WorldWideScience

Sample records for aquecimento por ar

  1. Utilização de desperdícios (latas de refrigerante) na captação de Energia Solar para o aquecimento de ar

    OpenAIRE

    Galvão, Constança

    2013-01-01

    Esta dissertação tem o intuito de apresentar um protótipo construído por Jorge Lourenço, em Olhão, Algarve, permitindo desta forma promover pistas para a criação de um novo produto vocacionado para o aproveitamento de Energia Solar Térmica para o aquecimento de ar. Assim, será analisado um painel solar que produz Energia Solar Térmica construído com latas de refrigerante e alguns materiais básicos de construção. Além de apresentar uma forma simples de se construir um Painel Solar Térmic...

  2. Desenvolvimento e construção de fornalha para biomassa com sistema de aquecimento direto e indireto do ar = Development and construction of a furnace for biomass with system of direct and indirect air heating

    Directory of Open Access Journals (Sweden)

    Fernanda Augusta de Oliveira Melo

    2010-07-01

    Full Text Available Uma fornalha, com opção para aquecimento direto e indireto de ar, foiprojetada e construída para utilizar, como combustível complementar à lenha, biomassa particulada, resíduo agroindustrial abundante e desperdiçado em boa parte. No intuito de verificar o funcionamento da fornalha, na opção de aquecimento direto e indireto, foram realizados três testes preliminares utilizando somente lenha como combustível. Nestes testes, avaliaram-se as temperaturas do ar ambiente, do ar aquecido na saída da fornalha e depois do ventilador, fluxo de ar, poder calorífico inferior e eficiência térmica. Com os dados obtidos nos testes, nas opções de aquecimento direto e indireto de ar, a fornalha mostrou-se flexível na opção de aquecimento, de fácil construção e operação, não exigindo mão-de-obra qualificada.A furnace, with a system for direct and indirect air heating, was projected and constructed to use biomass, particulate biomass, abundant and largely wasted agroindustrial refuse, as complementary fuel to firewood. With the objective of verifying furnace operation, in the option of direct and indirect heating, three preliminaries tests were conducted using only firewood as fuel. In these tests, the following variables were monitored: room air temperature, heated air temperature at the exit of the furnace and after the fan; room air relative humidity; warm air flow; lower calorific power and thermal efficiency of the furnace. In the tests the results showed, for both direct and indirect air heating, the furnace was shown to be flexible in the heating option, of easy construction and operation, not requiring skilled labor.

  3. PEDOLOGIA BRASILEIRA NA ANTÁRTICA: A PESQUISA DE SOLOS AFETADOS POR PERMAFROST NO CENÁRIO DO AQUECIMENTO GLOBAL

    Directory of Open Access Journals (Sweden)

    Thiago Torres Costa Pereira

    2015-09-01

    Full Text Available A Antártica representa um ambiente peculiar para formação de solos e estudo de muitos de seus processos, sendo que alguns dos quais possuem características atípicas. Solos afetados por permafrost são encontrados nas regiões árticas e subárticas, em altas montanhas e nas regiões livres de gelo da Antártica, e abrangem cerca de 13 % da cobertura terrestre. Atualmente, é inegável a influência do permafrost sobre os recursos hídricos, propriedades do solo, e desenvolvimento de vegetação. Além destes, uma série de questões estão relacionadas às mudanças no balanço de carbono, em reflexo à degradação do permafrost pelo aumento de temperatura. As quatro maiores regiões da Criosferano mundo são: Antártica, Oceano Ártico, as neves extrapolares e os ambientes montanhosos bastante frios. Mudanças na Criosferaem resposta ao aquecimento global são prováveis de serem observadas inicialmente em zonas de transição, em torno das extremidades de geleiras e camadas de gelo, e em áreas de permafrost, ambientes que em contrapartida, influenciam, mesmo que indiretamente, todas as superfícies da Terra. O debate sobre a possibilidade da ocorrência de aumento da temperatura global causado pelos gases do efeito estufa despertou atenção de pesquisadores sobre o estado de equilíbrio das grandes massas de gelo e permafrost presentes na Antártica. Outros fatores importantes envolvem as interações que influenciam diretamente as relações tróficas e rotas de transferência de matéria e energia entre o oceano e as áreas costeiras na Antártica. Nestes locais, existe grande aporte de materiais orgânicos depositados por aves, com destaque para os pinguins, sendo a incorporação destes materiais orgânicos à matriz mineral do solo a principal influência na caracterização dos solos ornitogênicos. Diante destes fatos, foram iniciados em 2002 os estudos pedológicos pelo então Projeto Criossolos, atual NúcleoTerrantar. Os

  4. Estudo comparativo de sistemas em aquecimento

    OpenAIRE

    Castro, Inês Marques Costa Borges de

    2013-01-01

    O presente estudo pretende avaliar o desempenho energético e rentabilidade do uso de equipamento de climatização para o aquecimento ambiente de uma casa sénior, através de sistemas tradicionais de produção de água aquecida, como a caldeira e a tradicional bomba de calor, e um sistema apoiado num equipamento de produção solar térmico. Perante uma determinada arquitectura, foram calculados os caudais de ar novo, de forma a garantir a qualidade do ar interior, cumprindo os requisitos da actua...

  5. Estudo do crescimento de nanofitas de céria dopada com gadolínio por sistema de aquecimento por micro-ondas

    Directory of Open Access Journals (Sweden)

    R. F. Gonçalves

    2013-09-01

    Full Text Available O óxido de cério (céria tem atraído atenção devido às suas importantes aplicações, como em células a combustível de óxido sólido, catalisadores de gases de exaustão de automóveis, catalisadores para a obtenção de hidrogênio, bloqueadores de raios ultravioleta, biomateriais, entre outros. Controlar os métodos de síntese da céria é de grande importância para explicar ou prever essas propriedades. Desta forma, o objetivo deste trabalho foi estudar o crescimento de nanofitas de óxido de cério em um sistema hidrotérmico assistido por micro-ondas, no qual 8 min foram obtidas nanofitas com comprimentos próximos a 330 nm, em 130 ºC e pressão de 3 atm. Os resultados colaboram para pesquisas em reformadores para obtenção de etanol e/ou anodos de células combustíveis de óxido sólido.

  6. Cinética de sinterização para sistemas à base de SnO2 por taxa de aquecimento constante Sintering kinetics for SnO2-based systems by constant heating rate

    Directory of Open Access Journals (Sweden)

    S. M. Tebcheran

    2003-04-01

    Full Text Available Cerâmicas densas de óxido de estanho são muito promissoras para aplicações tecnológicas como varistores e cadinhos de fusão de vidros corrosivos. Vários aditivos em pequenas concentrações podem ser usados como promotores de densificação desta cerâmica. No presente trabalho foram estudadas as cinéticas de sinterização do óxido de estanho, considerando o efeito de atmosfera de sinterização e da concentração de MnO2. Sistemas de SnO2-MnO2 foram preparados pelo método dos precursores poliméricos e os pós obtidos foram caracterizados por medidas de área de superfície específica (BET e por difração de raios X. Pós de SnO2 com concentrações variadas de MnO2 foram compactados de forma cilíndrica e sinterizados em dilatômetro com taxa de aquecimento constante e atmosferas controladas. Amostras sinterizadas foram caracterizadas por microscopia eletrônica de varredura. A influência da atmosfera (argônio, ar ou CO2 como também das concentrações de MnO2 na cinética de sinterização foram determinadas. Os dados cinéticos da retração linear foram analisados pelos modelos cinéticos para a fase inicial de sinterização (Woolfrey e Bannister como também para a sinterização global (Su e Johnson permitindo determinar a energia de ativação aparente. De acordo com a determinação da curva mestre de sinterização, a energia de ativação aparente de todo o processo de sinterização foi determinada bem como sua dependência com a atmosfera e concentrações de manganês. Baseado nestes valores e no expoente n, pode-se determinar, pela equação clássica de crescimento de grão, que o mecanismo de sinterização mais provável é de difusão por contorno de grão com redistribuição superficial controlando a cinética de sinterização.Dense tin oxide based ceramics are very promising for technological applications such as varistors and crucibles for melting very corrosive glasses. Several additives have been used

  7. Efeito da taxa de aquecimento na reversão da martensita induzida por deformação em um aço inoxidável austenítico do tipo ABNT 304 Influence of heating rate on the reversion of strain-induced martensite in AISI 304 austenitic stainless steel

    Directory of Open Access Journals (Sweden)

    Tiago Felipe de Abreu Santos

    2009-03-01

    Full Text Available Ensaios de tração foram realizados em corpos-de-prova de aço inoxidável austenítico, nas temperaturas de -50 e -10ºC e quantidades de deformação de 3 a 12%, com a finalidade de se obterem diferentes quantidades de fases martensíticas dos tipos e e a'. As martensitas induzidas por deformação foram caracterizadas quanto a sua morfologia, distribuição e quantidade por meio de análises metalográficas, dilatometria, e medidas com um detector de ferrita. As temperaturas de transformações reversas, ε→γ e α'→γ, foram determinadas por ensaios dilatométricos. A reversão das martensitas e e α' foi observada nas faixas de temperaturas de 50-200ºC e 500-800ºC, respectivamente. A taxa de aquecimento praticamente não influencia as temperaturas de reversão de ε→γ. A reversão da martensita α', ao contrário, mostrou-se dependente da taxa de aquecimento.Austenitic stainless steels specimens were deformed by tension from 0.03 to 0.12 of true strain at -50ºC and -10ºC, in order to obtain different volumetric fractions of e and α' strain induced martensites. The morphology, distribution and volumetric fractions of the strain induced martensites were characterized by metallography and dilatometry analysis and quantified by ferrite detector measurements. The reverse transformation temperatures of ε→γ and α'→γwere detected by dilatometry tests. The e and α' martensites reversion was observed in the temperature range of 50-200ºC and 500-800ºC, respectively. The heating rate did not influence the reversing of ε→α' temperatures but did affect the α'→γtransformation temperatures.

  8. Efeitos do resfriamento e aquecimento articular no desempenho funcional do ombro

    OpenAIRE

    Dayane de Oliveira Estevam; Marcelo Lima de Oliveira; Marcelo Lourenço da Silva; Leonardo César Carvalho; Daniel Ferreira Moreira Lobato

    2015-01-01

    INTRODUÇÃO: Um dos recursos mais utilizados na reabilitação de lesões musculoesqueléticas é a termoterapia por subtração de calor (crioterapia), enquanto a termoterapia por adição de calor é considerada o procedimento mais antigo de reabilitação física. Entretanto, há poucas evidências que tenham investigado os efeitos desses recursos sobre o desempenho de membros superiores. OBJETIVO: Comparar o efeito do resfriamento e do aquecimento articular sobre o desempenho funcional do membro superior...

  9. Controle de temperatura em intervenção cirúrgica abdominal convencional: comparação entre os métodos de aquecimento por condução e condução associada à convecção Control de temperatura en intervención quirúrgica abdominal convencional: comparación entre los métodos de calentamiento por conducción y conducción asociada a la convección Temperature control in conventional abdominal surgery: comparison between conductive and the association of conductive and convective warming

    Directory of Open Access Journals (Sweden)

    Marcelo Lacava Pagnocca

    2009-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Hipotermia intra-operatória é complicação frequente, favorecida por operação abdominal. A eficácia da associação dos métodos de aquecimento por condução e convecção na prevenção de hipotermia e seus efeitos no período de recuperação pós-operatória foram os objetivos deste estudo. MÉTODO: Quarenta e três pacientes de ambos os sexos de 18 a 88 anos de idade, submetidos à laparotomia xifopúbica sob anestesia geral e monitorização da temperatura esofágica, foram distribuídos de modo aleatório em dois grupos de aquecimento: COND (n = 24, com colchão de circulação de água a 37°C no dorso e COND + CONV (n = 19, com a mesma condição associada à manta de ar aquecido a 42°C sobre o tórax e membros superiores. Analisados peso, sexo, idade, duração da operação e anestesia, temperaturas na indução anestésica (Mi, horas consecutiva (M1, M2, final da operação (Mfo e anestesia (Mfa, entrada (Me-REC e saída (Ms-REC da recuperação pós-anestésica (SRPA, além das incidências de tremores e queixas de frio no pós-operatório. RESULTADOS: Os grupos foram semelhantes em todas as variáveis analisadas, exceto nas temperaturas em M2, M3, M4, Mfo e Mfa. O grupo COND reduziu a temperatura a partir da segunda hora da indução anestésica, mas o grupo COND + CONV só na quarta hora. Em COND, observou-se hipotermia na entrada e saída da SRPA. CONCLUSÕES: Associar métodos de aquecimento retardou a instalação e diminui a intensidade da hipotermia intra-operatória, mas não reduziu a incidência das queixas de frio e tremores.JUSTIFICATIVA Y OBJETIVOS: La Hipotermia intraoperatoria es una complicación frecuente, favorecida por la operación abdominal. La eficacia de la asociación de los métodos de calentamiento por conducción y convección en la prevención de hipotermia y sus efectos en el período de recuperación postoperatoria, fueron los objetivos de este estudio. M

  10. Efeitos do aquecimento e do alongamento na resposta neuromuscular dos isquiotibiais

    Directory of Open Access Journals (Sweden)

    João Felipe de Souza Nogueira

    2014-07-01

    Full Text Available INTRODUÇÃO: A preparação para a atividade esportiva frequentemente envolve aquecimento e/ou alongamento, no intuito de prevenir lesões e/ou melhorar o desempenho. No entanto, a maneira como essas práticas podem interferir nos mecanismos neuromusculares de controle articular não é clara. OBJETIVO: Analisar o efeito imediato do alongamento e do aquecimento, isolados ou associados, no tempo de latência muscular (TLM e na amplitude de ativação dos isquiotibiais, após perturbações repentinas da articulação do joelho. MÉTODOS: Sessenta voluntários do sexo feminino (média de idade de 22,3 ± 1,7 anos e IMC 21,4 ± 1,3 kg/cm2 foram divididas aleatoriamente em quatro grupos: (1 controle, (2 aquecimento, (3 alongamento, (4 aquecimento + alongamento. A atividade elétrica dos isquiotibiais foi captada por eletromiografia de superfície durante uma perturbação súbita do joelho. Um eletrogoniômetro detectou o início da variação angular, enquanto os eletrodos captaram o início e a amplitude da atividade muscular antes e após as intervenções. Como procedimento estatístico utilizou-se ANOVA two-way e post-hoc de Tukey, considerando-se como nível de significância p < 0,05. RESULTADOS: O TLM do bíceps femoral e do semitendíneo foi reduzido nos grupos 3 (p = 0,048 e 0,027, respectivamente e 4 (p = 0,026 e 0,039, respectivamente. Não houve alteração significativa da amplitude de ativação muscular nos grupos avaliados. CONCLUSÕES: Os dados do presente estudo sugerem que, embora não tenham sido observadas alterações na amplitude eletromiográfica, o alongamento passivo e estático, utilizado de forma isolada ou associado ao aquecimento, promoveu uma redução do TLM dos isquiotibiais. Essa redução pode vir a ser um fator de proteção de lesões musculares e articulares, após uma perturbação súbita, como as que ocorrem na prática desportiva.

  11. ANÁLISE DO DESEMPENHO TÉRMICO DE UM SISTEMA DE AQUECIMENTO SOLAR DE BAIXO CUSTO NA CIDADE DE MOSSORÓ (RN)

    OpenAIRE

    Fabiana Karla de Oliveira Martins Varella; Maria Izabel da Silva Guerra

    2014-01-01

    O presente trabalho estuda a possibilidade de instalação e utilização de um Sistema de Aquecimento Solar de Água Não Convencional e de Baixo Custo (SASncbc) na cidade de Mossoró/RN. Para isso, foi analisado o desempenho térmico de cada elemento que compõe o sistema de aquecimento solar separadamente, a fim de analisar o comportamento que os mesmos apresentaram na cidade em estudo. O SASncbc é composto por um coletor solar plano e um reservatório térmico, e o funcionamento desse sistema é real...

  12. Efeitos do resfriamento e aquecimento articular no desempenho funcional do ombro

    Directory of Open Access Journals (Sweden)

    Dayane de Oliveira Estevam

    2015-06-01

    Full Text Available INTRODUÇÃO: Um dos recursos mais utilizados na reabilitação de lesões musculoesqueléticas é a termoterapia por subtração de calor (crioterapia, enquanto a termoterapia por adição de calor é considerada o procedimento mais antigo de reabilitação física. Entretanto, há poucas evidências que tenham investigado os efeitos desses recursos sobre o desempenho de membros superiores. OBJETIVO: Comparar o efeito do resfriamento e do aquecimento articular sobre o desempenho funcional do membro superior. MÉTODOS: Trinta e quatro voluntários (22,23 ± 2,17 anos; 22,39 ± 2,53 kg/m2, de ambos os sexos, foram divididos aleatoriamente em um dos três grupos: 1 grupo crioterapia GCR (n=10: submetidos ao resfriamento articular por compressas frias; 2 grupo termoterapia - GTE (n=10: submetidos ao aquecimento articular por ondas curtas e 3 grupo controle - GCO (n=14, não submetidos a qualquer intervenção. Os voluntários foram avaliados, pré e pós-intervenção, quanto ao desempenho funcional de membros superiores por meio dos testes de estabilidade da extremidade superior em cadeia cinética fechada (TEESCCF e das condições de equilíbrio em apoio bimanual sobre o baropodômetro. Ainda, os voluntários foram avaliados quanto ao desempenho funcional virtual por meio do jogo Mario Kart (Nintendo Wii (r . RESULTADOS: Houve melhora significativa nos valores pós-intervenção no TEESCCF para o GCR (p0,05. Entretanto, na condição de olhos fechados, houve piora de desempenho para GTE (p=0,04 e melhora de desempenho para o GCO (p=0,02. Não houve alteração significativa no desempenho funcional virtual para os três grupos (p>0,05. CONCLUSÃO: Embora não tenha favorecido o desempenho funcional em todos os testes reais e virtuais utilizados, o resfriamento articular foi mais efetivo que o aquecimento articular para manter o desempenho muscular do membro superior, especialmente nas condições de equilíbrio sobre membros superiores na condi

  13. Toxicidad y teratogénesis por arsénico en aguas en el pez cebra (Danio rerio)

    OpenAIRE

    F Prieto García; OA Báez Ramírez; W Scout; JC Gaytán Oyarzún; A Zúñiga Estrada

    2007-01-01

    El objetivo del trabajo fue estudiar los daños teratogénicos y la inducción de micronúcleos en células branquiales de peces cebra (Danio rerio) por presencia de arsénico en las aguas. Fueron mantenidos en aguas bicarbonatadas cálcicas magnésicas de un pozo de referencia y del pozo Zimapán 5, del Municipio Zimapán, Estado de Hidalgo, México. Este último, con un contenido de arsénico que varía de 0,395-0,630 mg/L. Para el estudio de genotoxicidad se evaluaron durante 180 dí...

  14. Toxicidad y teratogénesis por arsénico en aguas en el pez cebra (Danio rerio)

    OpenAIRE

    F Prieto García; OA Báez Ramírez; W Scout; JC Gaytán Oyarzún; A Zúñiga Estrada

    2007-01-01

    El objetivo del trabajo fue estudiar los daños teratogénicos y la inducción de micronúcleos en células branquiales de peces cebra (Danio rerio) por presencia de arsénico en las aguas. Fueron mantenidos en aguas bicarbonatadas cálcicas magnésicas de un pozo de referencia y del pozo “Zimapán 5”, del Municipio Zimapán, Estado de Hidalgo, México. Este último, con un contenido de arsénico que varía de 0,395-0,630 mg/L. Para el estudio de genotoxicidad se evaluaron durante 180 días en 3 tratamiento...

  15. Enseñar probabilidad en primaria y secundaria? ¿Para qué y por qué?

    OpenAIRE

    Jímenez, Liliana; Jimenez, Rafael

    2005-01-01

    Este trabajo va dirigido a maestros y profesores de matemática. En él se exponen algunas reflexiones sobre la necesidad de abordar, en nuestros días, los conceptos de incertidumbre y probabilidad en la educación primaria y secundaria. Además se proponen algunos modelos de ejercicios que los introducen, con algunos comentarios didácticos para orientar el proceso. Por otra parte, se trata de provocar más discusión acerca de la importancia de enseñar el tema de probabilidad a nivel tanto de secu...

  16. Impacto de los sistemas de riego por goteo en arándanos Impact of drip irrigation systems in blueberries

    Directory of Open Access Journals (Sweden)

    Alejandro Pannunzio

    2011-01-01

    Full Text Available El ensayo examinó los efectos de diferentes sistemas de riego por goteo en el rendimiento de la variedad O´Neal de arándano (Vaccinium corymbosum L. El estudio se realizó en Zarate (33º 41’ S y 59º 41’ W, provincia de Buenos Aires, Argentina. El cultivo se implantó en agosto de 2001, la primera cosecha se efectuó en octubre de 2003. El objetivo fue determinar cual era el sistema de riego por goteo que maximizaba el rendimiento, siendo los tratamientos, un lateral de tubería de goteo por fila de plantas con goteros a 40 cm (T1 y dos laterales de tubería de goteo con goteros a 20 cm por fila de plantas (T2. El porcentaje de suelo mojado por sistema se incrementa a medida que aumenta el número de emisores por metro lineal. El diseño experimental fue de bloques completamente aleatorizados, con bloques de cinco plantas y cinco repeticiones por tratamiento. La cosecha de 2003, reportó rendimientos de 2436 kg ha-1 para el tratamiento T1 y de 4335 kg ha-1 para tratamiento T2. El mojado parcial del suelo que realiza el tratamiento T1, de menor cantidad de goteros por metro lineal, no es suficiente para mojar un porcentaje de suelo compatible con altos rendimientos.The experiment examined the effects of different drip irrigation systems in an O´Neal variety of blueberry (Vaccinium corymbosum L. It was contucted at Zarate (33º 41’ S and 59º 41’ W, Buenos Aires, Argentina. Plants of the experiment were planted in August of 2001, after one year in nursery. The first harvest was realized in October of 2003. The main scope of the experiment was to find the irrigation system which maximized yields. Treatments were: one drip irrigation line with drippers at 40 cm (T1 and two laterals with drippers at 20 cm per row (T2. The experiment was conducted in a completely randomized block design, each one with 5 plants and 5 replications. During the harvest of October and November of 2003, reported yields were 2436 kg ha-1 for the treatment T1 and

  17. ESCENARIOS CLIMÁTICOS PARA EL MONZÓN SUDAMERICANO: DETERMINADOS POR LOS MODELOS DE ACOPLAMIENTO DEL IPCC AR4

    Directory of Open Access Journals (Sweden)

    Andrés W. Burgoa Mariaca

    2008-01-01

    Full Text Available De los cinco modelos de cambio climático establecidos por el IPCC AR4 SRES A2 en el presente estudio, se eligen los modelos Ukmo_HadCM3 y el GISS-ER por brindar fuertes contrastes significativos en la distribución espacial de las precipitaciones en la parte central de la cuenca amazónica y la amazonía boliviana. Los modelos Ukmo_HadCM3 y Mpi-Echam5CM3 para el clima futuro en el escenario SRES A2, evidencian significativos constrastes en la vorticidad anticiclónica (ζ > 0 o Alta Boliviana. A su vez, la observación de la Corriente en Chorro de los Niveles Bajos (CCNB por dichos modelos, muestran semejanzas en el transporte de humedad de la Cuenca del Sahel africano hacia la Cuenca Amazónica, evidencióandose contrastes notorios en la parte noreste de la Cuenca del Plata.

  18. Aquecimento alfvênico viscoso-resistivo em discos de acresção ao redor de estrelas T Tauri clássicas

    Science.gov (United States)

    Santana, W. M.; Vasconcelos, M. J.

    2003-08-01

    Com a crescente disponibilidade de dados observacionais sobre estrelas T Tauri, a busca por modelos mais precisos vem se tornando cada vez maior. Estes modelos devem explicar, entre outras coisas, o mecanismo dissipativo responsável pelo transporte de momento angular no disco de acresção que acredita-se, circunda estas estrelas. O mecanismo mais viável, do ponto de vista teórico, é uma instabilidade MHD conhecida como "instabilidade magnetorotacional ou Balbus-Hawley" (IBH). Esta instabilidade veio mostrar que o campo magnético desempenha um papel importante na evolução destes objetos mas requer, no entanto, um acoplamento mínimo entre o gás e o campo magnético no disco que não é atingido para os valores de temperatura obtidos do modelo padrão. Contudo, alguns mecanismos de aquecimento para o disco precisam ser examinados. Neste trabalho, propomos a dissipação de ondas Alfvén como uma fonte de aquecimento para o disco. Se o gás apresentar uma condutividade elétrica finita e viscosidade, teremos um tipo de amortecimento para as ondas denominado amortecimento viscoso-resistivo que será aqui considerado. Este mecanismo é aplicado ao modelo de disco em camadas. Calculam-se as taxas de aquecimento Alfvênico, a temperatura efetiva do disco bem como as taxas de ionização decorrentes deste aquecimento e do aquecimento gerado pela absorção de raios cósmicos. Comparações com os dados observacionais de Kitamura et. al. (2001) são efetuadas, ressaltando-se os pontos comuns entre suas observações e nossos dados teóricos.

  19. Por que Melipona scutellaris (Hymenoptera, Apidae forrageia sob alta umidade relativa do ar?

    Directory of Open Access Journals (Sweden)

    Marília D. e Silva

    2011-06-01

    Full Text Available Há evidências de que a temperatura do ar e a umidade relativa afetam a atividade de voo de espécies de abelhas sociais Meliponini. Em particular, as espécies grandes do gênero Melipona Illiger, 1806 responderiam de maneira mais estreita à variação na umidade relativa. Neste estudo defende-se o argumento de que a umidade relativa seja uma variável de confusão. Nesta linha de argumentação, também foi analisado o papel da coleta de pólen sobre o ritmo diário de forrageio. A robusta Melipona scutellaris (Latreille, 1811 foi usada como modelo e a atividade diária de voo e de forrageio de pólen foi medida em 12 colônias (4 colônias/hábitat, em três tipos de hábitats, que variam principalmente quanto à pluviosidade, na área de distribuição natural desta espécie (Floresta Pluvial, Floresta Sazonal e Transição Floresta Tropical-Cerrados. A maioria da atividade de voo acontece durante a manhã. A atividade de forrageio das colônias foi mais elevada nas primeiras horas do alvorecer, quando a umidade relativa também era alta, frequentemente associada a picos de coleta de pólen. A atividade de voo decresceu abruptamente durante as temperaturas altas ao redor do meio dia. A relação da atividade de voo com a umidade relativa foi altamente significativa e linear, contrastando com a relação significativa e unimodal com a temperatura. Na relação com o forrageio de M. scutellaris, a umidade relativa se configura como uma variável contingente, em hábitats tropicais úmidos, considerando os padrões diários de variação do microclima e de forrageio de pólen. Este último padrão também sustenta a hipótese de partição temporal de fontes florais de pólen.

  20. Uso de controlador PID como tecnologia eficiente em sistema de aquecimento de creche suína

    Directory of Open Access Journals (Sweden)

    Juliana de S. G. Barros

    2015-05-01

    Full Text Available O uso racional de energia elétrica em creches suínas pode ser viabilizado sem afetar o desempenho produtivo dos animais visando à sustentabilidade do setor razão por que o objetivo deste trabalho foi avaliar a eficiência de duas tecnologias de controle de temperatura em sistema de aquecimento resistivo em creche suína, no uso de energia elétrica e no ganho de peso dos leitões. Os sistemas avaliados foram: resistências elétricas suspensas com controle PID (proporcional, integral e derivativo e resistências elétricas suspensas com termostato. O experimento foi realizado durante o período de inverno, entre maio e setembro de 2013. Os critérios de comparação foram: consumo de energia elétrica (kWh, consumo específico (kWh kg-1, custo específico (R$ kg-1, indicador de eficiência elétrica no aquecimento, ganho de peso (kg e ganho de peso diário (kg d-1. O sistema de aquecimento com controlador PID, apesar de apresentar maior consumo médio, foi mais eficiente quanto ao uso de energia elétrica para produzir 1 kg de peso vivo (2,88 kWh kg-1, quanto ao custo específico (0,75 R$ kg-1 e quanto ao ganho de peso dos leitões (7,3 kg em comparação com o sistema com termostato (3,98 kWh kg-1, 1,03 R$ kg-1 e 5,2 kg, respectivamente.

  1. Riesgos de los residuos de minería: intoxicación intencional en vacuno por arsénico inorgánico

    Directory of Open Access Journals (Sweden)

    F Soler Rodríguez

    2012-01-01

    Full Text Available Las intoxicaciones por arsénico en los animales domésticos han sido una de las principales causas de intoxicación, especialmente en el ganado vacuno, aunque han ido disminuyendo desde la prohibición de muchos de sus compuestos y actualmente son anecdóticas. En este trabajo se presenta un caso de intoxicación intencional en ganado vacuno ocurrido en una explotación de Barruecopardo (Salamanca. Siete vacas nodrizas se vieron afectadas, muriendo cuatro de ellas, con un cuadro caracterizado por apatía, postración, pérdida de apetito, intensas diarreas, normotermia y disnea. En la necropsia se observaron fenómenos congestivos y equimosis en corazón y aparato digestivo, y úlceras perforantes en la pared del abomaso. Ante la sospecha de una posible intoxicación por arsénico, se analizaron muestras de hígado y riñón encontrando unos niveles de 13,57 y 8,65 mg/kg respectivamente, que confirmaron el diagnóstico clínico inicial. Un polvo grisáceo, insoluble en agua, que contenía arsénico en una proporción del 65,24 % (652,4 x 103 mg/kg había sido depositado intencionadamente en el suelo donde se colocaba el alimento para el ganado. En el mismo cercado se produjo la muerte de 15 ovejas con un cuadro clínico similar. Este artículo resulta especialmente interesante debido a la ausencia de casos intencionados confirmados de intoxicación por arsénico en rumiantes. Se incide en la importancia del peligro de los residuos abandonados de minería cuando el arsénico es uno de los subproductos comerciales obtenidos.

  2. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  3. Aprendizaje por refuerzo seguro para enseñar a un robot humanoide a caminar más rápido

    OpenAIRE

    Acera Bolaños, Daniel

    2013-01-01

    Enseñar a un robot humanoide a caminar es un problema abierto y desafiante. Los comportamientos clásicos de caminar habitualmente requieren la puesta a punto de muchos parámetros de control (longitud de paso, velocidad, frecuencia, etc). Encontrar una configuración inicial o básica de estos parámetros no es complicado, pero optimizarla para un objetivo (por ejemplo, caminar rápido) no es tan sencillo, ya que puede hacer caer al robot humanoide provocando daños, en caso de un...

  4. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    OpenAIRE

    Francisco Prieto García; María de Los Ángeles Lechuga Vargas; María Aurora Méndez Marzo; Enrique Barrado Esteban; Juan Carlos Ggaytán Oyarzún

    2006-01-01

    Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS), mediante generador de hidruros (GH). En este estudio se utilizó el Vicia faba como un bioensayo para evaluar...

  5. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    2006-03-01

    Full Text Available Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS, mediante generador de hidruros (GH. En este estudio se utilizó el Vicia faba como un bioensayo para evaluar el daño genotóxico con la prueba de inducción de micronúcleos por exposición al agua de Zimapán, contaminada con As en células de raíces. Se utilizó como ensayo de control un agua de pozo de similares características del municipio de Pachuca, pero con contenidos de As por debajo de los límites de detección. Los resultados mostraron que el agua de esta región presenta altas concentraciones de arsénico y que puede provocar efectos genotóxicos que se manifiestan por la inducción de micronúcleos en las células meristemáticas de raíces de tejidos vegetales sensible.Estudos feitos no período de 1992-1998 nas águas dos poços da municipalidade de Zimapán, estado do Hidalgo, México, demostram o aumento na concentração de arsênio ultrapassando os limites máximos permissíveis pela norma oficial mexicana. A determinação de arsênio nas amostras de água foi feita por absorção atômica (AA, por meio do gerador de hidruros (GH. Neste estudo, o Vicia faba foi usado como bioensaio para avaliar os danos genotóxicos com o teste da indução dos micronúcleos pela exposição à água de Zimapán, contaminada com arsênio em células de raízes. Como controle, foi usada uma água com similares características, do município de Pachuca, mas com índices abaixo dos limites de detecção. Os resultados mostraram que a água desta região apresenta altas concentrações de arsênico e que os efeitos genotóxicos manifestam-se pela

  6. Secagem de café cereja descascado por ar quente e microondas Drying pulped coffee cherry beans by means of hot air ond microwaves

    Directory of Open Access Journals (Sweden)

    M.L. Cunha

    2003-12-01

    Full Text Available Este trabalho objetivou estudar a viabilidade de produzir café cereja descascado seco pela aplicação de microondas para assistir a secagem convencional a ar quente, a fim de reduzir o tempo de processo, com o aumento do rendimento industrial e da qualidade do produto perante os métodos tradicionais de secagem. Dois ciclos de secagem foram testados: a processo em secador rotativo convencional a ar quente, com umidade do produto reduzida de 45-50 a 11-13% b.u.; b processo subdividido em uma primeira etapa de pré-secagem convencional a ar quente de 45-50 a 30% b.u., seguida de etapa de secagem final por ar quente e microondas, com redução de 30 a 11-13% b.u. de umidade do produto. O tempo global do primeiro para o segundo ciclo de secagem foi reduzido de 15 a 37,5 para pouco mais de 10 horas, respectivamente. A qualidade sensorial do produto foi avaliada pela "prova da xícara", complementada por análises de microscopia eletrônica de varredura (MEV, com resultados satisfatórios. Um estudo preliminar dos aspectos econômicos envolvidos na ampliação de escala para uma linha industrial de processamento de café com a inclusão de um sistema a microondas foi também delineado.This research concerns a process development study focussing the application of microwaves to pulped coffee cherries production, in order to reduce the drying time and increase the industrial yield and product quality when compared to conventional drying processes. Two drying cycles were tested: a a hot air drying process using a conventional batch rotary dryer from 45-50 to 11-13% w.b. product moisture; b a two stage process, whereby the product was pre dried with hot air from 45-50 to 30% w.b., followed by a final microwave and hot air drying stage, to reduce product moisture from 30 to 11-13% w.b. The overall drying time was reduced from 15 to 37.5 hours to about 10 hours, respectively. The sensory quality of the product was evaluated by the "cup test", complemented

  7. Contaminación por Arsénico en Acuíferos de Catalunya (España)

    OpenAIRE

    Ventura Houle, René

    2015-01-01

    El arsénico (As) es una de las 10 sustancias químicas que la Organización Mundial de la Salud (OMS) considera más preocupantes para la salud pública y además es uno de los elementos más tóxicos que pueden ser encontrados en el medio ambiente, es carcinogénico, genera alteraciones en el sistema digestivo e inmunológico, entre otras afecciones. Debido a los procesos naturales de interacción en la geoquímica de las aguas subterráneas, estas son proclives a presentar concentraciones de As de...

  8. Sistema de aquecimento solar das piscinas da C. M. de Penacova e respectivas I. S.

    OpenAIRE

    Oliveira, Mário Jorge Simões

    2014-01-01

    Apesar dos sucessivos programas de apoio que têm vindo a ser disponibilizados para a instalação de sistemas de aquecimento solar, muitas piscinas municipais aquecidas não possuem este tipo de aproveitamento de energia solar. Assim sendo, verificam-se elevados custos de exploração, resultantes, em grande parte, de exagerados consumos de energia. Estes gastos podem ser minimizados com a adoção de diversas medidas de redução energética, nomeadamente a inclusão de um sistema de aquecimento solar,...

  9. Características del aceite de semillas de Cucurbita pepo L. microencapsulado mediantesecado por aspersión con maltodextrina y goma arábiga

    OpenAIRE

    López H., Orestes Darío; Márquez Conde, Tania; Mayo A., Orestes; Toledo S., Carlos; Pérez S., Enma

    2009-01-01

    Para elaborar una forma sólida de administración oral a partir del extracto lipídico de las semillas de Cucurbita pepo L. usado en el tratamiento de la hiperplasia benigna prostática, la alternativa de la microencapsulación ofrece una solución para modificar su estado físico. Las microcápsulas obtenidas mediante secado por aspersión, empleando maltodextrina y goma arábiga como encapsulantes, alcanzándose más de un 80% en cuanto a eficiencia de encapsulación. Se verificó la forma esférica y...

  10. PLATA Y CASTAÑAR (VILLAVERDE, MADRID. UN EJEMPLO DE INTERVENCIONES EN EL BORDE DE LA CIUDAD. URBANISMO POR Y PARA EL REALOJO

    Directory of Open Access Journals (Sweden)

    Antonio J. Palacios García

    2009-01-01

    Full Text Available En las ciudades españolas todavía persisten un buen número de áreas que presentan una serie de carencias urbanísticas, sociales, económicas, ambientales u otras. Es lo que se conoce como barrios desfavorecidos urbanos. Para esta aportación se analiza el caso de una zona del sur metropolitano madrileño como es la de Plata y Castañar. En dicho barrio vamos a tratar de desentrañar el proceso de sustitución y creación de la edificación existente, los problemas acontecidos durante el desarrollo de la intervención, sus dificultades y las herramientas empleadas. Un área donde se ha intervenido frente al desfavorecimiento de forma sectorial, sobre un único elemento, el espacio construido. Aún a costa de la persistencia en el tiempo de otras graves carencias (fundamentalmente de tipo social. Una forma de intervenir muy criticada por cuanto supone la agrupación en un mismo territorio de una población desfavorecida.

  11. Tratamento de efluente de refinaria de óleo de soja por sistema de flotação por ar dissolvido Treatment of efluents of soybean oil refnery by dissolved air flotation

    OpenAIRE

    Juliana Cecchet; Benedito M. Gomes; Ricardo N. Costanzi; Simone D Gomes

    2010-01-01

    Propôs-se, neste trabalho, avaliar o desempenho de coagulantes combinados a três tipos de polieletrólitos (aniônico, catiônico e não iônico), através de Flotação por Ar Dissolvido (FAD), no tratamento de efluentes de refinaria de óleo de soja. O experimento, conduzido em escala de laboratório, ensejou não apenas encontrar, pelos diagramas de coagulação, a melhor faixa de pH e a melhor concentração de coagulante mas, também, as dosagens e os tipos de floculante, culminando em sua dosagem ótima...

  12. Aquecimento global: efeitos no crescimento, no desenvolvimento e na produtividade de batata Global warming: effects on growth, development, and yield of potato

    Directory of Open Access Journals (Sweden)

    Joelma Dutra Fagundes

    2010-06-01

    Full Text Available A concentração atmosférica dos gases do efeito estufa, principalmente o CO2, tem aumentado nas últimas décadas devido às atividades antrópicas. A concentração de CO2 aumentou de aproximadamente 280 partes por milhão por volume (ppmv no período pré-industrial para a atual concentração de 380 ppmv. Há registros que, durante o século XX, houve um aumento da temperatura média da superfície global de 0,6±(0,2°C, e projeções indicam um provável aumento de 1,1 a 6,4°C na temperatura média global até o final do século XXI, dependendo da região do planeta. O aumento da concentração de CO2 e da temperatura afeta diretamente processos fisiológicos, como fotossíntese e respiração das plantas, o que poderá alterar o desempenho das culturas, incluindo a batata. O objetivo desta revisão foi reunir informações da literatura sobre os possíveis efeitos do aumento na concentração de CO2 e da temperatura do ar no crescimento, no desenvolvimento e na produtividade da cultura de batata. O aumento do CO2, seguido de aumento na temperatura do ar, de maneira geral, resultará em menor crescimento, redução na duração do ciclo de desenvolvimento, menor produtividade e aumento da incidência de doenças da batata. Como estratégia para minimizar os efeitos de um possível aquecimento global sobre essa cultura, sugere-se que sejam desenvolvidas cultivares tolerantes a altas temperaturas, adaptadas as épocas de plantio em cada local, alteradas as práticas de manejo da cultura e até expandidas as áreas de cultivo para regiões mais frias.The concentration of atmospheric greenhouse gases, mainly the CO2, has increased in the last decades due to anthropogenic activities. The atmospheric CO2 concentration has increased from about 280 parts per million per volume (ppmv in the pre-industrial period to the currently 380ppmv concentration. There are reports that during the XX century global average temperature increased 0.6±(0.2

  13. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    Directory of Open Access Journals (Sweden)

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  14. Dimensões psicológicas do aquecimento global conforme a visão de adolescentes brasileiros

    Directory of Open Access Journals (Sweden)

    Hellen Chrystianne Lucio Barros

    2013-06-01

    Full Text Available Evidências científicas sugerem o envolvimento das ações humanas nas mudanças climáticas globais (MCGs - seja como intensificadoras, mitigadoras ou adaptadoras diante dos seus efeitos - situação que evidencia a relevância de se investigar os aspectos psicológicos envolvidos no tema. O objetivo deste estudo foi investigar a visão de adolescentes sobre o aquecimento global (AG, que é uma parte importante das MCGs. Participaram 323 estudantes do Ensino Fundamental e Médio, sendo 202 garotas e 121 rapazes, com idades entre 12 e 19 anos, e média de 15 anos, que responderam a um questionário, contendo uma pergunta aberta sobre AG. Evidenciou-se que o conhecimento do assunto é superficial; os estudantes o percebem como um problema ambiental genérico, e o confundem com outros problemas, como a poluição. A cadeia interdependente de fenômenos relacionados às MCGs, como os gases do efeito estufa, foi mencionada por raríssimos participantes, assim como as implicações locais do problema.

  15. Impact of global warming on beef cattle production cost in Brazil Impacto do aquecimento global no custo de produção de carne bovina no Brasil

    Directory of Open Access Journals (Sweden)

    Irenilza de Alencar Nääs

    2010-02-01

    decréscimo da capacidade de pastagens (RP em função das mudanças no índice pluviométrico total, na temperatura do ar e na extensão da estação de seca; e (ii o desenvolvimento de um algoritmo para predição do decréscimo da produção em função de um modelo fuzzy de RP que resulte no impacto na produtividade bovina de corte e conseqüente aumento no custo de produção. Foram organizados os dados históricos de fatores ambientais dos municípios importante produção no Cerrado e um conjunto de funções Gaussianas fuzzy foi desenvolvido e três estimativas possíveis (otimista, média e negativa foram consideradas. O decréscimo na produtividade do gado foi estimado usando as perdas de produção devido ao acréscimo da temperatura bem como da vulnerabilidade da capacidade de pastagem. O estabelecimento dos limites para o cenário do acréscimo do custo de produção usou o número de unidade animal por área de pastagem, a adoção de suplemento de grãos e o cenário de produção futura; e o resultado da função de saída apontou para uma variação do acréscimo do custo de produção de 80% (otimista até 160% (pessimista. Sob o cenário otimista, o custo total da produção brasileira de carne bovina no Cerrado chega a US$ 2,88 kg-1, enquanto no cenário pessimista este custo pode atingir US$ 4,16 kg-1, o que pode comprometer a competitividade internacional do setor.

  16. Aviary heating: control of air temperature heated by a set biomass gasifier-combustor in a co-current flow, using a frequency inverter; Aquecimento de aviarios: controle da temperatura do ar aquecido por um conjunto gaseificador-combustor de biomassa de fluxo concorrente, utilizando um inversor de frequencia

    Energy Technology Data Exchange (ETDEWEB)

    Santos, William Rosario dos [Universidade Presidente Antonio Carlos (UNIPAC), Ponte Nova, MG (Brazil); Silva, Jadir Nogueira; Oliveira Filho, Delly; Martins, Marcio Aredes; Oliveira, Jofran Luiz de [Universidade Federal de Vicosa (UFV), MG (Brazil)], Emails: jadir@ufv.br, delly@ufv.br, aredes@ufv.br, jofran.oliveira@ufv.br

    2009-07-01

    One of the problems with using the gasifier for heating purposes in poultry facilities is the waste of energy during the day, once the equipment does not have control of the thermal and power generated. During this period, the difference in temperature between the air and the standard for the birds inside the building is lower than when compared with the nocturnal period. During the day, the temperature inside the poultry house is controlled by curtains, which occurs without diminishing the biomass burning. Another way to control the temperature is the shutdown of the system, which requires the constant attention of the operator. In this way, there is a potential for energy savings if the thermal power could be controlled according to the demand, which can be represented by the temperature gradient. The purpose of this study was to control the temperature of exhaustion air from a set combustor-gasifier (down draft), based on the model developed by Martin et al. (2006), through the control of speed of the fan engine and also controlling the flow contributions of primary and secondary air in the combustor. The experiment was carried out in the Energy and Pre-processing of Agricultural Products areas, at the Department of Agricultural Engineering - Federal University of Vicosa. (author)

  17. Diferentes aquecimentos no desempenho de repetições máximas na musculação

    Directory of Open Access Journals (Sweden)

    Danilo Atanázio da Luz Junior

    2014-12-01

    Full Text Available Introdução: Apesar do aquecimento ser considerado essencial na prática dos esportes, pouco se conhece sobre seu efeito no treinamento de força. Objetivo: Avaliar o efeito de diferentes estratégias de aquecimento no desempenho neuromuscular em adultos jovens submetidos a testes de repetições máximas de membro superior e inferior. Métodos: Dois experimentos foram realizados separadamente. Para o primeiro experimento, 16 adultos jovens hígidos realizaram um teste de repetições máximas a 70% de 1RM no supino reto (previamente determinado. Quatro condições de aquecimento foram testadas: Controle (CON sem aquecimento prévio, esteira (EST 5' a 60% VO2max, resistência de força (REF 15 repetições com 40% de 1RM e força máxima (FM duas séries de duas repetições com 90% de 1RM. Para o segundo experimento, 14 adultos jovens hígidos, realizaram um teste de repetições máximas a 70% de 1RM no leg press unilateral (previamente determinado. Cinco condições de aquecimento foram testadas: controle (CON sem aquecimento prévio, esteira (EST 5' a 60% VO2max, bicicleta (BIC 5' a 60% VO2max, resistência de força (REF 15 repetições com 40% de 1RM e força máxima (FM duas séries de duas repetições com 90% de 1RM. Para ambos os experimentos o número de repetições realizadas e a percepção subjetiva de esforço foram avaliadas. Resultados: Para o primeiro experimento o protocolo FM foi superior a todos os outros protocolos. Não foram observadas diferenças entre as outras condições. Para o segundo experimento, foi observado diferenças entre todos os protocolos, exceto CON e EST. Sendo FM>BIC>REF>EST=CON. Conclusão: Os resultados do presente estudo sugerem que um aquecimento de força máxima levou a uma maior produção de força para os membros superiores e inferiores. Adicionalmente, aquecimentos aeróbios e de resistência de força apresentaram melhora no desempenho de força para os membros inferiores em uma menor

  18. Metodología para diseñar un producto alimenticio por medio de la identificación de los factores que influyen en la decisión de compra

    OpenAIRE

    Pedro Vargas Aguilar; Elba Cubero Castillo; Arie Lang Gutowski

    2014-01-01

    Se desarrolló una metodología para identificar los factores que influyen en la decisión de compra de un producto alimenticio con la cual la información obtenida se utiliza para diseñar y reproducir productos de alta gama de consumo. Inicialmente se definieron los parámetros que se evaluarán para establecer la metodología, y se estudió su efectividad en una salsa de tomate de corte popular. Por medio de encuestas, en los restaurantes de comida rápida se determinó la relación existente entre el...

  19. Tratamento de efluente de refinaria de óleo de soja por sistema de flotação por ar dissolvido Treatment of efluents of soybean oil refnery by dissolved air flotation

    Directory of Open Access Journals (Sweden)

    Juliana Cecchet

    2010-01-01

    Full Text Available Propôs-se, neste trabalho, avaliar o desempenho de coagulantes combinados a três tipos de polieletrólitos (aniônico, catiônico e não iônico, através de Flotação por Ar Dissolvido (FAD, no tratamento de efluentes de refinaria de óleo de soja. O experimento, conduzido em escala de laboratório, ensejou não apenas encontrar, pelos diagramas de coagulação, a melhor faixa de pH e a melhor concentração de coagulante mas, também, as dosagens e os tipos de floculante, culminando em sua dosagem ótima. Para tanto, parâmetros, como tempo e gradiente de mistura rápida (1 min / 150 s-1, tempo e gradiente de mistura lenta (10 min / 40 s-1 - 5 min / 20 s-1, pressão na câmara de saturação (450 kPa e velocidade ascensional (1,67 cm min-1 foram usados para a fase da flotação nos ensaios. Após o término dos ensaios, amostras do efluente tratado foram utilizadas para comparativo com o efluente bruto, obtendo-se um grau de remoção de demanda química de oxigênio (DQO de 93,7 e 95,1% e de óleos e graxas (O&G de 94,2 e 99,8% para os ensaios 1 e 2, respectivamente. Apesar de sua excelente eficiência de remoção, o efluente tratado não apresentou características de reúso em torres de resfriamento, haja vista que sua DQO ficou muito acima de 75 mg L-1 O2.The aim of this work was to evaluate the performance of coagulants combined with three polyelectrolytes (anionic, cationic and non ionic using dissolved air flotation (DAF in the treatment of effluents of the soybean oil refinery. This study was conducted at laboratory-scale to find, through the coagulation diagram, the best limits of pH and coagulant concentration. With those limits, the dosage of flocculants was varied to achieve the optimum dosage. For that, some parameters were fixed: time and rapid mix gradient (1 min and 150 s-1, time and slow mix gradient (10 min and 40 s-1 - 5 min and 20 s-1, pressure in saturation chamber (450 kPa and ascension velocity (1.67 cm min-1 for two

  20. Treatment of Bothrops alternatus envenomation by Curcuma longa and Calendula officinalis extracts and ar-turmerone Tratamento local do envenenamento por Bothrops alternatus com extrato de Curcuma longa e Calendula officinalis e ar-turmerone

    Directory of Open Access Journals (Sweden)

    M.M. Melo

    2005-02-01

    Full Text Available It was investigated the efficiency of two extracts of plants and one fraction of their properties against the local effects of bothropic envenomation. Bothrops alternatus venom (1.25µg diluted in 100µl of sterile saline solution was inoculated (intradermally into the shaved dorsal back skin of 30 New Zealand rabbits. The animals were divided in six groups receiving the following treatments: group I: subcutaneous application of Curcuma longa extract (1.0ml; group II: topic treatment of Curcuma longa hydroalcoholic extract (1.0ml; group III: topic application of ar-turmerone in vaseline (1.0g; group IV: topic application of Curcuma longa methanolic extract (1.0ml; group V: topic application of Calendula officinalis ointment (1.0g; group VI: topic application of saline (1.0ml. These treatments were done at 30 minutes, and at 2, 4, 24 and 72 hours after venom inoculation. Intensity of local edema, hemorrhagic halo and necrosis were evaluated until 168h after that. Additionally, seven days after the Bothrops venom inoculation, blood was collected from heart with and without EDTA (10% for hemogram and biochemical parameters (total protein, blood urea nitrogen, creatinine, and fibrinogen and all the animals were anesthetized, sacrificed by ether inhalation and submitted to necropsy. Fragments of tissues were taken for histopathological evaluation. The most efficient treatment for inhibition of edema, necrosis and local hemorrhage after Bothrops alternatus venom was the topic application of ar-turmerone.Investigou-se a eficácia do extrato de plantas no tratamento local do envenenamento botrópico. Veneno de serpentes Bothrops alternatus (1,25µg diluído em 100µl de solução salina estéril foi inoculado (via intradérmica entre as escápulas de 30 coelhos. Os animais foram divididos em seis grupos (tratamentos: grupo I: tratamento subcutâneo com extrato de Curcuma longa; grupo II: tratamento tópico com extrato hidroalcoólico de Curcuma longa

  1. Desempenho produtivo e bioeconômico de frangos de corte criados em diferentes sistemas de aquecimento Productive and bioeconomical performance of broiler chicks grown under different heating systems

    Directory of Open Access Journals (Sweden)

    Paulo Giovanni de Abreu

    2000-02-01

    Full Text Available RESUMO - Este experimento foi realizado em duas fases para estudar o efeito de diferentes sistemas de aquecimento em piso sobre os desempenhos produtivo e bioeconômico de frangos de corte. Um total de 500 pintos de um dia, 50% macho e 50% fêmea, em cada círculo de proteção, foi distribuído em um delineamento experimental em blocos casualizados, com sete tratamentos e quatro blocos. Os sistemas de aquecimento testados foram: placa de fibra de vidro sem cobertura de lona plástica; placa de fibra de vidro com cobertura de lona plástica; resistência embutida no piso sem cobertura de lona plástica; resistência embutida no piso com cobertura de lona plástica; placa de argamassa armada sem cobertura de lona plástica; placa de argamassa armada com cobertura de lona plástica; e campânula a gás. O aquecimento foi mantido por 21 dias, iniciando com a temperatura de 35ºC na primeira semana, com redução de 3ºC por semana. Peso vivo, ganho de peso, consumo de ração, conversão alimentar e mortalidade foram avaliados. Os consumos de energia elétrica e de gás foram registrados durante todo o período de aquecimento, para comparação de custos. O sistema de aquecimento placa de argamassa com cobertura de lona plástica foi o mais indicado, pois propiciou boas condições térmicas e maior margem bruta no final do período de criação.ABSTRACT - This experiment was carried out in two phases to study the effect of different heating systems on the productive and bioeconomical performances in broilers. Five hundred one-day broiler chicks, 50% male and 50% female, in each protected circle, were allotted to a randomized block design with seven treatments and four blocks. The heating systems were: fiber glass plate without plastic sheet cover, fiber glass plate with plastic sheet cover; built-in floor resistance without plastic sheet cover, built-in floor resistance with plastic sheet cover; mortar plate without plastic sheet cover, mortar

  2. Behavior of Eucalyptus grandis and E. cloeziana seedlings grown in arsenic-contaminated soil Comportamento de mudas de E. grandis E. eucalyptus cloeziana cultivadas em solo contaminado por arsênio

    Directory of Open Access Journals (Sweden)

    Roseli Freire Melo

    2010-06-01

    Full Text Available Arsenic has been considered the most poisonous inorganic soil pollutant to living creatures. For this reason, the interest in phytoremediation species has been increasing in the last years. Particularly for the State of Minas Gerais, where areas of former mining activities are prone to the occurrence of acid drainage, the demand is great for suitable species to be used in the revegetation and "cleaning" of As-polluted areas. This study was carried out to evaluate the potential of seedlings of Eucalyptus grandis (Hill Maiden and E. cloeziana F. Muell, for phytoremediation of As-polluted soils. Soil samples were incubated for a period of 15 days with different As (Na2HAsO4 doses (0, 50, 100, 200, and 400 mg dm-3. After 30 days of exposure the basal leaves of E. cloeziana plants exhibited purple spots with interveinal chlorosis, followed by necrosis and death of the apical bud at the 400 mg dm-3 dose. Increasing As doses in the soil reduced root and shoot dry matter, plant height and diameter in both species, although the reduction was more pronounced in E. cloeziana plants. In both species, As concentrations were highest in the root system; the highest root concentration was found in E. cloeziana plants (305.7 mg kg-1 resulting from a dose of 400 mg dm-3. The highest As accumulation was observed in E. grandis plants, which was confirmed as a species with potential for As phytoextraction, tending to accumulate As in the root system and stem.O arsênio (As tem sido considerado o poluente inorgânico de solo mais tóxico para os seres vivos, razão pela qual o interesse por espécies indicadoras e fitorremediadoras tem aumentado nos últimos anos. Particularmente para o Estado de Minas Gerais, que apresenta áreas remanescentes de atividade mineradora sujeitas à ocorrência de drenagem ácida, existe grande demanda por espécies com potencial para serem utilizadas na revegetação e "limpeza" de substratos contaminados por esse metaloide. Este

  3. Análise de um sistema de aquecimento de água para residências rurais, utilizando energia solar A water heating system analysis for rural residences, using solar energy

    Directory of Open Access Journals (Sweden)

    Luiz H. Basso

    2010-02-01

    Full Text Available A conscientização da importância do meio ambiente tem incentivado o estudo de novas fontes energéticas renováveis e menos poluentes. Dentre essas fontes, a energia solar destaca-se por ser perene e limpa. A utilização da energia solar em sistemas de aquecimento de água residencial rural pode colaborar com a economia de energia elétrica, base da matriz energética brasileira. Conhecer os fatores que influenciam na operação de um sistema de aquecimento de água por energia solar é importante na determinação de sua viabilidade técnica, visando a sua difusão em residências rurais. Para tanto, construiu-se um protótipo, no câmpus da Faculdade Assis Gurgacz, em Cascavel - PR, com características similares a um equipamento utilizado em residências para dois habitantes, para funcionar com circulação natural ou termossifão e sem auxílio de sistema de aquecimento complementar. O equipamento mostrou-se viável tecnicamente, alcançando a temperatura mínima para banho de 35 °C, sempre que a radiação solar foi superior a 3.500 Wh m-2, o que aconteceu para a maioria dos dias estudados.The awareness of the importance of the environment has stimulated the study of new renewed energy sources and less pollutant. Amongst these sources, solar energy stands alone for being perennial and clean. The use of solar energy in systems of agricultural residential water heating, can complement the economy of electric energy, base of the Brazilian energy matrix. Knowing the factors that influence the operation of a system of water heating by solar energy is important in determining their technical viabilities targeting their distribution in agricultural residences. To evaluate equipment of water heating for solar energy, a prototype was constructed in the campus of Assis Gurgacz College, in Cascavel,State of Paraná, Brazil, with similar characteristics to equipment used in residences for two inhabitants, to function with natural circulation or

  4. Microclima de abrigos escamoteadores para leitões submetidos a diferentes sistemas de aquecimento no período de inverno Microclimate of creep for piglets submitted to different systems of heating during the winter period

    Directory of Open Access Journals (Sweden)

    Héliton Pandorfi

    2005-03-01

    Full Text Available O objetivo desta pesquisa foi avaliar a eficiência dos diferentes sistemas de aquecimento em abrigos escamoteadores para leitões. Foi desenvolvida na sala da maternidade, com 80 animais entre o nascimento e o desmame, adotando-se 4 diferentes sistemas de aquecimento: piso térmico, lâmpada incandescente, resistência elétrica e lâmpada infravermelha. As variáveis ambientais foram registradas no ambiente externo, sala da maternidade e no interior de cada abrigo escamoteador avaliado, ao longo de 18 dias. Para avaliação zootécnica foram registrados ganho de peso diário (GPD e mortalidade. A análise técnico-econômica foi feita considerando-se o consumo de energia elétrica e o GPD dos animais. O delineamento experimental foi em blocos casualizados com 4 tratamentos e 18 blocos. Os sistemas de aquecimento apresentaram diferenças significativas para temperatura de bulbo seco umidade relativa do ar (UR, e para os índices de conforto, carga térmica radiante e entalpia, sendo que os tratamentos que se mostraram mais adequados, do ponto de vista térmico e técnico-econômico, foram lâmpada incandescente e resistência elétrica.The general objective of this research was to evaluate the efficiency of different systems of heating in creep for piglets. The experiment was conducted in a commercial swine production farm, located in Elias Fausto city, in the State of São Paulo. The research was developed in the farrowing house, with 80 animals between the birth and weanning, adopting 4 different heating systems: heat mat, standard heating lamp, electrical resistance and infrared lamp. The ambient variables were observed inside and outside the farrowing house and inside each studied creep, during 18 days. For animal production evaluation of daily weight gain and mortality were registered too. The techno-economic analysis was made considering the consumption of electric energy and the weight gained by animals. The statistical design of the

  5. Inspeção termográfica de danos por impacto em laminados de matriz polimérica reforçados por fibras de carbono Thermographic inspection of impact damage in carbon fiber-reinforcing polymer matrix laminates

    Directory of Open Access Journals (Sweden)

    José R. Tarpani

    2009-01-01

    Full Text Available Laminados compósitos com matrizes poliméricas, respectivamente termorrígida e termoplástica, fortalecidas com fibras contínuas de carbono foram submetidos a impacto único transversal com diferentes níveis de energia. Os danos impingidos aos materiais estruturais foram avaliados por termografia ativa infravermelha na modalidade transmissão. Em geral, os termogramas do laminado termoplástico apresentaram indicações mais claras e bem definidas dos danos causados por impacto, se comparados aos do compósito termorrígido. O aquecimento convectivo das amostras por fluxo controlado de ar quente se mostrou mais eficaz que o realizado por irradiação, empregando-se lâmpada de filamento. Observou-se também que tempos mais longos de aquecimento favoreceram a visualização dos danos. O posicionamento da face impactada do espécime, relativamente à câmera infravermelha e à fonte de calor, não afetou a qualidade dos termogramas no caso do laminado termorrígido, enquanto que influenciou significativamente os termogramas do compósito termoplástico. Os resultados permitiram concluir que a termografia infravermelha é um método de ensaio não-destrutivo simples, robusto e confiável para a detecção de danos por impacto tão leve quanto 5 J em laminados compósitos poliméricos reforçados com fibras de carbono.Continuous carbon fiber reinforced thermoset and thermoplastic composite laminates were exposed to single transversal impact with different energy levels. The damages impinged to the structural materials were evaluated by active infrared thermography in the transmission mode. In general, the thermoplastic laminate thermograms showed clearer damage indications than those from the thermosetting composite. The convective heating of the samples by controlled hot air flow was more efficient than via irradiation using a filament lamp. It was also observed that longer heating times improved the damage visualization. The positioning of the

  6. Eliminación de arsénico mediante flotación por adsorción coloidal utilizando flóculos de Fe(OH3 en un sistema de flotación por aire disuelto

    Directory of Open Access Journals (Sweden)

    Pavez, O.

    2009-04-01

    Full Text Available In the present work, the influence of Fe/As ratio on the As removal, from aqueous solutions, applying flotation by colloidal adsorption was studied. Ferric chloride was used as coagulant and dodecil sulfate as collector, and arsenic trioxide was utilized to preparing the solutions. The obtained results show that the highest arsenic removal was accomplished in the range of pH between 4 and 5,5, and the increasing of the initial concentration of Fe(III, increases the removal of arsenic from the solution. However, with the decreasing of the initial concentration of arsenic in the solution, it is required a larger Fe/As ratio for its removal. For solutions containing: 13,73, 1,71 and 0,105 mg/L of arsenic, it was shown that to remove around 95% of the dissolved arsenic, a Fe/As ratios of approximately 6/1, 18/1 and 800/1, respectively, are required.

    En el presente trabajo se estudió el efecto de la relación Fe/As sobre la eliminación de arsénico aplicando flotación por adsorción coloidal en aguas con distintos contenidos de arsénico. Como coagulante se utilizó cloruro férrico y dodecil sulfato de sodio como colector, y las soluciones fueron preparadas con trióxido de arsénico. Los resultados obtenidos muestran que el rango de pH 4-5,5 es el más adecuado para la eliminación de arsénico, aumentando el porcentaje de eliminación con el incremento de la concentración inicial de Fe(III en la solución. Por otra parte, a medida que disminuye la concentración inicial de arsénico en la solución se requiere una mayor proporción de Fe/As para su eliminación. Además, se mostró que para soluciones conteniendo 13,73 mg/l, 1,71 mg/l y 0,105 mg/l de As, se necesitan relaciones Fe/As de 6:1, 18:1 y 800:1 para lograr una eliminación de arsénico desde la solución del orden de 95 %.

  7. ¿Por qué enseñar a escribir usando técnicas de "Focus on Form"?

    Directory of Open Access Journals (Sweden)

    Rosa Mª Lucha Cuadros

    2006-05-01

    Full Text Available El estudio que aquí presentamos aborda los siguientes temas: 1. Indaga acerca de si una enseñanza intensiva centrada en la forma induce o no a obtener resultados más positivos en la adquisición, al menos en la memoria a corto plazo, de estructuras lingüísticas significativas; en nuestro caso estructuras para comparar y expresar ventajas e inconvenientes. 2. Permite postular la efectividad del uso de herramientas informáticas para evaluar la “calidad de información” (Díaz y Ruggia 2004 de producciones escritas. Las herramientas utilizadas han sido, por un lado, el analizador-etiquetador Connexor, y, por otro lado, el software Childes (MacWhinney 1987, formado por diferentes programas informáticos, que permite la cuantificación automática de la frecuencia de aparición de categorías sintácticas elegidas previamente. En la investigación participaron dos grupos de estudiantes del programa Erasmus de la Universitat Pompeu Fabra. El primer grupo recibió una enseñanza intensiva centrada en la forma tras la cual realizó una tarea de expresión escrita consistente en la redacción de un texto expositivo. El segundo grupo realizó la misma tarea de expresión escrita, pero sin la previa instrucción centrada en la forma. //// The present study analyses the effectiveness of instructed second language teaching through focus on form in a group of learners compared with a control group. Written production was elicited through a final task after refreshing grammar and lexis content in the experimental group while the control just did the final task. The final product of both students’ groups was analysed with semiautomatic processors (Childes and Connexor and the patterns resulting compared and evaluated separately. Data show that the experimental group, which underwent treatment, did perform more native-like than the control group.

  8. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  9. Analysis of a solar water thermosyphon system; Analise do aquecimento solar de agua por sistema a termosifao

    Energy Technology Data Exchange (ETDEWEB)

    Cardenas, Abner Barzola

    1992-07-01

    A design methodology and to perform the simulation of flat plate solar collectors coupled with a water storage tank and operating by natural convection circulation is presented. For a given site the incident solar radiation on a tilted and previously oriented surface is determined from solar astronomy and the dally average of the monthly data of the horizontal total solar radiation. Huancayo situated in Peru (at 12.05 deg S, long. 76.18 deg W, altitude 3,312 m), is chosen as the site to be installed the solar water system, as a mean to improve the peasant's standard of life. An optimum tilt angle for a north oriented collector surface is obtained in order to have a maximum solar capture during the water. The theoretical methodology use here is based upon the ONG's paper (1976), and in attrition is considered the hot water drainage due to the dally consumption. For the sake of comparison, the calculated flowrate values are confronted with the experimental data obtained by FERNANDEZ, for a same site location (Rio de Janeiro) and are used identical dimensions for the water thermosyphon heater. Finally, the economic feasibility of the solar water system is demonstrated when it is compared with the usual immersion electric resistance boiler. For the Peruvian conditions the more adequate solar water system for a rural or domestic usage is a 1.4 m{sup 2} area solar collector (6 parallel, 15,875 mm copper tubes), 100 l capacity for the water storage tank, 33.5 mm for the connecting tubes, being of 300 mm. The height between the collector top and the bottom of the tank. (author)

  10. Sistema automatizado de aquecimento solar para controle de fitopatógenos da água de irrigação Automatic solar heating system for control of pathogens in irrigation water

    Directory of Open Access Journals (Sweden)

    Carlos A. da S. Braga

    2001-05-01

    Full Text Available O sistema automatizado de aquecimento solar, baseou-se em um processo misto de aquecimento da água em circuito fechado, através de coletores planos e dois princípios integrados de transmissão de calor, um por convecção natural e o outro por convecção forçada. A automatização foi realizada por monitores termostáticos diferenciais. Os testes normativos abrangeram as temperaturas programadas de 50, 55 e 60 ºC, que contemplam a faixa de temperatura letal para a maioria dos fitopatógenos. Os resultados indicaram rendimentos térmicos da ordem de 63, 55 e 52%, superiores, quando comparados aos rendimentos médios de 50, 47 e 45% dos sistemas convencionais. Os resultados experimentais mostraram que o sistema é eficiente para a eliminação de patógenos da água de irrigação, sendo promissor como uma opção de baixo custo para ser usado em viveiros, casas-de-vegetação e pequenas ou médias propriedades agrícolas.In the system proposed, which uses flat collectors, both natural and forced convection are responsible for the transfer of heat to the circulating water. The automation of the system is performed by thermostats, placed in different places, electrically connected to other components like valves and a water pump. Under identical test conditions and in the range of temperatures considered (50, 55 and 60 ºC, which includes the reference lethal temperature range for pathogens, the thermal efficiencies attained were 63, 55 and 52%, which compare favorably with those obtained in conventional systems, these being 50, 47 and 42% respectively, as reported. The results of the experimental trials show that the system described is a viable option to eliminate pathogens present in irrigation water, while its low cost makes it attractive for use in nurseries, greenhouses and on small farms.

  11. Mecanismos anatômicos e fisiológicos de plantas de aguapé para a tolerância à contaminação por Arsênio Anatomical and physiological mechanisms of water hyacinth plants to Arsenic contamination tolerance

    OpenAIRE

    F.J. Pereira; E.M. de Castro; Oliveira, C.; M.F. Pires; Pasqual, M.

    2011-01-01

    Este trabalho teve como objetivo a avaliação das características anatômicas e fisiológicas de aguapé (Eichhornia crassipes) em resposta ao estresse por arsênio. As plantas de aguapé foram cultivadas em solução nutritiva hidropônica de Hoagland em casa de vegetação sob cinco concentrações de arsênio: 0,0; 0,25; 0,5; 1,0; e 2,0 mg L-1 por período de 20 dias. As plantas demonstraram aumento na taxa fotossintética, na condutância estomática, na transpiração e na relação Ci/Ca, bem como na ativida...

  12. Global warming in Amazonia: impacts and Mitigation Aquecimento Global na Amazônia: impactos e Mitigação

    Directory of Open Access Journals (Sweden)

    Philip Martin Fearnside

    2009-01-01

    climate change, Brazil must assume the leadership in fighting global warming.O aquecimento global tem impactos potencialmente catastróficos na Amazônia, e, ao mesmo tempo, a manutenção da floresta amazônica oferece uma das opções mais valiosas e baratas para mitigar as mudanças climáticas. Nós sabemos que o fenômeno de El Niño, causado por uma oscilação da temperatura da superfície da água no Pacífico, tem impactos sérios na Amazônia, causando secas e incêndios florestais, como aconteceram em 1997-1998. Oscilações de temperatura no Atlântico também provocam secas severas, como em 2005. Nós também sabemos que árvores amazônicas morrem, tanto do fogo como do estresse hídrico sob condições quentes e secas. Além disso, a água reciclada pela floresta fornece chuva que mantém as condições climáticas apropriadas para floresta tropical, especialmente durante a estação seca. O que nós precisamos saber com urgência, por meio de pesquisa intensificada, inclui como representar melhor o El Niño e as oscilações no Atlântico, nos modelos climáticos, como representar as retroalimentações bióticas nos modelos usados para tomada de decisão sobre o efeito estufa, e um estreitamento da gama das estimativas da sensitividade climática (para reduzir a incerteza sobre a probabilidade de impactos muito severos. Assuntos que precisam ser negociados incluem a definição de mudança de clima "perigosa", com os correspondentes níveis máximos das concentrações de gases de estufa na atmosfera. Mitigação do efeito estufa tem que incluir a manutenção da floresta amazônica, o que traz benefícios para o combate ao efeito estufa por meio de dois papéis separados: diminuir o fluxo de emissões de carbono que acontece em cada ano devido ao ritmo rápido do desmatamento, e evitar a emissão do estoque de carbono na floresta restante que pode ser liberada de várias maneiras, inclusive por causa da própria mudança climática. Barreiras impedindo a

  13. O currículo na e da enfermagem: por onde começar e recomeçar El currículo en la y de la enfermería: por donde comenzar y recomenzar Nursing curriculum: witch way to commence and to recommence

    Directory of Open Access Journals (Sweden)

    Dulce Maia Silva Vendrúscolo

    1996-01-01

    Full Text Available Este estudo apóia-se na premissa de que toda prática educacional se faz baseada em pressupostos de natureza filosófica e pedagógica, representando o currículo, a visão de mundo percebida pela escola e seus professores. A questão orientadora desta investigação assim se coloca: Qual a percepção do professor sobre as concepções curriculares norteadoras do currículo de graduação de enfermagem? Participaram da pesquisa 36 professores de 9 escolas paulistas de enfermagem que responderam à entrevista formulada a partir da técnica do Diferencial Semântico. As concepções-educacionais, tradicionalista, cognitiva, comportamentalista, de auto-realização e de reconstrução social, orientaram esta análise. Os resultados da pesquisa expressaram as preferências dos sujeitos para posturas educacionais de caráter humanístico e social, demonstrando haver, entretanto, a orientação ora para postura mais renovadoras, ora para mais tradicionais, caracterizando não haver uma concepção predominante na orientação do currículo. A realidade curricular da enfermagem demonstra a existência de um plurarismo de posturas filosóficas e pedagógicas na orientação do ensino de graduação, sendo estas opções, muitas vezes, resultantes das aspirações e dos ideais do próprio professor atribuídos ao processo educacional vigente na enfermagem.Este estudio se apoya en la premisa de que toda práctica educacional se hace fundamentada en presupuestos de naturaleza filosófica y pedagógica, representando el currículo, la visión de mundo percibida por la escuela e sus profesores. La orientación de esta investigación así se coloca: Cual es la percepción del profesor acerca de las concepciones curriculares norteadora del currículo de pre-grado de Enfermería? Parciparon de la investigación 36 profesores de 9 escuelas paulistas de Enfermería que respondieron a la entrevista formulada a partir de la técnica del Diferencial Sem

  14. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  15. Global warming and climate changes in the view of adults living in cities of São Paulo State AQUECIMENTO GLOBAL E MUDANÇAS CLIMÁTICAS NA VISÃO DE ADULTOS RESIDENTES EM CIDADES PAULISTAS

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Tavares

    2011-10-01

    Full Text Available ABSTRACT This study was conducted through interviews in mid-2009, in the cities of São Bernardo do Campo, Santo Antonio de Posse, Pederneiras and Tapiratiba, located in São Paulo State, Brazil. The aim was to evaluate if the population had information about the global warming and climate changes. In case of an affirmative answer, the main sources of information that they had access were identified and also their personal views on this controversial subject today. Regarding the climate changes and its causes and consequences, it was found that people acquire more information through television and internet, which is worrying, given that the facts disclosed by the television networks and the worldwide computers network, are often alarmist and lacking scientific foundation. Keywords: Global Warming. Climate Changes. State Policy on Climate Changes. Media. Mitigation Measures.RESUMO Este trabalho, por meio de entrevistas realizadas em meados de 2009, nas cidades de São Bernardo do Campo, Santo Antonio de Posse, Pederneiras e Tapiratiba, localizadas no Estado de São Paulo, Brasil. O objetivo foi avaliar se a população tinha informações a respeito do aquecimento global e mudanças climáticas. Em caso de uma resposta afirmativa, procurou-se conhecer as principais fontes de informação a que teve acesso e suas posições pessoais diante de um assunto polêmico na atualidade. Verificou-se que sobre mudanças climáticas, suas causas e conseqüências, as pessoas ainda adquirem mais informações na televisão e na internet, o que é preocupante, haja vista que os fatos divulgados pelas redes televisivas e pela rede mundial de computadores são, muitas vezes, alarmistas e desprovidos de fundamentos científicos. Palavras-chave: Aquecimento Global. Mudanças Climáticas. Política Estadual de Mudanças Climáticas. Mídia. Medidas Mitigadoras.

  16. Tropical agriculture and global warming: impacts and mitigation options Agricultura tropical e aquecimento global: impactos e opções de mitigação

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo P. Cerri

    2007-02-01

    Full Text Available The intensive land use invariably has several negative effects on the environment and crop production if conservative practices are not adopted. Reduction in soil organic matter (SOM quantity means gas emission (mainly CO2, CH4, N2O to the atmosphere and increased global warming. Soil sustainability is also affected, since remaining SOM quality changes. Alterations can be verified, for example, by soil desegregation and changes in structure. The consequences are erosion, reduction in nutrient availability for the plants and lower water retention capacity. These and other factors reflect negatively on crop productivity and sustainability of the soil-plant-atmosphere system. Conversely, adoption of "best management practices", such as conservation tillage, can partly reverse the process - they are aimed at increasing the input of organic matter to the soil and/or decreasing the rates at which soil organic matter decomposes.O uso intensivo da terra invariavelmente causa efeitos negativos ao ambiente e produção agrícola se práticas conservativas não forem adotadas. Redução na quantidade de matéria orgânica do solo significa emissão de gases (principalmente CO2, CH4, N2O para a atmosfera e aumento do aquecimento global. A sustentabilidade do solo é também afetada, uma vez que a qualidade da matéria orgânica remanescente muda. Alterações podem ser verificadas, por exemplo, pela desagregação do solo e mudança na sua estrutura. As consequências são erosão, redução na disponibilidade de nutrientes para as plantas e baixa capacidade de retenção de água no solo. Estes e outros fatores refletem negativamente na produtivade das culturas e sustentabilidade do sistema solo-planta-atmosfera. Ao contrário, a adoção de boas práticas de manejo, tal como o sistema plantio direto, pode parcialmente reverter o processo, uma vez que objetiva o aumento das entradas de material orgânico no solo e/ou diminuição das taxas de decomposi

  17. Arsenic phytoextraction and hyperaccumulation by fern species Fitoextração e hiperacumulação de arsênio por espécies de samambaias

    Directory of Open Access Journals (Sweden)

    Maria Isidoria Silva Gonzaga

    2006-02-01

    Full Text Available Arsenic (As is an ubiquitous trace metalloid found in all environmental media. Its presence at elevated concentrations in soils derives from both anthropogenic and natural inputs. Arsenic is a toxic and carcinogenic element, which has caused severe environmental and health problem worldwide. Technologies currently available for the remediation of arsenic-contaminated sites are expensive, environmentally disruptive, and potentially hazardous to workers. Phytoextraction, a strategy of phytoremediation, uses plants to clean up contaminated soils and has been successfully applied to arsenic contaminated soils. It has the advantage of being cost-effective and environmentally friendly. A major step towards the development of phytoextraction of arsenic-impacted soils is the discovery of the arsenic hyper accumulation in ferns, first in Pteris vittata, which presented an extraordinary capacity to accumulate 2.3% arsenic in its biomass. Another fern, Pityrogramma calomelanos was found to exhibit the same hyperaccumulating characteristics. After that, screening experiments have revealed that the Pteris genus is really unique in that many species have the potential to be used in phytoextraction of arsenic. In general, these plants seem to have both constitutive and adaptive mechanisms for accumulating or tolerating high arsenic concentration. In the past few years, much work has been done to understand and improve the hyperaccumulating capability of these amazing plants. In particular, the field of molecular biology seems to hold the key for the future of the phytoremediation.O arsênio e um metalóide traço encontrado basicamente em todos os ambientes. Elevadas concentrações de arsênio no solo podem acontecer naturalmente devido ao intemperismo de rochas ricas em arsênio, como também de atividades antropogênicas. O arsênio é um elemento tóxico e cancerígeno. Em muitas partes do mundo, a contaminação pelo arsênio tem causado problemas

  18. Compostagem como fonte térmica de energia para aquecimento de água na aqüicultura = Composting as thermal source of energy for heating the water in the aquaculture

    Directory of Open Access Journals (Sweden)

    César Ademar Hermes

    2005-07-01

    Full Text Available O objetivo deste trabalho foi utilizar a compostagem como fonte térmica de energia na manutenção de organismos aquáticos. A região de Toledo possui temperatura média anual do ar de 20,5ºC e média no trimestre quente de 27ºC e no frio de 16,5ºC. O material experimental utilizado consistiu de caixas de água, tubos de alumínio, feno degramínias, esterco de aves e suínos, compressores de aquário, mangueiras e tubos, pedras porosas, alevinos de tilápia e termômetro. Foram monitoradas as temperaturas do ar, do composto, da água com e sem aquecimento pelo composto. As temperaturas médias foram de 20,9ºC e 31,1ºC, para o ar e o composto, respectivamente. A diferença de peso entre os alevinos foi de 24,0%. Concluiu-se que a compostagem pode ser uma fonte de energia térmica na aqüicultura.The objective of this work is to use the composting as thermal energy source in the maintenance of aquatic organisms. The area of Toledo possesses annual medium temperature of the air of 20.5ºC and average in the hottest quarter of 27ºC and in the more cold of 16.5ºC. The experimental material consisted of boxes of water, pipes of aluminum,hay of grassy, manure of birds and swine, aquarium compressors, hoses and pipes, porous stones, fish lingers, and thermometer. The temperatures of the air, the composition, and the water without heating were monitored. The medium temperatures obtained were 20.9ºCand 31.1ºC for the air and the composition, respectively. The temperature averages of the water with heating and without heating were 22.0ºC and 20.0ºC. The weight difference among the fish lingers was 24.0%. The conclusion is that the composting can be a thermalsource of energy in the aquaculture.

  19. Mecanismos anatômicos e fisiológicos de plantas de aguapé para a tolerância à contaminação por Arsênio Anatomical and physiological mechanisms of water hyacinth plants to Arsenic contamination tolerance

    Directory of Open Access Journals (Sweden)

    F.J. Pereira

    2011-06-01

    Full Text Available Este trabalho teve como objetivo a avaliação das características anatômicas e fisiológicas de aguapé (Eichhornia crassipes em resposta ao estresse por arsênio. As plantas de aguapé foram cultivadas em solução nutritiva hidropônica de Hoagland em casa de vegetação sob cinco concentrações de arsênio: 0,0; 0,25; 0,5; 1,0; e 2,0 mg L-1 por período de 20 dias. As plantas demonstraram aumento na taxa fotossintética, na condutância estomática, na transpiração e na relação Ci/Ca, bem como na atividade de todas as enzimas do sistema antioxidante, com maior atividade nas folhas em relação às raízes nos tratamentos contendo arsênio. As características anatômicas das folhas das plantas sob as maiores concentrações de arsênio mostraram aumento na densidade estomática, no índice estomático e na espessura do parênquima esponjoso. A anatomia radicular não evidenciou alterações decorrentes da intoxicação por arsênio e modificações nas características do xilema e floema, porém não houve prejuízos à sua estrutura e função. Dessa forma, o estresse por intoxicação pelo arsênio, nas concentrações testadas, não é evidente nas plantas de E. crassipes, e os mecanismos de tolerância são relacionados com modificações na anatomia e fisiologia das plantas.This work aimed to evaluate the anatomical and physiological characteristics of Eichhornia crassipes in response to arsenic stress. Plants of E. crassipes were grown in Hoagland hydroponic nutritive solution under greenhouse conditions at five arsenic levels: 0.0, 0.25, 0.50, 1.0 and 2.0 mg L-1 during 20 days. The plants showed an increase in photosynthetic rate, stomatal conductance, transpiration and Ci/Ca rate, as well as in the activity of all the enzymes in the antioxidant system, with higher activity in the leaves than in the roots, in all the treatments with arsenic. The anatomical characteristics observed on the leaves of the plants under higher

  20. Updraft biomass gasification reactor evaluation of fuel; Reator de gaseificacao de biomassa em fluxo contra corrente para aquecimento de ar de secagem

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Ivanildo da S. dos; Silva, Jadir N. da; Martins, Marcio A. [Universidade Federal de Vicosa (UFV), MG (Brazil)], Emails: ivanildomt@gmail.com, jadir@ufv.br, aredes@ufv.br

    2010-07-01

    Searching for a clean hot air from biomass for on farm applications, a gasification/combustion system was designed, built and evaluated. The system consisted of a countercurrent gasifier, coupled with a combustion chamber that burns the producer gas, and eucalyptus firewood was used as a fuel. Willing to reduce heat losses from the unit as well as to prevent thermal hazardous the unit was totally covered with brick's wall. Initial unit thermal efficiency was of about 56% and it reaches up to 71% at recharge. It was concluded that this system attended the proposed objectives, producing clean hot air that can be used for drying purposes as well as ambient space heating. (author)

  1. Potential of macrophyte for removing arsenic from aqueous solution Potencial de remoção de arsênio de solução aquosa por macrofita

    Directory of Open Access Journals (Sweden)

    F.P. Guimaraes

    2012-12-01

    estudo, com vistas à seleção de plantas para remediação de ambientes contaminados com arsênio (As. Os experimentos foram conduzidos em casa de vegetação durante seis dias, em vasos contendo solução Hoagland (¼ força iônica e As nas concentrações de 0,5; 2,5 e 5,0mgL-1. As três espécies mostraram acúmulo crescente de As tanto quanto a concentração do metalóide na solução foi aumentada. No entanto, foi detectada redução no ganho de massa fresca e seca quando as plantas foram expostas a altas concentrações de As. As três espécies de macrófitas mostraram diferenças na eficiência de remoção de As na solução. A. caroliniana, S. minima e L. gibba acumularam, em média, 0,130, 1,200 e 1,397mgmDM-1 de As, respectivamente, quando expostas a 5,0mgL-1. As macrófitas absorveram maior quantidade de As na solução com baixo índice de fosfato. Quanto maior a concentração de As nos tecidos da L. gibba, menor foi o conteúdo de clorofila e carotenoide, mostrado pela alta incidência de clorose. Lemna gibba também apresentou diminuição no tamanho da folha e As não afetou a síntese total de clorofila e carotenoide em A. caroliniana. Esta espécie apresentou folhas arroxeadas com alta concentração de antocianina cuja presença sugere associação à deficiência de fosfato. A necrose marginal ocorreu nas folhas flutuantes de S. minima, e as plantas-filha não mostraram nenhum sintoma visual. A porcentagem de As removida da solução pelas plantas foi reduzida quando estas foram expostas a altas concentrações do poluente. Das três espécies estudadas, somente L. gibba pode ser considerada como hiperacumuladora de As, porém sua utilização para remediar ambientes aquáticos contaminados com As mostrou-se limitada e exige investigação mais aprofundada.

  2. Evaluación del comportamiento de arsénico, cobre, plomo y zinc en suelos afectados por el vertido de la mina de Aznalcóllar (Sevilla, España)

    OpenAIRE

    Sarria Carabalí, Margarita María

    2013-01-01

    Después del accidente de la mina de Aznalcóllar, los suelos afectados fueron sometidos a medidas de remediación para disminuir la contaminación generada principalmente por As, Cu, Pb y Zn, encontrándose que después de 6 años seguían teniendo problemas (Simón et al., 2009). Por lo anterior, se hizo un muestreo en tres perfiles de suelos contaminado (SC), remediado (SR) y no contaminado (SNC, no afectado por el vertido) en el sector “Puente de las Doblas” a los diez años de ocurrido el accident...

  3. Sobre la conveniencia de diseñar y producir un sistema distribuido de preservación digital por replicación para las tesis doctorales generadas en las universidades españolas

    OpenAIRE

    Ferrer Gutiérrez, Ángeles

    2015-01-01

    Los sistemas distribuidos de preservación digital ?a menudo llamados sistemas en la nube, pese a que técnicamente se basan en servidores alojados en las propias instituciones? son una solución ya real y económica para la preservación de recursos digitales que puedan ser considerados críticos por nuestras instituciones. Las principales técnicas o mecanismos de preservación radican en la replicación de los datos en lugares geográficamente dispersos (para substituir las copias defectuosas por...

  4. Avaliação de controles PID adaptativos para um sistema de aquecimento resistivo de água Evaluation of adaptive PID controls for a resistive system of heating water

    Directory of Open Access Journals (Sweden)

    Maria Isabel Berto

    2004-09-01

    Full Text Available O trabalho consiste na implementação de um controle convencional PID/SISO-feedback para obter um ajuste fino na temperatura de entrada da água de aquecimento em um processo de pasteurização. Para isto utilizou-se uma resistência de 2500 Watts instalada na linha do fluido secundário da seção de aquecimento do pasteurizador e um Pt100 para a medição de sua temperatura. Como o comportamento desta temperatura em função de uma mesma perturbação degrau de potência na resistência é dependente da vazão de trabalho, objetivou-se encontrar um controle único para que a mesma fosse mantida no set-point desejado na faixa de operação de vazão da água do processo (300 a 700L/h. Três sintonias para o controlador adaptativo PID foram testadas: a primeira consistiu na implementação de uma função adaptativa dos parâmetros PID, ajustada através dos valores individuais obtidos para cada vazão de trabalho conforme metodologia da curva de reação do processo; a segunda consistiu em configurar os parâmetros do PID com os valores médios destes calculados individualmente para cada vazão, e a terceira consistiu na sintonia através de uma função adaptativa ajustada pelos parâmetros de sintonia obtidos pela metodologia de Aström & Hägglund. A avaliação do desempenho das sintonias dos controladores adaptativos foi realizada por comparação dos valores dos índices de erro, obtidos por perturbações do sistema em malha fechada na vazão de água. Os resultados obtidos mostraram que dentre as sintonias testadas, a terceira sintonia, popularmente conhecida como "Bang-Bang", apresentou menores oscilações e os menores valores dos índices de erros.The aim of this work is to implement a conventional PID/SISO feedback control to obtain a fine adjustment of the water inlet temperature at a pasteurization process. For that, a resistance of 2500 Watts and a Pt100 to measure the temperature were installed in the water inlet line of the

  5. Influência do resfriamento e do aquecimento local na flexibilidade dos músculos isquiotibiais Influence of local cooling and warming on the flexibility of the hamstring muscles

    Directory of Open Access Journals (Sweden)

    JS Brasileiro

    2007-02-01

    Full Text Available OBJETIVO: O propósito deste estudo foi analisar os efeitos do resfriamento e do aquecimento sobre a flexibilidade dos músculos isquiotibiais, observando os efeitos agudos e crônicos. MÉTODOS: Quarenta voluntários foram aleatoriamente incluídos em um dos quatro grupos (n=10: 1 grupo controle; 2 grupo alongamento (técnica sustentar-relaxar para os músculos isquiotibiais, por duas semanas consecutivas; 3 grupo alongamento precedido da aplicação de crioterapia (25 minutos na região posterior da coxa e 4 grupo alongamento precedido de aquecimento com diatermia por ondas curtas (25 minutos. A avaliação da flexibilidade muscular foi realizada através de uma prancha acoplada a um sistema de goniometria, especialmente preparada para avaliar o ângulo extensor do joelho. RESULTADOS: Os três grupos experimentais aumentaram significativamente a ADM em relação ao grupo controle. Os ganhos médios diários, considerados efeitos agudos, mostraram diferenças significativas em favor do grupo submetido ao resfriamento, quando comparado aos demais (aumento de 2,6 ± 0,9°, 4,3 ± 1,5° e 2,4 ± 0,7° para os grupos 2, 3 e 4, respectivamente, p= 0,008. Em relação aos efeitos crônicos, não foi observada diferença significativa entre os três grupos experimentais, embora todos diferiram do controle (aumento de 1,5 ± 0,5°, 11,1 ± 6,1°, 14,4 ± 5,4° e 14,4 ± 6,2°, para os grupos 1, 2, 3 e 4, respectivamente. CONCLUSÕES: Sessões de alongamento, aplicadas diariamente, aumentaram significativamente a flexibilidade dos músculos isquiotibiais. Os efeitos agudos foram maiores no grupo submetido ao resfriamento, quando comparado aos grupos somente alongado ou aquecido. Os efeitos crônicos não foram influenciados pelo aquecimento nem pelo resfriamento.OBJECTIVE: The aim of this study was to analyze the acute and chronic effects of cooling and warming on hamstring muscle flexibility. METHOD: Forty volunteers were randomly included in one of

  6. ¿Por qué enseñar métodos de investigación en las facultades de biblioteconomía y documentación?

    OpenAIRE

    Delgado López-Cózar, Emilio

    2001-01-01

    Se pretende demostrar por qué es necesaria la enseñanza de métodos de investigación en los estudios de Biblioteconomía y Documentación. Se exponen las opiniones al respecto de diversos profesionales, profesores y científicos. Se mantiene que el aprendizaje de la metodología científica sirve, en primer lugar, para formar el espíritu crítico del alumnado y, en segundo lugar, para dotarle de herramientas que le permitan en su futuro profesional actuar de manera racional y sis...

  7. Uso da zootecnia de precisão na avaliação do comportamento de leitões lactentes submetidos a diferentes sistemas de aquecimento Use of animal precision production in the behavior evaluation of lactation piglets submitted to different heating systems

    Directory of Open Access Journals (Sweden)

    Iran José Oliveira da Silva

    2005-02-01

    Full Text Available Objetivou-se, nesta pesquisa, avaliar o comportamento de leitões em diferentes sistemas de aquecimento, por meio de análise de imagem e identificação eletrônica, na sala da maternidade, com 80 animais entre o nascimento e o desmame. Os tratamentos adotados para avaliação da eficiência dos diferentes sistemas de aquecimento foram: piso térmico, lâmpada incandescente, resistência elétrica e lâmpada de infravermelho. O delineamento experimental foi em blocos casualizados com quatro tratamentos e 18 blocos, as médias foram comparadas pelo teste Tukey. A avaliação física dos ambientes foi realizada por intermédio da temperatura de bulbo seco (Ts, temperatura de bulbo úmido (Tu e temperatura de globo negro (Tg, registradas por cabos termopares tipo T armazenados em uma plataforma automática de dados, em intervalo horário. Índice de temperatura de globo e umidade (ITGU, carga térmica radiante (CTR e entalpia (H foram calculados usando as variáveis ambientais registradas. Os dados ambientais foram registrados em ambiente externo, na sala da maternidade e no interior de cada abrigo escamoteador, durante 18 dias. Ganho de peso diário (GPD e mortalidade também foram registrados. A avaliação comportamental foi realizada utilizando a análise de imagem, identificação eletrônica. Para o período de inverno, o uso de lâmpada incandescente e resistência elétrica foi mais adequado sob o ponto de vista térmico, durante a primeira e segunda semanas, entretanto, considerando-se o reflexo do aquecimento no comportamento dos leitões na terceira semana, o piso térmico foi o que proporcionou melhor condição de conforto aos animais.The objective of this research was to evaluate the behavior of piglets at different heating systems using the image analysis and electronic identification devices. This research was developed in the farrowing house, with 80 piglets from birth to weaning. The treatments were the different heating systems

  8. Potencial de quatro espécies herbáceas forrageiras para fitorremediação de solo contaminado por arsênio Potential of four herbaceous forage species for phytoremediation of a soil contaminated with arsenic

    Directory of Open Access Journals (Sweden)

    Roseli Freire de Melo

    2009-04-01

    Full Text Available A fitorremediação de solos e substratos contaminados por elementos tóxicos tem despertado crescente interesse entre pesquisadores e técnicos. Particularmente em relação ao As, o obstáculo ao emprego desta técnica é o pequeno número de espécies identificadas capazes de acumular este elemento. O objetivo deste trabalho foi avaliar o potencial de plantas de estilosante (Stylosanthes humilis HBK, amendoim (Arachis pintoi Krapov. & Gregory, aveia (Avena strigosa Schreb e azevém (Lolium multiflorum Lam. como espécies fitorremediadoras de áreas contaminadas por As. Amostras de Latossolo Vermelho-Amarelo foram incubadas por 15 dias com diferentes doses de As: 0; 50; 100; e 200 mg dm-3. Em seguida, realizaram-se a semeadura das quatro espécies e as respectivas adubações. Aos 65 dias após a semeadura, as plantas foram avaliadas quanto à altura, à matéria seca da parte aérea e raízes. Determinaram-se os teores de As nas folhas jovens, intermediárias e basais, no caule e nas raízes, bem como o conteúdo e o índice de translocação (IT de As. Por meio de análises de regressão, foram estimados os teores críticos (TC de As disponíveis no solo, que proporcionaram redução de 50 % da matéria seca. As espécies estudadas apresentaram comportamento diferenciado quanto à tolerância ao As, com destaque para azevém, amendoim e estilosante, que não apresentaram lesões foliares decorrentes de fitotoxidez por esse elemento. Os TC para as plantas de aveia e azevém foram significativamente superiores aos observados para as demais espécies, caracterizando-as como espécies tolerantes ao As. As plantas de amendoim e estilosante apresentaram maior capacidade de absorção e maior IT de As para a parte aérea. As plantas de amendoim apresentaram maiores teores nas folhas basais e raízes, mostrando potencial para serem utilizadas em programas de fitorremediação. As plantas de azevém, amendoim e estilosante podem ser utilizadas na

  9. Determinación de las propiedades reológicas de soluciones acuosas de carboximetilcelulosa (CMC), por mediciones experimentales en viscosímetro rotacional AR – G2

    OpenAIRE

    Lasheras Ruiz, Arsenio José

    2009-01-01

    La definición que da la empresa “TA Instruments” de la reología es: La ciencia del flujo y la deformación de la materia. Parece que esta definición es muy genérica; sin embargo se puede encontrar en otros libros otras definiciones, como por ejemplo: La reología estudia cómo se deforma y fluye la materia cuando se le somete a una presión. Ésta puede ser una tensión, una compresión o una fuerza de cizalla. Aunque en general los sistemas dispersos y coloidales se comportan de forma muy similar a...

  10. Múltiples formas de enseñar para adaptarnos a diversas maneras de aprender. Las inteligencias múltiples y el trabajo por proyectos en Educación Infantil

    OpenAIRE

    Barrio Rubio, Irene

    2015-01-01

    El presente Trabajo de Fin de Grado busca profundizar en la teoría de las inteligencias múltiples de Howard Gardner como marco para el estudio de una metodología didáctica que dé respuesta a las diferentes formas de aprender del alumnado. Así, se diseña y se pone en práctica una propuesta didáctica para el primer curso del Segundo Ciclo de Educación Infantil tomando como base la teoría de las inteligencias múltiples y la metodología educativa del trabajo por proyectos. Para el desarrollo de e...

  11. Potencial do soro de leite líquido como agente encapsulante de Bifidobacterium Bb-12 por spray drying: comparação com goma arábica Potential of liquid whey as the encapsulating agent of Bifidobacterium Bb-12 by spray drying: comparison with arabic gum

    Directory of Open Access Journals (Sweden)

    Fabiane Picinin de Castro-Cislaghi

    2012-09-01

    Full Text Available O objetivo do trabalho foi avaliar o potencial do soro de leite líquido como agente encapsulante de Bifidobacterium Bb-12 por spray drying, comparando-o com a goma arábica, a qual é tradicionalmente utilizada na tecnologia de microencapsulação. Foram determinados o rendimento da microencapsulação e a viabilidade das microcápsulas durante o armazenamento. Quando o soro de leite foi utilizado como agente encapsulante, o rendimento da microencapsulação foi maior e a viabilidade das células manteve-se elevada e constante durante doze semanas. O soro de leite apresentou-se como um eficiente agente encapsulante de Bifidobacterium por spray drying.The objective of this study was to evaluate the potential of liquid whey as the encapsulating agent Bifidobacterium Bb-12 by spray drying, compared with arabic gum, which is typically used in microencapsulation technology. The microencapsulation yield and viability during storage were determined. When the whey was used as the encapsulating agent, the microencapsulation yield was higher, and cell viability remained high and steady for twelve weeks. The whey was shown to be an effective encapsulating agent of Bifidobacterium by spray drying.

  12. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  13. Utilización de Sistemas Basados en Reglas y en Casos para diseñar transmisiones por tornillo sinfín // Use of rules based systems and cases based systems for worm gear design

    Directory of Open Access Journals (Sweden)

    Jorge Laureano Moya‐Rodríguez

    2012-01-01

    Full Text Available Las técnicas de Inteligencia Artificial se aplican hoy en día a diferentes problemas de Ingeniería,especialmente los Sistemas Basados en el Conocimiento. Entre estos últimos los más comunes son losSistemas Basados en Patrones, los Sistemas Basados en Reglas, los Sistemas Basados en Casos y losSistemas Híbridos. Los Sistemas Basados en Casos parten de problemas resueltos en un dominio deaplicación y mediante un proceso de adaptación, encuentran la solución a un nuevo problema. Estossistemas pueden ser usados con éxito para el diseño de engranajes, particularmente para el diseño detransmisiones por tornillo sin fin, sin embargo ello constituye un campo de las aplicaciones de laInteligencia Artificial aún inexplorada. En el presente trabajo se hace una comparación del uso de losSistemas Basados en Regla y los Sistemas Basados en Casos para el diseño de transmisiones portornillo sin fin y se muestran los resultados de la aplicación de los sistemas basados en regla al diseñoparticular de una transmisión por tornillo sin fin.Palabras claves: tornillo sin fin, engranajes, sistemas basados en casos, sistemas basados en reglas,inteligencia artificial.____________________________________________________________________________AbstractNowadays Artificial Intelligence techniques are applied successfully to different engineering problems,especially the “Knowledge Based Systems”. Among them the most common are the “Frame basedSystems”, “Rules Based Systems”, “Case Based Systems” and "Hybrid Systems". The “Case BasedSystems” (CBS analyze solved problems in an application domain and by means of a process ofadaptation; they find the solution to a new problem. These systems can be used successfully for thedesign of gears, particularly for designing worm gears; nevertheless it constitutes a field of the applicationsof artificial intelligence even unexplored. A comparison of the use of “Rules Based System” and

  14. Simulação estocástica da radiação fotossinteticamente ativa e da temperatura do ar por diferentes métodos Random simulation of photosynthetically active radiation and air temperature through different methods

    Directory of Open Access Journals (Sweden)

    Thomas Newton Martin

    2007-09-01

    Full Text Available O objetivo deste trabalho foi comparar três métodos para simulação de dados de radiação fotossinteticamente ativa e temperatura do ar, com o uso de parâmetros diários de 17 estações do Estado de São Paulo. A simulação foi realizada para o primeiro e o 16º dia de cada mês, conforme: a distribuição normal truncada a mais ou menos 1,96 de desvio-padrão; distribuição triangular assimétrica; e distribuição normal bivariada. As estimativas com os dados simulados foram comparadas com os respectivos parâmetros (obtidos com os dados observados, pelos testes de homogeneidade de variância F e Bartlett, teste t de comparação de médias, coeficiente de correlação de Pearson, índice de concordância de Willmott, índice de desempenho de Camargo, coeficiente angular e o teste de normalidade dos dados. A simulação pela distribuição normal bivariada é a mais adequada para representar as variáveis climáticas.The purpose of this work was to compare three methods for simulating data of photosynthetically active radiation and air temperature, using daily parameters of 17 stations of São Paulo State, Brazil. The simulation of those elements was carried out for de 1st and the 16th day of each month, through three cases: nonsymmetric triangular distribution; normal distribution truncated at 1.96 standard deviation; and bivaried normal distribution. The simulated data were evaluated through the tests of homogeneity of variance F and Bartlett, t test, agreement index of Willmott, angular coefficient of the straight line, the index of performance of Camargo and tack the normal distribution (uni-varied. The simulation using the bi-varied normal distribution is most appropriate for representing the climate variables.

  15. Avaliação energética e de desempenho de frangos com aquecimento automático a gás e a lenha Energetic evaluation and performance of broilers with automatic heating using gas and wood

    Directory of Open Access Journals (Sweden)

    Sandro R. Funck

    2008-02-01

    Full Text Available Nesta pesquisa foram analisados aquecimento automático infravermelho a gás e aquecimento automático a lenha, com três linhagens de frango, criados no período de 01/05/2005 a 16/06/2005, em aviários de 1200 m² e abatidos com 45 dias de idade. Avaliaram-se o consumo e o custo energético de cada sistema e os seguintes índices zootécnicos: peso médio, mortalidade, conversão alimentar e consumo de ração. O delineamento experimental foi inteiramente casualizado em um modelo fatorial 2 x 3, constituído de dois sistemas de aquecimento e das três linhagens de frangos machos formando seis tratamentos com seis repetições, perfazendo o total de trinta e seis aviários com 13.300 aves cada um. Utilizou-se, para a análise estatística, o programa SISVAR 4.6 e se realizaram as comparações entre as médias através do teste de Tukey. Os resultados obtidos foram os seguintes: o consumo energético de lenha de 173,21 GJ por lote e o custo de R$ 3,23 e, para o do gás, foi de 20,26 GJ por lote e o custo de R$ 53,76. Em relação ao desempenho zootécnico, não houve diferença significativa entre os dois sistemas analisados, mas entre as linhagens ocorreu diferença significativa, com a linhagem Cobb apresentando 6,62%, maior peso médio e 1,04% maior mortalidade, quando comparada com aves da linhagem Ross 1.In this research automatic infra-red gas heating and wood-burning were analyzed, with three lineages of broilers raised from May 1, 2005 to June 16, 2005 in 1200 m² poultry houses, and slaughtered at the age of 45 days. The energetic consumptions and costs were evaluated for each system, as well as the following zootechnical indexes: mean weight, mortality, feed conversion and consumption. The experimental design was completely randomized in a factorial 2 x 3 model, made up by two heating systems, three lineages of male broilers and six treatments and six replications, totaling thirty six poultry houses with 13,300 birds each. For the

  16. Characterization of iron phosphate glasses prepared by microwave heating; Obtencao de vidros fosfatos contendo ferro por meio do aquecimento em fornos de microondas

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Fabio Jesus Moreira de

    2006-07-01

    Phosphate glasses have been investigated since the fifties, because they are relatively easy to prepare, have low melting temperatures (1000 deg C - 1200 deg C), and low glass transition. However, these glasses were very sensitive to humidity, showing a very low chemical durability. Iron phosphate glasses have been prepared by melting inorganic precursors in conventional electric furnaces and induction furnaces. By adding iron, phosphate glasses became chemical resistant and were thought to be used as nuclear waste forms or mechanical resistance fibers. The use of microwaves has been investigated because it makes possible a fast and homogeneous heating of the materials. Microwave promotes the self-heating of the material by the interaction of the external electromagnetic field with the molecules and ions of the material. Niobium phosphate glasses was also produced already through the heating of precursors in microwave ovens. Other glasses containing iron in theirs structure was produced by conventional furnaces and they had your structures analyzed. But even so, it was not still published synthesis of iron phosphate glasses starting from the melting of precursors materials in microwave ovens. In the present work mixtures of (NH{sub 4}){sub 2}HPO{sub 4} and Fe{sub 3}O{sub 4} or (NH{sub 4}){sub 2}HPO{sub 4} and Fe{sub 2}O{sub 3} were exposed to microwave energy with electromagnetic waves of 2,45 GHz. It was proposed that the absorption of this radiation for the material causes the heating from room temperature to melting temperature. The obtained iron phosphate glasses was analyzed by X-ray diffraction, Moessbauer spectroscopy, and Differential Thermal Analysis. Iron phosphate glasses were also produced in electrical furnaces for comparison. (author)

  17. Differential susceptibility according to gender in the association between air pollution and mortality from respiratory diseases Susceptibilidade segundo sexo na associação entre poluição do ar e mortalidade por doenças respiratórias

    Directory of Open Access Journals (Sweden)

    Marcio Sacramento de Oliveira

    2011-09-01

    Full Text Available This study analyzed the association between air pollution and deaths from respiratory diseases, considering differential susceptibility according to gender. The authors used daily deaths from respiratory diseases (ICD-10, J00-J99, PM10, SO2, and O3 levels, and meteorological indicators in Volta Redonda, Rio de Janeiro State, Brazil, from January 2002 to December 2006. The association was estimated by Poisson regression using generalized additive models, where the increase in risk of deaths from PM10 to lag 1 was 10.01% (95%CI: 1.81-18.88% in the total female population and 10.04% (95%CI: 0.90-20.02% in elderly women. The increase in risk of deaths from PM10 to lag 9 was 8.25% in the total male population (95%CI: 0.86-16.18% and 10.80% (95%CI: 2.18-20.15% in elderly men. For exposure to SO2 and O3, the risk was significant in the total male population and the elderly, respectively. The results emphasize the need for further studies, focusing on modification of the effects of air pollution on health.O estudo avaliou a associação entre poluição do ar e óbitos por doenças respiratórias, considerando susceptibilidade diferencial segundo sexo. Foram utilizados óbitos diários por doenças respiratórias (CID-10, J00-J99, níveis de PM10, SO2, O3 e indicadores meteorológicos de Volta Redonda, Rio de Janeiro, Brasil, de janeiro de 2002 a dezembro de 2006. A associação foi estimada por MAG de regressão de Poisson, onde para lag 1, o aumento do risco dos óbitos por PM10 foi de 10,01% (IC95%: 1,81-18,88% no total da população feminina e 10,04% (IC95%: 0,90-20,02% em idosas. No total da população masculina, para lag 9, o aumento do risco de óbitos por PM10 foi de 8,25% (IC95%: 0,86-16,18% e de 10,80% (IC95%: 2,18-20,15% para os idosos. Para exposição ao SO2 e O3, o risco foi significativo no total da população masculina e em idosos respectivamente. Os resultados reforçam a necessidade de estudos adicionais, centrando-se na modifica

  18. Ecoética e aquecimento global http://dx.doi.org/10.15601/1983-7631/rt.v8n14p66-74

    Directory of Open Access Journals (Sweden)

    Manuel Alfonso Díaz Muñoz

    2015-08-01

    Full Text Available RESUMO: O presente artigo pretende apresentar os dados científicos mais recentes sobre a questão do aquecimento global e discutir suas implicações políticas e éticas. Destaca-se a centralidade da questão ética e a necessidade de um novo paradigma biocêntrico, pois a vivência de uma nova ética ambiental global ou ecoética aparece como condição necessária para a sobrevivência humana e planetária. Conclui-se o artigo com o que se entende é a expressão concreta dessa referência ética comum: a Carta da Terra.Palavras-chave: Ecologia; Meio Ambiente

  19. Superdeformation of Ar hypernuclei

    Science.gov (United States)

    Isaka, Masahiro; Kimura, Masaaki; Hiyama, Emiko; Sagawa, Hiroyuki

    2015-10-01

    We investigate the differences in the Λ separation energies (S_Λ ) of the ground and superdeformed (SD) states in {}^{37}_Λ Ar, ^{39}_Λ Ar, and ^{41}_Λ Ar within the framework of antisymmetrized molecular dynamics (AMD). In this study, we find that the calculated S_Λ values in the SD states are much smaller than those in the ground states, unlike the result using the relativistic mean-field (RMF) calculation [B.-N. Lu et al., Phys. Rev. C, 89, 044307 (2014)]. One of the reasons for this difference between the present work and the RMF calculation is the difference in the density profile of the SD states in the core nuclei. We also find that the property of the Λ N odd-parity interaction affects the S_Λ trend between the ground and SD states.

  20. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  1. ARS Culture Collection

    Science.gov (United States)

    The internationally recognized Agricultural Research Service (ARS) Culture Collection will be described to include the microorganisms maintained by the collection, preservation methods and worldwide distribution of cultures. The impact of the germplasm will be described to include discovery of the f...

  2. Umidificação e aquecimento do gás inalado durante ventilação artificial com baixo fluxo e fluxo mínimo de gases frescos

    OpenAIRE

    Gorayb Susane Bruder Silveira; Braz José Reinaldo Cerqueira; Martins Regina Helena Garcia; Módolo Norma Sueli Pinheiro; Nakamura Giane

    2004-01-01

    JUSTIFICATIVA E OBJETIVOS: Em pacientes sob intubação traqueal ou traqueostomia, a umidificação e o aquecimento do gás inalado são necessários para a prevenção de lesões no sistema respiratório, conseqüentes ao contato do gás frio e seco com as vias aéreas. O objetivo da pesquisa foi avaliar o efeito do sistema respiratório circular com absorvedor de dióxido de carbono do aparelho de anestesia Cícero da Dräger, quanto à capacidade de aquecimento e umidificação dos gases inalados, utilizando-s...

  3. Influence of the time/temperature binomial on the hydroxymethylfurfural content of floral honeys subjected to heat treatment Influência do binômio tempo e temperatura nos teores de hidroximetilfurfural em méis florais submetidos ao aquecimento

    Directory of Open Access Journals (Sweden)

    Roberta de Oliveira Resende Ribeiro

    2012-04-01

    Full Text Available Hydroxymethylfurfural (HMF content is internationally recognized for its ability to indicate the freshness or lack of freshness of honey and can be used to judge the processing and storage condition of honey. The objective of the present study was to evaluate the evolution of HMF levels in fresh extracted honeys submitted to different temperatures ranging from 30 to 100º C, during pre-established time intervals (30, 45, 60, 180 and 720 minutes.The test was conducted in floral honey with an initial HMF content of 2.2 mg/Kg. The maximum value recommended by the Brazilian law (60 mg/Kg was not exceeded in the samples subjected to heating for 30, 45 and 60 minutes regardless of the temperatures used. When the samples were heat treated during 180 minutes at 90º C the official value was surpassed. The highest values were observed in samples subjected to heating over 720 minutes, and the limit was exceeded at 70º C. The results obtained indicate that the HMF content gradually increases when the honey is heated at high temperatures for long periods. Therefore, we suggest a process optimization, considering the initial HMF content of the product and standardizing times and temperatures to ensure a good quality of the final product.O teor de hidroximetilfurfural (HMF é reconhecido internacionalmente pela capacidade de indicar o frescor do mel, podendo ser usado para avaliar o processamento e condições de armazenamento do mel. Neste trabalho objetivou-se avaliar a evolução dos níveis de HMF em mel recém-obtido, submetidas a diferentes temperaturas que variaram de 30 a 100º C, por intervalos de tempo pré-definidos (30, 45, 60, 180 e 720 minutos. O ensaio foi realizado em mel floral, cujo valor inicial de HMF foi de 2,2 mg/Kg. O valor máximo preconizado pela legislação brasileira não foi ultrapassado nas amostras submetidas ao aquecimento por 30, 45 e 60 minutos independente das temperaturas. Por um período de 180 minutos, o limite legal de

  4. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  5. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  6. El reto de enseñar por competencias

    OpenAIRE

    Ayuso Marente, José Antonio

    2006-01-01

    Con motivo de la reciente implementación de la Evaluación de Diagnóstico en Andalucía se realiza una reflexión en torno a las competencias básicas, qué y cuáles son, cómo encajan dentro del curriculum y finalmente cual será el papel del profesorado en el desarrollo de estas competencias en los centros de Primaria y Secundaria andaluces.

  7. Spectroanalytical investigations on inductively coupled N2/Ar and Ar/Ar high frequency plasmas

    International Nuclear Information System (INIS)

    In order to improve the detection limits of trace elements in corrosion products of metallic materials, the inductively coupled plasma excitation source (ICP) was applied for spectroscopic analysis. Besides optimizing the working conditions for the mentioned materials, the fundamental research clearing the excitation processes in ICP was carried out. Basicly, two plasma systems were investigated: the nitrogen cooled N2/Ar- and pure Ar/Ar-plasma. The computed detection limits for 8 chosen elements are between 0.1 and 50 μg ml-1 in both plasmas. The advantage of ion lines was clearly present; in N2/Ar-plasma it was larger than in Ar/Ar-plasma. The excitation temperatures measured with help of ArI, FeI and ZnI lines rise with increasing power and decreasing distance from the induction coil. The distribution of Zn excitation temperature in N2/Ar-plasma as well as the measured N+2 rotational and CN vibrational temperatures indicate, that the toroidal structure of Ar/Ar-plasma is not analogue to the N2/Ar-plasma. The values of the various excitation temperatures (Ar, Fe, Zn) and the differences between the excitation, vibration, rotation and ionization temperatures (Tsub(i) > Tsub(n) = Tsub(vib) > Tsub(rot)) indicate an absence of thermal equilibrium in the concerned system. (orig.)

  8. Correlação entre a necrose de frutos associada ao Colletotrichum spp. com as características frutos por nó e produtividade entre genótipos de café arábica Correlation between fruit necrosis associated to Colletotrichum spp. with the fruits per node and yield traits of arabic coffee

    Directory of Open Access Journals (Sweden)

    Gustavo Hiroshi Sera

    2008-02-01

    Full Text Available O fungo Colletotrichum spp. vem sendo associado à graves perdas para a cafeicultura brasileira. Objetivou-se neste trabalho verificar a existência de relação entre a variável necrose de frutos associada ao Colletotrichum spp. ("COL" com a quantidade média de frutos por nó produtivo ("FN" e com a produção ("PRD" em genótipos de café arábica. O ensaio de campo foi realizado no IAPAR (Londrina, PR, Brasil em dezembro de 2004 e em cafeeiros com três anos de idade. A variável "COL" foi avaliada atribuindo-se notas de 1 a 5, onde 1 representam plantas com 0 % a 5 % de frutos necrosados. "FN" foi avaliada seguindo uma escala de notas de 1 a 5, onde 1 representa plantas com 0 a 3 frutos/ nó e nota 5 com mais do que 15 frutos/ nó. A avaliação visual subjetiva da produção foi estimada em litros de frutos em estádio cereja, por planta. A correlação de Pearson foi estimada para avaliar a existência de associações entre as variáveis. Foram observadas correlações positivas e significativas a 1 % entre "COL" e "FN" e entre "COL" e "PRD". A necrose de frutos foi mais intensa em cafeeiros com mais produção e com mais frutos por nó produtivo. Sugere-se que a avaliação da resistência de campo à necrose dos frutos associada à presença de Colletotrichum spp. seja realizada em cafeeiros com alta produção e com alta quantidade de frutos por nó produtivo.Different fungi species of genus Colletotrichum has been associated with losses to the Brazilian coffee crop. The aim of this research was to evaluate the association between the variable fruit necrosis associated to Colletotrichum spp. ("COL" with the fruits per productive node average ("FN" and between "COL" and the yield ("PRD" in Coffea arabica L. genotypes. The field assay was evaluated at IAPAR (Londrina, PR, Brazil, in December 2004 and on coffee trees with three years old. The "COL" variable was evaluated attributing scores from 1 to 5, where score 1 represents plants

  9. INIBIÇÃO DE SALMONELLA POR EXTRATO DE ALECRIM (Rosmarinus officinalis): EFEITO DOS EXTRATOS ETANÓLICOS E AQUOSO INHIBITION OF Salmonella BY ROSEMARY EXTRACTS (Rosmarinus officinalis): EFFECT OF WATER AND ETHANOL EXTRACTS

    OpenAIRE

    Maria Célia Lopes Torres; Alonso Salustiano Pereira; Magdala Alencar Teixeiras; Paulo César Stringheta

    2007-01-01

    Estudou-se os efeitos inibidores do extrato etanólico e do extrato aquoso de alecrim, obtidos em Soxhlet e após aquecimento a 121°C por 10 minutos respectivamente, sobre sete espécies de Salmonella isoladas de frangos. Determinou-se a presença do princípio ativo bactericida do alecrim nos extratos aquoso e etanólico, sua concentração com efeito inibidor sobre Salmonella, “in vitro”, e a ocorrência de um possível sin...

  10. Geochronology and thermochronology by the 40Ar/39Ar method

    International Nuclear Information System (INIS)

    This work is a response to the authors' belief that there is a need for a monograph on 40Ar/39Ar dating to provide concise knowledge concerning the application of this method to geological studies. They aim to provide a reasonably comprehensive but by no means exhaustive coverage of the principles and practices of 40Ar/39Ar dating, with emphasis on interpretation of results. In attempting to provide an overview of the current state of knowledge, they commonly cite examples from the available literature. They draw rather heavily upon their own work, because they feel comfortable with their own examples. (author)

  11. Air quality and emergency pediatric care for symptoms of bronchial obstruction categorized by age bracket in Rio de Janeiro, Brazil Qualidade do ar e atendimentos pediátricos de emergência por sintomas de obstrução brônquica categorizados por faixas etárias no Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Marisa Moura

    2009-03-01

    Full Text Available The objective of this study was to estimate the association between levels of air pollutants and respiratory symptoms in children. An ecological time-series study was conducted between April 2002 and March 2003 with daily data on PM10, SO2, CO, NO2, and O3 and paediatric care in emergency rooms due to symptoms indicating bronchial obstruction. The potential confounding factors considered were: time trend, seasonality, meteorological variables, respiratory infections and the effects of weekends and holidays. A semi-parametric Poisson regression was used to model the time series. Splines (data smoothing functions, indicator variables and cubic polynomials were used to adjust the effects of the confounding variables. A 5% significance level was adopted for the study. A statistically significant increase of 6.7% in paediatric visits of children of less than 2 years of age was associated with PM10. A 3% positive association with O3 showed borderline significance (p O objetivo deste trabalho foi estimar a associação entre os níveis dos poluentes atmosféricos e sintomas respiratórios em crianças. Foi realizado um estudo ecológico de séries temporais, entre abril de 2002 e março de 2003, com dados diários de PM10, SO2, CO, NO2 e O3 e dos atendimentos pediátricos de emergência ocasionados por sintomas de obstrução brônquica. As variáveis de confusão foram: tendência temporal, sazonalidade, fatores meteorológicos, infecções respiratórias e os efeitos dos finais de semana e feriados. Regressão de Poisson semiparamétrica foi usada para modelar as séries temporais. Curvas suaves, splines, variáveis indicadoras e polinômios cúbicos foram empregadas para corrigir os efeitos dos fatores de confundimento. Foi adotado o nível de significância de 5%. Um incremento estatisticamente significativo dos atendimentos, de 6,7%, esteve associado com PM10 nas crianças menores do que dois anos. Associação positiva com o O3, em torno de 3

  12. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  13. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  14. Estudo da hemodinâmica venosa por meio da pletismografia a ar no pré e pós-operatório de varizes dos membros inferiores Venous hemodynamic study by air plethysmography in the pre- and postoperative period of lower limb varicose veins

    Directory of Open Access Journals (Sweden)

    Nei Rodrigues Alves Dezotti

    2009-03-01

    Full Text Available Contexto: O tratamento cirúrgico das varizes primárias dos membros inferiores deve proporcionar alívio da estase venosa, a fim de evitar a evolução da doença venosa para estágios de maior gravidade clínica. Objetivo: Estudar as alterações da hemodinâmica venosa em pacientes portadores de varizes primárias dos membros inferiores no pré e pós-operatório, utilizando a pletismografia a ar. Método: Foram estudados 63 membros inferiores em 39 pacientes (35 mulheres e quatro homens, com média de idade igual a 46,3 anos, operados no Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo, no período de janeiro de 2001 a dezembro de 2004. Os membros inferiores foram classificados de acordo com a classificação CEAP, em critério clínico = C2 a C6 (C2 = 6, C3 = 32, C4 = 15, C5 = 7 e C6 = 3, critério etiológico = Ep, critério anatômico = As e critério fisiopatológico = Pr. Os pacientes foram avaliados por exame clínico pré e pós-operatório, mapeamento dúplex pré-operatório e pletismografia a ar pré e pós-operatória. Resultados: Houve melhora da hemodinâmica venosa no pós-operatório, demonstrada pela diminuição do índice de enchimento venoso e da fração de volume residual e aumento da fração de ejeção nos membros inferiores submetidos à operação de varizes. Conclusão: A operação venosa superficial aliviou a estase venosa e proporcionou adequado tratamento, com o objetivo de interromper a evolução fisiopatológica da doença venosa crônica, em qualquer nível de gravidade clínica.Background: Surgical treatment of primary varicose veins of the lower limbs might contribute to venous stasis relief by preventing evolution of the venous disease to worse severity stages. Objective: To study venous hemodynamic changes in patients with primary varicose veins of the lower limbs during the pre- and postoperative period using air plethysmography. Method: Sixty-three lower

  15. Study of growth of gadolinium-doped ceria nanobelts by a hydrothermal microwave system; Estudo do crescimento de nanofitas de ceria dopada com gadolinio por sistema de aquecimento por micro-ondas

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, R.F.; Castro, D.A.; Santos, M.R.C.; Figueiredo, A.T.; Godinho Junior, M. [Universidade Federal de Goias (UFG), Catalao, GO (Brazil). Dept. de Quimica; Barrado, C.M. [Universidade Federal do Para (UFPA), Belem, PA (Brazil). Inst. de Ciencias Exatas e Naturais; Leite, E.R. [Universidade Federal de Sao Carlos (INCTMN/UFSCar), SP (Brazil). Dept. de Qumica

    2013-07-15

    Cerium oxide (ceria) has attracted attention because of its important applications such as solid oxide fuel cells, catalysts for automobile exhaust gas, catalysts to obtain hydrogen, UV blockers, biomaterials, etc.. Control methods for synthesis of ceria are of great importance to explain or predict these properties. Thus, the objective of this work was to study the growth of cerium oxide nanobelts in a microwave-assisted hydrothermal system, where in 8 min 330 nm nanobelts were obtained at 130 deg C and 3 atm. The results collaborate to the research on reformers for ethanol and/or solid oxide fuel cells anode. (author)

  16. The 38Ar(p,d)37Ar reaction

    International Nuclear Information System (INIS)

    The 38Ar(p,d)37Ar reaction has been used to study the properties of the high-lying positive parity states in 37Ar. Angular distributions in the region thetasub(c.m.)=160-1320 have been analyzed using the DWBA code DWUCK to determine the spectroscopic properties of these states. The two lowest T=3/2 states have been identified at 4.98MeV (3/2+) and 6.65MeV (1/2+). The results are compared to recent shell-model calculations; their significance for the solar neutrino experiment is also discussed. (Auth.)

  17. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  18. por valores

    Directory of Open Access Journals (Sweden)

    Jazmín Díaz-Barrios

    2005-01-01

    Full Text Available La era actual se caracteriza por una búsqueda de la identidad del hombre, donde el pivote del cambio organizacional es el individuo; cambiar en este entorno depende, en gran medida, de los valores que imperen en la cultura de la organización. Este trabajo documental intenta identificar aquellos valores, condición sine-qua-non, para el logro de los objetivos de cambio y analizarlos a fin de determinar sus indicadores, con el objeto de presentar una herramienta a las organizaciones que les facilite adaptarse a los nuevos tiempos. Se encontró que los valores: Delegación, Comunicación, Colaboración, Participación y Aprendizaje, son esenciales en los cambios integrales de esta era. Se determinaron 20 indicadores de su presencia. Se concluye que con esta información cada ente puede elaborar instrumentos que le permitan saber si los valores requeridos están presentes y en caso contrario tomar decisiones que alineen a la organización alrededor de los valores humanistas planteados, incrementando así las posibilidades de éxito en el proceso de cambio y por ende, las posibilidades de supervivencia en esta nueva época.

  19. Electron scattering from 36Ar and 40Ar

    International Nuclear Information System (INIS)

    The argon isotopes, 36Ar and 40Ar, have been investigated using electron scattering at the high-resolution Linac facilities of the National Bureau of Standards. Both elastic scattering and scattering to low-lying states have been observed. A high-pressure, low-volume gas target cell was designed and developed for this experiment. The cell features a transmission geometry and has resolution comparable to solid targets. Spectra were obtained at incident beam energies ranging from 65 to 115 MeV at scattering angles of 92.50 and 1100. Values obtained for the rms charge radii are 3.327 +- 0.015 and 3.393 +- 0.015 fm for 36Ar and 40Ar respectively. A sensitive measurement was made of the difference in the two radii yielding a value of Δ r = 0.079 +- 0.006 fm. The inelastic levels observed are the 1.97 (2+) and 4.18 MeV (3-) levels in 36Ar, and the 1.46 (2+), 2.52 (2+), 3.21 (2+), and 3.68 MeV (3-) levels in 40Ar. A Tassie model analysis was made of the inelastic transitions in the DWBA approximation and transition strengths of these levels were extracted

  20. What to teach to patients with heart failure and why: the role of nurses in heart failure clinics ¿Qué enseñar a los pacientes con insuficiencia cardiaca y por qué?: el papel de los enfermeros en clínicas de insuficiencia cardíaca O que ensinar aos pacientes com insuficiência cardíaca e por quê: o papel dos enfermeiros em clínicas de insuficiência cardíaca

    Directory of Open Access Journals (Sweden)

    Eneida Rejane Rabelo

    2007-02-01

    Full Text Available The most important objective of heart failure (HF treatment is to reach and preserve patients' clinical stability. Several studies have shown that programs aimed at systematic education, developed by multidisciplinary teams, are positive strategies to work with these patients. Nurses active in HF clinics play a fundamental role in the educational process and continuity of patient care. The objectives of these processes are to teach, reinforce, improve and constantly evaluate patients' self-care abilities, which include weight monitoring, sodium and fluid restrictions, physical activities, regular medication use, monitoring signs and symptoms of disease worsening and early search for medical care. Therefore, education to understand HF and the development of self-care abilities are considered key points to improve adherence, avoid decompensation crises and, consequently, to maintain patients clinically stable. This article presents a careful review of the aspects involved in the patient education process by nurses in the context of HF clinics.El principal objetivo del tratamiento de la insuficiencia cardiaca (IC consiste en obtener y mantener la estabilidad clínica del paciente. Varios estudios demostraron que programas de educación sistemática, desarrollados por equipos multidisciplinares, son estrategias positivas para estos pacientes. Enfermeras que trabajan en clínicas de IC tienen un papel fundamental en la educación y apoyo de los pacientes. Los objetivos del proceso son enseñar, reforzar, mejorar y evaluar constantemente la capacidad de autoayuda, que incluye el control de peso, restricciones al consumo de sodio y líquidos, actividades físicas, el uso adecuado de medicamentos, la observación de señales y síntomas de agravamiento de la enfermedad y la búsqueda precoz de los servicios médicos. Los puntos principales para promover el mejor cumplimiento de la terapia y evitar crisis de descompensación serian entonces la educaci

  1. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  2. Consumo de arsénico y riesgo cardiovascular

    OpenAIRE

    Lachiner Saborío Morales; Luis Fernando Hidalgo Murillo

    2015-01-01

    El arsénico (As) es un elemento considerado como ubicuo, cuyas fuentes pueden ser naturales o productos de la actividad humana. La exposición a este elemento ocurre principalmente por la vía oral. Las presentaciones inorgánicas del As son consideradas como las más tóxicas. La absorción del As ocurre en el intestino delgado y por medio de acuaporinas ingresa a los hepatocitos, en casos de ingesta crónica el As tiende acumularse en hígado, riñones, corazón, sistema nervioso, pulmones, músculo, ...

  3. Reproducción de Eisenia foetida en suelos agrícolas de áreas mineras contaminadas por cobre y arsénico Reproduction of Eisenia foetida in agricultural soils from mining areas contaminated with copper and arsenic

    OpenAIRE

    Gonzalo Ávila; Hernán Gaete; Mario Morales; Alexander Neaman

    2007-01-01

    El objetivo del trabajo fue evaluar la toxicidad del cobre y arsénico en suelos agrícolas, mediante bioensayos estandarizados de toxicidad aguda y crónica sobre Eisenia foetida y relacionar la respuesta de ésta con las concentraciones de cobre y arsénico en los suelos. Los suelos agrícolas fueram muestreados en las inmediaciones de áreas mineras en la cuenca del río Aconcagua, Chile. E. foetida expuesta a los suelos estudiados mostró una baja mortalidad, indicando la ausencia de toxicidad agu...

  4. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  5. Os impactos do crescimento econômico sobre o aquecimento terrestre: a contribuição dos países em desenvolvimento

    Directory of Open Access Journals (Sweden)

    Maria Fernanda Cavalieri de Lima Santin

    2007-07-01

    Full Text Available O objetivo deste artigo é estimar as emissões de dióxido de carbono, CO2, para o ano de 2012, provenientes das atividades econômicas em alguns países em desenvolvimento, a saber: África do Sul, Argentina, Brasil, China, Índia e México. Inicialmente, são apresentadas as principais causas do aquecimento terrestre e como a utilização de combustíveis fósseis amplia o efeito estufa. Em seguida, são estimadas as emissões de CO2 para três cenários alternativos utilizando-se da Identidade de Kaya. Nos três cenários foram considerados que o aumento populacional e o crescimento da economia seguiriam as taxas médias do período 2000-05. Tentou-se avaliar os efeitos da redução dos índices de intensidade energética e de CO2, mantida a mesma taxa de crescimento econômico e populacional. Neste sentido, nem mesmo no cenário no qual é previsto um maior uso de energias renováveis e de tecnologias voltadas à proteção do meio ambiente, foi possível reduzir os níveis de emissões de CO2 em todos os países.Abstract The main aim of this paper is to evaluate the emissions of carbon dioxide in 2012 as consequence of economic activities in developing countries (South Africa, Argentina, Brazil, China, India and Mexico. To achieve this purpose, we appraise the causes of global warm and the main uses of fossil fuels and how these factors affect the world economy. Then we estimate the CO2 emissions in three alternatives scenarios, using Kaya identity. In the three scenarios was 25consider the economic growth and increase in population equal to period 2000-05. In each scenario, we try to evaluated the effects of reduce the index of energy intensity and CO2. As result, even in the scenario where we simulate major changes in renewable energy and the use of appropriate technologies, it was not feasible to reduce the level of CO2 emission in all the countries.

  6. Proceedings of the MERCOFRIO 2000: Congress and exposition on air conditioning, refrigeration, heating and ventilation from MERCOSUL; Anais do MERCOFRIO 2000: Congresso de ar condicionado, refrigeracao, aquecimento e ventilacao do MERCOSUL

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-07-01

    Theoretical and experimental papers are presented on the following subjects: energy consumption and conservation, thermal analysis, heat transfer, air conditioning and conditioners, residence thermal analysis, and food preservation.

  7. REGISTRATION OF BIRDSFOOT TREFOIL GERMPLASM ARS-2622

    Science.gov (United States)

    ARS-2622 broadleafed birdsfoot trefoil (Lotus corniculatus L.) germplasm was released by the USDA-ARS in cooperation with the Missouri Agricultural Experiment Station in August 2002. The merit of ARS-2622 is that it is a rhizome producing population with a broad genetic base. ARS-2622 was developed ...

  8. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  9. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscience

  10. Uma análise do efeito do aquecimento global na produção de batata no Brasil An analysis of the potato production in Brazil upon global warming

    Directory of Open Access Journals (Sweden)

    CA Lopes

    2011-03-01

    Full Text Available Face às prováveis mudanças climáticas afetando as áreas agricultáveis do planeta, foi feita uma revisão bibliográfica sobre os efeitos do aumento da temperatura no metabolismo da planta de batata, enfatizando suas consequências no desenvolvimento vegetativo e na produtividade da cultura. Embora a ênfase maior desse artigo se prenda ao efeito do clima na redução de alimentos, alerta-se ainda para o risco de erosão genética pelo desaparecimento de espécies silvestres, de grande importância para programas de melhoramento genético. A partir dessas informações e de dados climáticos das regiões produtoras publicados em literatura nacional, foi realizada uma análise prospectiva da produção de batata no Brasil. Para tal, tomou-se como base o aumento da temperatura de até 5ºC até o final deste século e uma faixa ótima de produtividade da batata de 10ºC a 25ºC, conforme indicado em literatura especializada. Foram selecionados seis municípios representando as regiões geográficas onde se cultiva a batata: São Joaquim-SC; Guarapuava-PR; Cristalina-GO; Mucugê-BA; Vargem Grande do Sul-SP e Araxá-MG. Para municípios com prevalência de temperaturas mais baixas, como São Joaquim, o aumento de temperatura preconizado não deverá restringir a produção, porém serão necessárias adequações de épocas de plantio. Por outro lado, a situação é preocupante em regiões e épocas de cultivo sujeitas a temperaturas altas, como Mucugê e Cristalina, onde o cultivo deverá se restringir a poucos meses do ano, contrastando com o plantio contínuo, durante o ano todo, ora sendo realizado. O intuito deste artigo é alertar, e não alarmar, a cadeia produtiva de batata no sentido de se preparar para os ajustes fitotécnicos visando a preservar a bataticultura nacional face a um eventual aquecimento global. Considerações sobre o melhoramento genético para atenuar, pelo menos em parte, esta situação é discutida.The future of

  11. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  12. Analysis of the electric heating conventional system replacement by the solar heating in day-care centers at Poco de Caldas - MG; Analise da substituicao de sistema convencional de aquecimento eletrico por aquecimento solar em creches em Pocos de Caldas -MG

    Energy Technology Data Exchange (ETDEWEB)

    Dantas, Carlos Tadeu [Escola Tecnica Limassis, Delfim Moreira, MG (Brazil); Mariotoni, Carlos Alberto [Universidade Estadual de Campinas, SP (Brazil)

    2006-07-01

    Located in the South of Minas Gerais, average altitude of 1186 m and population about 170.000 inhabitants Pocos de Caldas is one of the most developed tourist cities of Minas Gerais. Beyond this quality, that makes it one of the best cities in quality of life in Brazil, measured for the HDI, the city presents an enviable educational polar region comparing to cities of the south region. With 91 institutions of education, from children's education to superior education, Pocos de Caldas has more than 49,000 students today. From this scholar population, 1870 pupils represent the children's education in particular or municipal day-care centers, called CEI. Pocos de Caldas has its own generation of energy through the Municipal Department of Electricity, DME. The energy production today arrives the house of 58 MW reaching 100% of the population in 2005. The analysis of the substitution of conventional system of electric heating for solar heating in day-care centers has left of an unknown project, with the objective to minimize the consumption of energy unfastened during the children's baths who stay at CEI. In this context, this work presents a study carried through this project, after the implantation of the related system in four of the eleven day-care centers that the initial project composes. The data had been collected in the DME and the City department of Education. The pathological manifestations in the points of water consumption of the related day-care centers as well as the state of conservation of the systems of implanted solar heating had been investigated also. (author)

  13. Reproducción de Eisenia foetida en suelos agrícolas de áreas mineras contaminadas por cobre y arsénico Reproduction of Eisenia foetida in agricultural soils from mining areas contaminated with copper and arsenic

    Directory of Open Access Journals (Sweden)

    Gonzalo Ávila

    2007-03-01

    Full Text Available El objetivo del trabajo fue evaluar la toxicidad del cobre y arsénico en suelos agrícolas, mediante bioensayos estandarizados de toxicidad aguda y crónica sobre Eisenia foetida y relacionar la respuesta de ésta con las concentraciones de cobre y arsénico en los suelos. Los suelos agrícolas fueram muestreados en las inmediaciones de áreas mineras en la cuenca del río Aconcagua, Chile. E. foetida expuesta a los suelos estudiados mostró una baja mortalidad, indicando la ausencia de toxicidad aguda. Además, se observó una disminución en la producción de capullos y desarrollo de juveniles, indicando la existencia de toxicidad crónica. Dicha disminución fue relacionada con las concentraciones de cobre y arsénico en los suelos. El cobre y arsénico en conjunto disminuyeron la producción de capullos, mientras que sólo el arsénico disminuyó el desarrollo de juveniles. Suelos agrícolas provenientes de áreas mineras de la cuenca poseen potenciales características tóxicas para el desarrollo de la macrofauna edáfica.The objective of this work was to evaluate copper and arsenic toxicity in agricultural soils, by means of standardized bioassays of chronic and acute toxicity on Eisenia foetida, and to relate E. foetida response to copper and arsenic concentrations in soils. The agricultural soils were sampled in the proximity of copper mining industries, in the Aconcagua river basin, Chile. E. foetida exposed to the studied soils exhibited a low mortality, indicating the absence of acute toxicity. Besides, a decrease in the cocoon production and juvenile development was observed, indicating the existence of chronic toxicity. Reduction in the cocoon production and juvenile development was related to soil concentrations of copper and arsenic. Both copper and arsenic reduced the cocoon production, while only arsenic diminished the juvenile development. Agricultural soils from mining areas of the basin have potentially toxic characteristics

  14. ANÁLISE DE DIFERENTES VISCOSIDADES A PARTIR DA APLICAÇÃO DO AQUECIMENTO GERAL INDIRETO COMO MÉTODO DE RECUPERAÇÃO EM RESERVATÓRIOS PETROLÍFEROS

    OpenAIRE

    Elthon John Rodrigues Medeiros; Raimundo Nonato de Medeiros Júnior; Janusa Soares de Araújo; Jennys Lourde Meneses Barillas; Tarcílio Viana Dutra Junior; Wilson da Mata

    2011-01-01

    Cada barril de petróleo é relevante e até os campos produtores de difícil acesso têm importância. O petróleo viscoso e os baixos níveis de pressão nos reservatórios rasos dificultam a recuperação. O principal método de recuperação aplicado a esse tipo de petróleo é a injeção de vapor. O Aquecimento Geral Indireto - AGI (Blanket Heating) é uma técnica que utiliza a injeção de vapor através de canalizações horizontais. O fluido aquecido funciona como um trocador de calor, transferindo indiretam...

  15. Oldest human footprints dated by Ar/Ar

    Science.gov (United States)

    Scaillet, Stéphane; Vita-Scaillet, Grazia; Guillou, Hervé

    2008-11-01

    Fossilized human trackways are extremely rare in the geologic record. These bear indirect but invaluable testimony of human/hominid locomotion in open air settings and can provide critical information on biomechanical changes relating to bipedalism evolution throughout the primitive human lineage. Among these, the "Devil's footsteps" represent one of the best preserved human footprints suite recovered so far in a Pleistocene volcanic ash of the Roccamonfina volcano (southern Italy). Until recently, the age of these footprints remained speculative and indirectly correlated with a loosely dated caldera-forming eruption that produced the Brown Leucitic Tuff. Despite extensive hydrothermal alteration of the pyroclastic deposit and variable contamination with excess 40Ar, detailed and selective 40Ar/ 39Ar laser probe analysis of single leucite crystals recovered from the ash deposit shows that the pyroclastic layer and the footprints are 345 ± 6 kyr old (1 σ), confirming for the first time that these are the oldest human trackways ever dated, and that they were presumably left by the modern human predecessor, Homo heidelbergensis, close to Climatic Termination IV.

  16. Aquecimento de vinho tinto e suco de uva utilizados em preparações culinárias não afeta a capacidade antioxidante e o teor de fenóis totais Heating of red wine and grape juice in food preparations does not affect their antioxidant capacity and total phenol content

    Directory of Open Access Journals (Sweden)

    Jeanine Schütz Cardoso Teófilo

    2011-02-01

    Full Text Available OBJETIVO: Avaliar a capacidade antioxidante e a concentração dos compostos fenólicos de vinho tinto e suco de uva utilizados em preparações culinárias, quando submetidos ao processo de fervura. Métodos: A avaliação ocorreu após diferentes períodos de aquecimento (100°C em dois sistemas: i panela de alumínio e chama de fogão e ii balão de vidro e manta térmica. Amostras comerciais de vinho tinto (n=4 e suco de uva integral (n=4 foram submetidas à fervura por 10, 20 e 60 minutos. Antes e após cada período de fervura, a capacidade antioxidante total foi avaliada pela medida do potencial redutor férrico, e o teor de fenóis totais foi quantificado pelo método de Folin-Ciocalteau. As diferenças foram comparadas pela análise de variância para medidas repetidas (pObjective: This study evaluated the antioxidant capacity and concentration of phenolic compounds in red wine and grape juice used in culinary preparations subjected to boiling. Methods: The assessments were done after different boiling times (100°C using two systems: i aluminum pot and stove flame and ii volumetric flask and heating mantle. Samples of red wine (n=4 and grape juice (n=4 were subjected to boiling for 10, 20 and 60 minutes. Before and after each boiling period, the total antioxidant capacity was evaluated by the ferric reducing antioxidant power assay and the total phenol content was determined by the Folin-Ciocalteu reagent. Differences were compared by repeated measures analysis of variance (RM-ANOVA (p<0.05. Results: The different boiling times did not cause significant changes in the total antioxidant capacity or total phenol content of the beverages, regardless of boiling method. Conclusion: The results show that the antioxidant properties of red wine and grape juice did not change significantly after boiling for 60 minutes.

  17. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L.) sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L.) under air exposure stress

    OpenAIRE

    Roberta Dias da Silva; Laudicéia Oliveira Rocha; Bruno Duarte Alves Fortes; Dirson Vieira; Maria Clorinda Soares Fioravanti

    2012-01-01

    No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus) sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM), a hemoglobina corpuscular média (HCM), a concentração de hemoglobina corpuscular média (CHCM), o leucograma, contagem diferencial de l...

  18. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler <= 125.000 DKK), der af haft som sit formål at afprøve et unikt samarbejde omkring udforskningen af nye teknikker til augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  19. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  20. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  1. Characterization of bacteriocins produced by Lactococcus lactis strains Caracterização de bacteriocinas produzidas por linhagens de Lactococcus lactis

    Directory of Open Access Journals (Sweden)

    Izildinha Moreno

    2000-09-01

    Full Text Available Bacteriocins produced by fifteen strains of Lactococcus lactis (14 L. lactis subsp. lactis and one L. lactis subsp. cremoris were heat resistant, sensitive to several proteolytic enzymes and active over a wide range of pH. Their resistance to the heating was greatly influenced by the pH. Only the strain L. lactis subsp. lactis ITAL 383 produced a bacteriocin with a wide activity spectrum, similar to nisin of L. lactis subsp. lactis ATCC 11454. This bacteriocin inhibited closely related species and other Gram-positive microorganisms including Listeria monocytogenes and Staphylococcus aureus, but it was not active against the Gram-negative bacteria tested. The identification of partially purified antimicrobial compounds by SDS-PAGE showed that bacteriocin produced by strain ITAL 383 had the same molecular weight of nisin produced by L. lactis subsp. lactis ATCC 11454.Bacteriocinas resistentes ao aquecimento produzidas por quinze linhagens de Lactococcus lactis (14 L. lactis subsp. lactis e 1 L. lactis subsp. cremoris foram sensíveis à enzimas proteolíticas e ativas em uma ampla faixa de pH. A resistência dessas bacteriocinas ao aquecimento foi fortemente influenciada pelo pH do meio. Somente a linhagem L. lactis subsp. lactis ITAL 383 produziu uma bacteriocina com um amplo espectro de atividade, semelhante ao da nisina de L. lactis subsp. lactis ATCC 11454. Esta bacteriocina inibiu as espécies relacionadas e outros microorganismos gram-positivos, inclusive Listeria monocytogenes e Staphylococcus aureus, mas não as bactérias Gram-negativas examinadas. A identificação do composto antimicrobiano parcialmente purificado por SDS-PAGE revelou um peso molecular similar entre a bacteriocina ITAL 383 e a nisina de L. lactis subsp lactis ATCC 11454.

  2. Limpeza da superfície de corte de rebolos por um sistema de ar comprimido na retificação cilíndrica externa de mergulho de materiais cerâmicos refrigerados com a técnica da mínima quantidade de lubrificante (MQL Grinding wheel surface cleaning using a compressed air system, in external plunge grinding of ceramics using the minimum quantity lubricant (MQL technique

    Directory of Open Access Journals (Sweden)

    E. C. Bianchi

    2012-06-01

    Full Text Available Nos processos de retificação, a utilização de fluidos de corte é uma maneira de implementar a qualidade final do processo, pois os fluidos têm como finalidade a lubrificação na área de contato entre a peça e ferramenta e a refrigeração das superfícies, assim evitando danificações na superfície da peça. Com isso, a utilização de fluidos de corte tem sido constantemente estudada, visando diminuir a utilização deste, pois a utilização de fluidos de corte tem seus problemas. O custo do produto final aumenta consideravelmente com o uso de fluidos de corte no processo de retificação, além de que os fluidos de corte são substâncias tóxicas e nocivas tanto às pessoas quanto ao meio ambiente. Portanto, indústrias, universidades e centros de pesquisas são levados a pesquisar métodos alternativos menos prejudiciais ao meio ambiente. Dentre as alternativas surge a técnica da mínima quantidade de lubrificante (MQL, que também tem suas desvantagens, como por exemplo, a formação de um borra de óleo na superfície de corte do rebolo, o que gera uma rugosidade maior na peça. Porém, visando minimizar o problema da formação da borra de óleo podem ser usados jatos de ar comprimido incidindo na superfície de corte do rebolo, com o objetivo de limpar a mesma. Este estudo será feito através da análise da avaliação das variáveis de saída do processo de retificação externa, como o comportamento da rugosidade superficial e dos desvios de circularidade. Através dos resultados obtidos pretende-se estudar a técnica do MQL, visando melhorá-la através da limpeza da superfície de corte do rebolo com jatos de ar comprimido.In grinding, the use of cutting fluids aims to improve the final quality of the process, because their purpose is to lubricate the contact area between workpiece and tool and the surface cooling, thus avoiding damages on the machined part. Therefore, this subject has been constantly studied, in order

  3. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  4. Remoção dos compostos odoríferos geosmina e 2-metilisoborneol de águas de abastecimento através de processos de aeração em cascata, dessorção por ar e nanofiltração Removal of the odoriferous compounds geosmin and 2-methylisoborneol from drinking water by the processes of cascade aeration, air strippingand nanofiltration

    Directory of Open Access Journals (Sweden)

    Michely Zat

    2011-12-01

    Full Text Available Atividades humanas aceleram o processo natural de eutrofização das águas, favorecendo a floração de algas e cianobactérias. Estes organismos emitem os compostos 2-metilisoborneol (MIB e geosmina, que conferem gosto e odor de mofo e terra à água. A presença destes compostos se estende à água potável uma vez que os processos convencionais de tratamento são insuficientes para removê-los. Esta pesquisa foi realizada com o objetivo de avaliar alternativas de processos de tratamento para a remoção de MIB e geosmina da água. Os processos estudados foram aeração em cascata, dessorção por ar e nanofiltração. Os resultados sugerem a possibilidade de remoção quase total de MIB e geosmina da água através do sistema de nanofiltração, enquanto que os processos baseados em aeração e dessorção foram relativamente ineficientes.Human activities accelerate the natural process of eutrophication, favouring the occurrence of algae and cyanobacterial blooms. These organisms emit the compounds 2-methylisoborneol (MIB and geosmin, which confer earthy and moldy taste and odor to water. The presence of MIB and geosmin is extended to drinking water inasmuch they are not completely removed by the processes used in conventional treatment. This research was conducted to evaluate the capability of alternative treatment processes to remove MIB and geosmin from water. The processes studied were cascade aeration, air stripping, and nanofiltration. The results suggested that MIB and geosmin can be almost completely removed by nanofiltration, while the processes based on aeration and stripping were relatively inefficient.

  5. Behaviour of AR glass fibre for building structural applications

    Directory of Open Access Journals (Sweden)

    Miravete, A.

    2005-12-01

    Full Text Available The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be used as reinforcement of organic matrix composite materials, broadening the range of structural applications. The mechanical properties of AR glass fibre and organic matrix composite materials will be studied in this paper. First, the behaviour of this material under stress corrosion will be analysed. Their mass loss will be compared to E, C, and boron free glass fibres. Second, an experimental study dealing with 3P test bending and short beam ofAR glass fibre/polyester will de described with the goal of obtaining their Young modulus and tensile and interlaminar shear strengths. Finally, these experimental results will be compared to E glass fibre/polyester and several conclusions about their structural applications will be drawn.

    El vidrio AR y su presentación en forma de fibras de refuerzo, fue diseñado para ser inerte a los álcalis de los cementos. Por este motivo se viene utilizando desde hace varias décadas como refuerzo de morteros y hormigones en forma de fibra corta. El ensimaje que estas fibras de vidrio de refuerzo A R presentaba en su origen no era compatible con resinas de tipo sintéticas, por lo que el refuerzo era exclusivo para cementos y hormigones fuera cual fuera la aplicación, formato o proceso productivo. Recientemente, gracias al desarrollo específico de ensimajes especiales acordes a las fibras de vidrio AR ha aparecido la misma tipología de vidrio AR como refuerzo en forma de fibra continua compatible con resinas sint

  6. Consumo de arsénico y riesgo cardiovascular

    Directory of Open Access Journals (Sweden)

    Lachiner Saborío Morales

    2015-03-01

    Full Text Available El arsénico (As es un elemento considerado como ubicuo, cuyas fuentes pueden ser naturales o productos de la actividad humana. La exposición a este elemento ocurre principalmente por la vía oral. Las presentaciones inorgánicas del As son consideradas como las más tóxicas. La absorción del As ocurre en el intestino delgado y por medio de acuaporinas ingresa a los hepatocitos, en casos de ingesta crónica el As tiende acumularse en hígado, riñones, corazón, sistema nervioso, pulmones, músculo, tracto gastrointestinal y bazo. El consumo crónico de agua con concentraciones de As por encima del valor de referencia dado por la Organización Mundial de la Salud (OMS ha demostrado un aumento del riesgo de accidentes vasculares cerebrales (AVC, hipertensión arterial (HTA, aterosclerosis carotidea, enfermedades arteriales periféricas, mortalidad por infarto agudo del miocardio (IAM, aumento en enfermedades cardiovasculares en la población pediátrica y diabetes mellitus tipo II.

  7. Avaliação energética e de desempenho de frangos com aquecimento automático a gás e a lenha Energetic evaluation and performance of broilers with automatic heating using gas and wood

    OpenAIRE

    Sandro R. Funck; Fonseca, Ricardo A.

    2008-01-01

    Nesta pesquisa foram analisados aquecimento automático infravermelho a gás e aquecimento automático a lenha, com três linhagens de frango, criados no período de 01/05/2005 a 16/06/2005, em aviários de 1200 m² e abatidos com 45 dias de idade. Avaliaram-se o consumo e o custo energético de cada sistema e os seguintes índices zootécnicos: peso médio, mortalidade, conversão alimentar e consumo de ração. O delineamento experimental foi inteiramente casualizado em um modelo fatorial 2 x 3, constitu...

  8. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  9. Dependence of the measured 38Ar/36Ar ratio on the total Ar amount and its implications

    International Nuclear Information System (INIS)

    The sensitivity of a mass spectrometer for different isotopes of an element usually is not the same and causes a systematic difference between measured and actual isotopic ratios and is defined as mass discrimination. In noble gas mass spectrometry, the correction factor for mass discrimination can be calculated using a reference gas (air in most cases) with known isotopic composition. The mass discrimination factor (mdf) is defined as the ratio of true isotopic ratio to the measured isotopic ratio. Usually, mdf values, determined using argon in air as standard, are nearly constant for a given element over long periods of time. Both mass discrimination and sensitivity remain the same over a certain range of total pressure in the mass spectrometer, during the measurement of a given gas. For the case of Xe, Kr and Ne, in general, the total gas pressure in the mass spectrometer during the analysis of a sample gas falls within this range and consequently, a fixed value of sensitivity and mdf are used. But in the case of argon and particularly in certain cases (like in ureilites), this may not be true as we deal with samples having a wide range of 40Ar/36Ar ratios (10-3 to 104). It was noticed that the values for 38Ar/36Ar in ureilites (having 40Ar/36Ar 40Ar/36Ar = 295.5. This was the motivation for investigating the pressure effect on the measured ratio of 38Ar/36Ar

  10. Beta decay of 31Ar

    International Nuclear Information System (INIS)

    A complete study of 31Ar beta decay has been made by high-resolution charged-particle and gamma-ray spectroscopy. Beta-delayed radiation was detected by an array of three charged-particle detectors and a large-volume germanium detector. Fifteen new energy levels were discovered in 31Cl. The beta-strength distribution, measured to 14.5 MeV, is compared with a shell-model calculation in the full sd space. The quenching of the Gamow-Teller strength and the isospin impurity of the IAS in 31Cl are discussed. (orig.)

  11. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  12. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  13. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L. sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L. under air exposure stress

    Directory of Open Access Journals (Sweden)

    Roberta Dias da Silva

    2012-12-01

    Full Text Available No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM, a hemoglobina corpuscular média (HCM, a concentração de hemoglobina corpuscular média (CHCM, o leucograma, contagem diferencial de leucócitos, o plaquetograma, a glicose, a proteína total, o colesterol, o triglicerídeo e os eletrólitos (cálcio, cloretos, sódio e potássio. Os resultados revelaram que houve uma homogeneidade de distribuição para hemácias, volume globular, hemoglobina, índices hemantimétricos, proteína total, glicose, colesterol, e íons séricos, indicados pelos valores relativamente baixos do coeficiente de variação. Houve correlação positiva somente para leucócitos totais, células de defesa orgânica (neutrófilos e linfócitos, glicose, colesterol, sódio e cálcio. Quanto ao leucograma, à medida que os animais foram expostos ao ar, o número de leucócitos diminuiu gradativamente (leucopenia, ocorrendo simultaneamente neutrofilia e linfopenia. O índice glicêmico constituiu um bom indicador de estresse fisiológico, devido à hiperglicemia (82,0±20,88mg/dL demonstrada nos tratamentos. A exposição ao ar constituiu um fator de desequilíbrio na homeostase iônica, e na síntese de colesterol endógeno. Entretanto, o tempo de recuperação não ocasionou a completa reabilitação fisiológica frente ao desafio imposto.The present study evaluated the hematological and biochemical parameters of adult tilapia (Oreochromis niloticus under the influence of the physiological stress factor in animals submitted to air exposure during fattening in raceway system. Blood cell count, hemoglobin, hematocrit, mean corpuscular volume (MCV, mean

  14. Caracterização da fusão peritética do cloreto de sódio di-hidratado por curvas de aquecimento Sodium chloride dihydrate peritetic melting characterization through heating curves

    Directory of Open Access Journals (Sweden)

    Edward de Souza

    2009-01-01

    Full Text Available Binary mixture phase diagrams are normally obtained from thermal analysis involving freezing point curves. However, that approach is not always reliable and easy to follow to all kinds of mixtures in any proportion. In fact, even for a simple system, such as NaCl-H2O, this freezing methodology gives mixed results when one starts from a solid-solution system, due mostly to the formation of the NaCl.2H2O, which has an incongruent melting point, and the dependence of its solubility with the temperature. In this work we report a trustworthy, simple and cheap method involving heating curves to drawn the NaCl-H2O phase diagram.

  15. Influência do aquecimento sobre diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei (Boone, 1931 = Influence of heating under different titration methods of residual SO2 on shrimps Litopenaeus vannamei (Boone, 1931

    Directory of Open Access Journals (Sweden)

    Karla Patrícia Brito de Araújo Vieira

    2008-01-01

    Full Text Available O metabissulfito de sódio é o conservante mais aplicado na carcinicultura, com uso amparado em legislações vigentes no país, todavia, seu resíduo, dióxido de enxofre (SO2, em concentrações altas, pode provocar reações adversas à saúde. Este estudo foidesenvolvido com a finalidade de observar a influência do aquecimento sob diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei. Os camarões foram submetidos a nove concentrações de metabissulfito de sódio e avaliados com diferentesmétodos de detecção de SO2. O método da titulação Adolfo Lutz adaptado apresentou grande sensibilidade para detecção de SO2 residual. O método da titulação iodométrica com aquecimento possibilitou a detecção de maiores níveis de SO2, quando comparado aométodo sem o aquecimento. O aquecimento interferiu negativamente no método da fita reativa. Conclui-se que o aquecimento influenciou positivamente a titulação iodométrica, não ocorrendo o mesmo com a fita reativa.Sodium metabisulfite is the most applied preservative in shrimp culture, with its use supported by current legislation; however, its residue, sulfur dioxide (SO2, in high concentrations can provoke adverse health reactions. This study evaluated the influence of heating under different methods of residual SO2 titration in Litopenaeus vannamei. Shrimps were treated with nine concentrations of sodium metabisulfite and evaluated by different methods of SO2 titration. The adapted Adolfo Lutz titration method presented the highest sensitivity for the detection of SO2. The method of iodometric titration with heating made possible the detention ofhigher levels of SO2, when compared to the same method without heating. The heating influenced negatively on the reactive ribbon method. It is concluded that the heating influenced positively on the iodometric titration, as opposed to the reactive ribbon.

  16. Dating blueschist metamorphism: a combined 40Ar/39Ar and electron microprobe approach

    International Nuclear Information System (INIS)

    40Ar/39Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of 40Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (3140 to 4500C), however, is close to the estimated peak metamorphic temperatures (3250 +- 500C), suggesting that phengite 40Ar/39Ar plateau dates may coincide closely with the time of blueschist metamorphism. (author)

  17. Triaxial superdeformation in $^{40}$Ar

    CERN Document Server

    Taniguchi, Yasutaka; Kimura, Masaaki; Ikeda, Kiyomi; Horiuchi, Hisashi; Ideguchi, Eiji

    2010-01-01

    Superdeformed (SD) states in $^{40}$Ar have been studied using the deformed-basis antisymmetrized molecular dynamics. Low energy states were calculated by the parity and angular momentum projection (AMP) and the generator coordinate method (GCM). Basis wave functions were obtained by the energy variation with a constraint on the quadrupole deformation parameter $\\beta$, while other quantities such as triaxiality $\\gamma$ were optimized by the energy variation. By the GCM calculation, an SD band is obtained just above the ground state band. The SD band involves a $K^\\pi = 2^+$ side band due to the triaxiality. The calculated quadrupole electric transition strengths of the SD band reproduce well the experimental values. Triaxiality is significantly important to understand low-lying states.

  18. Estudio de daños genotóxicos y teratogénicos en pez cebra (danio rerio Hamilton, 1822) por acumulación del nivel de arsénico presente en el agua de Zimapán, Hidalgo

    OpenAIRE

    Baéz Ramírez, Oliveria Araceli

    2005-01-01

    Se estudiaron los daños genotóxicos (inducción de micronúcleos en células de las branquias) y teratogénicos en el pez cebra (danio rerio), causados por la exposición a niveles subcrónicos de As en agua. Los peces se estudiaron en agua de un pozo de referencia y del pozo "Zimapán 5", el segundo con un contenido de As que varía de 395 a 630 µg/L. Para el estudio genotóxico los especímenes fueron observados durante 180 días en 3 lotes separados con 55 animales/lote: uno con agua del pozo de refe...

  19. Protocolo de Quioto e as possibilidades de inserção do Brasil no Mecanismo de Desenvolvimento Limpo por meio de projetos em energia limpa The Kyoto Protocol and the possibilities for the insertion of Brazil at the Clean Development Mechanism through projects in clean energy

    Directory of Open Access Journals (Sweden)

    Helena Margarido Moreira

    2008-04-01

    Full Text Available Este artigo pretende estudar a inserção do Brasil no Mecanismo de Desenvolvimento Limpo (MDL do Protocolo de Quioto, por meio de projetos em energia limpa, enfatizando a cooperação entre países desenvolvidos e em desenvolvimento e visando as ações práticas que esse mecanismo permite desenvolver para se alcançar o desenvolvimento sustentável e para conter o aquecimento global. Para isto, realizou-se extensa revisão bibliográfica dos acordos internacionais referentes às mudanças climáticas e de livros e artigos sobre a inserção brasileira no Protocolo de Quioto e no Mecanismo de Desenvolvimento Limpo. O Protocolo de Quioto é um acordo internacional que prevê a redução das emissões de gases de efeito estufa por intermédio de mecanismos flexibilizadores. O Mecanismo de Desenvolvimento Limpo é o único que permite a participação de países em desenvolvimento, para que eles reduzam emissões por meio de projetos que busquem o desenvolvimento sustentável. Neste contexto, o Brasil surge como um país atrativo para o recebimento destes projetos, por sua vocação para desenvolver fontes alternativas de energia e pela sua liderança no processo negociador do Protocolo. O MDL configura-se, portanto, em uma grande oportunidade para o Brasil, visto que esses projetos representam uma fonte de recursos financeiros para que o país busque o desenvolvimento sustentável, além de incentivarem um maior conhecimento científico e a adoção de novas tecnologias.This article intends to study the insertion of Brazil at the Clean Development Mechanism (CDM of the Kyoto Protocol, through clean energy projects, emphasizing the cooperation between developed and developing countries, and aiming the practical actions that this mechanism allows to build up in order to reach the sustainable development and to stop the global warming. To achieve this, an intense bibliographic review of the international agreements concerning climate change, and

  20. Quantificação das Emissões de Gases Efeito Estufa – GEEs – Segundo Matriz Energética Diesel ou GNV no Transporte Público por Ônibus em NATAL–RN

    OpenAIRE

    Ricardo Teixeira Gregório Andrade; Enilson Medeiros dos Santos

    2010-01-01

    Dentre os contribuintes à poluição atmosférica mundial, o setor de transportes é responsável por considerável montante de emissões de gases poluentes. As emissões de gases poluentes causam uma gama de prejuízos sanitários, ambientais e, portanto, econômicos. Face à temática do aquecimento global e ao contexto do ganho de créditos de carbono via projetos tipo Mecanismo de Desenvolvimento Limpo (MDL), mostram-se favoráveis os estudos que possibilitem mitigar tais emissões e conseqüentes prejuíz...

  1. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharge

    Directory of Open Access Journals (Sweden)

    Euclides Alexandre Bernardelli

    2011-12-01

    Full Text Available Stearic acid (CH3(CH216COOH was treated with Ar and Ar-O2 (10% pulsed DC discharges created by a cathode-anode confined system to elucidate the role of oxygen in plasma cleaning. The treatment time (5 to 120 minutes and plasma gas mixture (Ar and Ar-O2 were varied, and the results showed that the mass variation of stearic acid after Ar-O2 plasma exposure was greater than that of pure Ar plasma treatment. Thus, compared to Ar*, active oxygen species (O and O2, in all states enhance the etching process, regardless of their concentration. During the treatments, a liquid phase developed at the melting temperature of stearic acid, and differential thermal analyses showed that the formation of a liquid phase was associated with the breakage of bonds due to treatment with an Ar or Ar-O2 plasma. After treatment with Ar and Ar-O2 plasmas, the sample surface was significantly modified, especially when Ar-O2 was utilized. The role of oxygen in the treatment process is to break carbonaceous chains by forming oxidized products and/or to act as a barrier again ramification, which accelerates the etching of stearic acid.

  2. Geochronology (40Ar/39Ar, K-Ar and He-exposure ages of Cenozoic magmatic rocks from Northern Chile (18-22°S: implications for magmatism and tectonic evolution of the central Andes

    Directory of Open Access Journals (Sweden)

    Gerhard Wörner

    2000-12-01

    norte de Chile (18-22°S: implicancias para el magmatismo y la evolución tectónica de los Andes centrales. Las edades K-Ar y Ar/Ar de rocas magmáticas del norte de Chile (18-22°S describen la duración y extensión de la evolución magmática terciaria y cuaternaria, y datan los eventos tectónicos mayores en esta región. Este trabajo resume nuevas edades K-Ar y Ar/Ar en minerales y roca total para intrusivos de la Precordillera, ignimbritas cenozoicas y estratovolcanes andesíticos del Escarpe Andino Occidental a los 18°S, y del frente volcánico. Las rocas intrusivas de la Precordillera (Quebrada Paguana, Quebrada Blanca, Quebrada Choja, Quebrada Guatacondo, Cerro Chandacolla representan el sistema de arco magmático cretácico a Eoceno, y dieron edades entre 45 y 35 Ma. Edades menores en rocas intrusivas son invariablemente causadas por alteración deutérica. Las ignimbritas de las formaciones Putani y Oxaya dieron edades Ar-Ar en sanidina alrededor de 24.2 a 24.8 Ma y 22.8 a 19.4 Ma, respectivamente. Los estratovolcanes andesíticos que sobreyacen directamente a las ignimbritas de Oxaya al norte de la Cordillera Occidental, dieron edades de 20.3Ma (Cordón Quevilque a 9.0 Ma (Cordón Margarita. Las muestras del Sistema de Arco Mioceno a Pleistoceno en el altiplano chileno que infrayacen a los volcanes del frente volcánico activo, han sido datadas entre 10.5 y ca. 3 Ma. Una ignimbrita de extensa distribución areal puede ser corelacionada desde la cuenca de Lauca hasta la costa del Pacífico, y hacia el este con ocurencias vecinas a Pérez. Dataciones repetidas por el método Ar-Ar en sanidina de la ignimbrita Lauca-Pérez dieron resultados concordantes de 2.7±0.25 Ma, 2.72±0.01 Ma y 2.73±0.01 Ma. Rocas del arco actual (Cordillera Volcánica dieron edades más jóvenes que 0. 9 Ma (volcanes, Irruputuncu, Olca, Aucanquilcha, Ollagüe, Poruñita. Estos nuevos datos se usan para constreñir la estratigrafía miocena, los movimientos tectónicos y la cronolog

  3. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  4. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  5. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  6. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  7. 40Ar/39Ar laser-probe dating of diamond inclusions from the Premier kimberlite

    International Nuclear Information System (INIS)

    Inclusions encapsulated by diamonds at the time of their formation provide a means for determining diamond crystallization ages and the chemistry of the surrounding upper mantle at that time. Sm-Nd studies of peridotitic inclusions, from Cretaceous-age kimberlites in southern Africa, suggest that the diamonds formed 3.3 Gyr ago. By contrast, eclogite-suite inclusions generally yield younger ages, sometimes approaching the time of kimberlite eruption. Here we report the results of 40Ar/39Ar laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds, which yield a mean age of 1,198±14 Myr. This age agrees well with Sm-Nd and 40Ar/39Ar analyses on similar Premier inclusions, and is indistinguishable from the inferred time of emplacement of the host kimberlite (1,150-1,230 Myr), which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated non-radiogenic 40Ar/36Ar ratio of 334±102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source (40Ar/36Ar>20,000). Pre-entrapment equilibration of the inclusions with an 36Ar-rich fluid is the most probable explanation for the low non-radiogenic (40Ar/36Ar) composition. (author)

  8. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  9. Ar-40/Ar-39 laser-probe dating of diamond inclusions from the Premier kimberlite

    Science.gov (United States)

    Phillips, D.; Onstott, T. C.; Harris, J. W.

    1989-01-01

    The results of Ar-40/Ar-39 laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds are reported which yield a mean age of 1198 + or - 14 Myr. This age agrees well with Sm-Nd and Ar-40/Ar-39 analyses on similar Premier inclusions and is indistinguishable from the inferred time of emplacement of the host kimberlite, which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated nonradiogenic Ar-40/Ar-36 ratio of 334 + or - 102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source. Preentrapment equilibration of the inclusions with an Ar-36-rich fluid is the most probable explanation for the low nonradiogenic composition.

  10. 39Ar-40Ar systematics of two millimeter-sized rock fragments from Mare Crisium

    International Nuclear Information System (INIS)

    Two small fragments, L24B, a glass-rich agglutinate (1.9mg) and L24A, a fine-grained lithic fragment (9.4mg), from the Luna 24 landing site have been neutron irradiated for the purpose of 39Ar-40Ar dating. A fairly well-defined 39Ar-40Ar plateau age of 3.65+-0.12 AE was found for the larger fragment. After appropriate corrections the composition of the trapped and spallogenic Ar could be deciphered. The evolution of 38Arsub(sp)/37Ar showed that 660 m.y. and 500 m.y. were the most reliable exposure ages for L24A and L24B, respectively. The Ti contents of <=0.6% determined by gamma-counting prior to the Ar analysis indicate both fragments being associated with the group of low-Ti or even very low-Ti basalts. (Auth.)

  11. 39Ar/Ar measurements using ultra-low background proportional counters

    Energy Technology Data Exchange (ETDEWEB)

    Hall, Jeter C.; Aalseth, Craig E.; Bonicalzi, Ricco; Brandenberger, Jill M.; Day, Anthony R.; Humble, Paul H.; Mace, Emily K.; Panisko, Mark E.; Seifert, Allen

    2016-01-08

    Age dating groundwater and seawater using 39Ar/Ar ratios is an important tool to understand water mass flow rates and mean residence time. For modern or contemporary argon, the 39Ar activity is 1.8 mBq per liter of argon. Radiation measurements at these activity levels require ultra low-background detectors. Low-background proportional counters have been developed at Pacific Northwest National Laboratory. These detectors use traditional mixtures of argon and methane as counting gas, and the residual 39Ar from commercial argon has become a predominant source of background activity in these detectors. We demonstrated sensitivity to 39Ar by using geological or ancient argon from gas wells in place of commercial argon. The low level counting performance of these proportional counters is then demonstrated for sensitivities to 39Ar/Ar ratios sufficient to date water masses as old as 1000 years.

  12. Miocarditis por dengue

    OpenAIRE

    Ricardo Amador García Hernández; Fidel Espinosa Rivera; Lianet Rivero Seriel

    2013-01-01

    El dengue es un arbovirus transmitido por el Aedes aegypti, produce los cuadros clínicos de dengue clásico, dengue hemorrágico y síndrome de choque por dengue, aisladamente se reportan casos de miocarditis. Se presentó un paciente con antecedentes de dengue clásico que manifestó dolor precordial asociado a cambios electrocardiográficos y fue ingresado en este hospital por síndrome coronario agudo probable, al cual se le diagnosticó clínicamente miocarditis por dengue.

  13. Progreso y retos de la geocronología 40Ar/39Ar en Costa Rica y Nicaragua Progress and Challenges Using 40Ar/39Ar Geochronology in Costa Rica and Nicaragua

    Directory of Open Access Journals (Sweden)

    Ian Saginor¹

    2011-12-01

    Full Text Available Con el principal objetivo de realizar mejores cálculos de la producción volcánica, en el Arco Volcánico de América Central, realizamos 61 dataciones 40Ar/39Ar en tefras y lavas en localidades de frente volcánico de Costa Rica y Nicaragua por medio de varias campañas de campo y análisis de laboratorio (preparación de muestras, envió al reactor nuclear, espectroscopía de masas de las muestras radiactivas, al laboratorio de gases nobles del Departamento de Ciencias de la Tierra y Planetarias de la Universidad Rutgers del 2002-2008. En este artículo presentamos diferentes observaciones que resultaron de este estudio donde se describe la precisión, exactitud y la confiabilidad de las edades 40Ar/39Ar. El primer resultado muestra las limitaciones de esta técnica en muestras baja en K2O con edades To better estimate the extrusive flux of the Central American Arc, from 2002-2008, we obtained sixty one high precision 40Ar/39Ar ages on geographically well-situated lavas and tephra from Costa Rica and Nicaragua. Here, we describe a number of observations encountered during this study using four examples that well document the precision, accuracy and general reliability of the 40Ar/39Ar ages. First, low K2O values, particularly in samples from Nicaragua, is a major limitation in or attempts to obtain reliable dates on samples under 1 My. Second, extensive weathering of samples due to the tropical climate of Central America has resulted in various levels of argon loss even when the hand sample appeared unaltered. Third, our field and geochronological data lead us to conclude that eruptive rates have not been constant over the past 15 to 20 My, but rather appears punctuated by gaps of up to several million years. We attempted to address the temporal gaps in several ways. First, geochemical analyses were used to identify samples that may have erupted during time periods without known volcanism. For example, U/Th values in the active Central

  14. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  15. On mechanism of Ar(3p54p) states excitation in low-energy Ar-Ar collisions

    International Nuclear Information System (INIS)

    The present work is devoted to study of Ar(3p54p) states excitation in binary low-energy Ar-Ar collisions. The results of the experimental investigation of excitation cross sections of Ar I 4p'[l/2]1, 4p'[3/2]1, 4p'[3/2]2 and 4p[3/2]2 levels in the collision energy range from threshold up to 500 eV (cm) and degree of polarization for 4s[3/2]20-4p'[l/2]1 and 4s[3/2]20-4p[3/2]2 transitions in this energy range are represented.

  16. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  17. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  18. Estudio del sistema simbiótico AR Pavonis

    Science.gov (United States)

    Quiroga, C.; Brandi, E.; Ferrer, O.; García, L.; Barbá, R.

    Se presenta un estudio espectroscópico y polarimétrico de la binaria eclipsante AR Pavonis a partir de observaciones obtenidas con el telescopio de 2.15 m. del CASLEO (San Juan). El estudio de la naturaleza del sistema se realizó a través del análisis de algunos espectros reunidos entre los años 1990 y 1995 y de datos polarimétricos correspondientes al intervalo 1995 y 1997. El análisis espectroscópico indica que AR Pav está compuesta por una gigante roja M3.7 y una componente caliente compacta, con una temperatura mayor a 90000 K y una luminosidad del orden de 500Lsolar. A lo largo del período orbital, las variaciones observadas en flujo y en velocidades radiales, reflejan que las emisiones permitidas se forman en una región que rodea la componente caliente. El estudio de la polarización lineal de AR Pav indica que además de una componente interestelar, existe una componente intrínseca del sistema que varía temporalmente y con la longitud de onda de la luz polarizada. El distinto comportamiento del grado de polarización y del ángulo de posición observado en fases diferentes, sugiere que distintos mecanismos pueden estar actuando, dependiendo de la región de scattering observado a lo largo de la línea de la visual.

  19. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  20. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  1. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  2. The mass of 32Ar and 33Ar for fundamental tests

    International Nuclear Information System (INIS)

    Masses of the short-lived radionuclides 32Ar (T1/2 = 98 ms) 33Ar (T1/2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10-8 (δm = 1.8 keV) and 1.4 x 10-8 (δm = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of 32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for 44Ar and 45Ar, and a 20σ deviation for 44Ar from the literature value was found and interpreted. (orig.)

  3. Dating blueschist metamorphism: a combined /sup 40/Ar//sup 39/Ar and electron microprobe approach

    Energy Technology Data Exchange (ETDEWEB)

    Sisson, V.B.; Onstott, T.C.

    1986-09-01

    /sup 40/Ar//sup 39/Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of /sup 40/Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (314/sup 0/ to 450/sup 0/C), however, is close to the estimated peak metamorphic temperatures (325/sup 0/ +- 50/sup 0/C), suggesting that phengite /sup 40/Ar//sup 39/Ar plateau dates may coincide closely with the time of blueschist metamorphism.

  4. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian...... retrograde chlorite formation. We conclude that even very minor chloritisation of biotite is apparently a more effective parameter than temperature in resetting the Ar clock, as is the formation of plagioclase from paragonite decomposition. Multi-equilibrium thermobarometry is necessary to ensure that...

  5. 40Ar/39Ar age and thermal history of the Kirin chondrite

    International Nuclear Information System (INIS)

    The Kirin meteorite, a large (> 2800 kg) H5 chondrite, fell in Kirin Province, China in 1976. A sample from each of the two largest fragments (K-1. K-2) yield 40Ar/39Ar total fusion ages of 3.63 +- 0.02 b.y. and 2.78 +- 0.02 b.y. respectively. 40Ar/40Ar age spectra show typical diffusional argon loss profiles. Maximum apparent ages of 4.36 b.y. (K-1) and approx. 4.0 b.y. (K-2) are interpreted as possible minimum estimates for the age of crystallization of the parent body. (orig./ME)

  6. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  7. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  8. Umidificação e aquecimento do gás inalado durante ventilação artificial com baixo fluxo e fluxo mínimo de gases frescos Humidificación y calentamiento del gas inhalado durante ventilación artificial con bajo flujo y flujo mínimo de gases frescos Inhaled gases humidification and heating during artificial ventilation with low flow and minimal fresh gases flow

    OpenAIRE

    Susane Bruder Silveira Gorayb; José Reinaldo Cerqueira Braz; Regina Helena Garcia Martins; Norma Sueli Pinheiro Módolo; Giane Nakamura

    2004-01-01

    JUSTIFICATIVA E OBJETIVOS: Em pacientes sob intubação traqueal ou traqueostomia, a umidificação e o aquecimento do gás inalado são necessários para a prevenção de lesões no sistema respiratório, conseqüentes ao contato do gás frio e seco com as vias aéreas. O objetivo da pesquisa foi avaliar o efeito do sistema respiratório circular com absorvedor de dióxido de carbono do aparelho de anestesia Cícero da Dräger, quanto à capacidade de aquecimento e umidificação dos gases inalados, utilizando-s...

  9. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  10. The thermal significance of potassium feldspar K-Ar ages inferred from 40Ar/39Ar age spectrum results

    International Nuclear Information System (INIS)

    40Ar/39Ar age spectrum analyses of three microcline separates from the Separation Point Batholith, northwest Nelson, New Zealand, which cooled slowly through the temperature zone of partial radiogenic 40Ar accumulation are characterized by a linear age increase over the first 65 percent of gas release with the lowest ages corresponding to the time that the samples cooled below about 1000C. The last 35 percent of 39Ar released from the microclines yields plateau ages which reflect the different bulk mineral ages, and correspond to cooling temperatures between about 130 to 1600C. Theoretical calculations confirm the likelihood of diffusion gradients in feldspars cooling at rates =0C-Ma-1. Diffusion parameters calculated from the 39Ar release yield an activation energy, E = 28.8 +- 1.9 kcal-mol-1, and a frequency factor/grain size parameter, D0/l2 = 5.6sub(-3.9)sup(+14) sec-1. This Arrhenius relationship corresponds to a closure temperature of 132 +- 130C which is very similar to the independently estimated temperature. From the observed diffusion compensation correlation, this D0/l2 implies an average diffusion half-width of about 3 μm, similar to the half-width of the perthite lamellae in the feldspars. The results are discussed. (author)

  11. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  12. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian; Hilgen, Frederik; Kuiper, Klaudia

    sanidine age of 0.7674±0.0022 Ma (2σ, external errors) is indistinguishable from the ID-TIMS U/Pb zircon age (0.7671±0.0019 Ma). The consistency between the astronomically calibrated 40Ar/39Ar sanidine age and U/Pb zircon age for this Quaternary unit suggests that agreement between these two radio...

  13. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  14. K/Ar ages from basal gneiss region

    International Nuclear Information System (INIS)

    K/Ar and 40Ar/39Ar geochronology of minerals from the Stadlandet region, Norway, is complicated by the presence of excess 40Ar in many samples. There is a correlation between excess 40Ar concentration and textural occurrence of samples. Amphiboles and micas closely accociated with eclogite pods are likely to contain significant concentrations of excess 40Ar, while samples from the country rocks are not. K/Ar and 40Ar/39Ar ages for hornblende from the country rocks suggest that post-metamorphic cooling through 5000C occured about 410 Ma ago, shortly after eclogite formation. Biotites containing no excess 40Ar cooled through 3000C about 370 Ma ago. A post-metamorphic cooling rate of about 50C/Ma can be inferred

  15. Ar-41 measurements and nuclear emergency preparedness

    International Nuclear Information System (INIS)

    During the early phase of an emergency is necessary to confirm the release of radioactivity predictions made by the operator of the nuclear plant. In this context, it has begun measuring Ar-41 in the vicinity of a research reactor. Since the Ar-41 is produced in the reactor, it has been studied as a good way to validate the air dispersion model used in nuclear emergencies and to develop a method to improve the characterization of the release. For this latter purpose a pilot experiment was conducted to determine computational and experimental methods, the flux of 1.29 MeV of Ar-41 and compared to evaluate the accuracy of the assessments made. This paper describes meteorological forecasting systems used in the experiment, the estimate of the stability class and the concentration of nuclides using a calculation code developed by the ARN, as well as the methodology and equipment used for measurement in the field. (authors)

  16. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  17. Online Scene Modeling for Interactive AR Applications

    OpenAIRE

    Yoo, Jaesang; Cho, Kyusung; Jung, Jinki; Yang, Hyun S.

    2010-01-01

    Augmented reality applications require 3D model of environment to provide even more realistic experience. Unfortunately, however, most of researches on 3D modeling have been restricted to an offline process up to now, which conflicts with characteristics of AR such as realtime and online experience. In addition, it is barely possible not only to generate 3D model of whole world in advance but also trasfer the burden of 3D model generation to a user, which limits the usability of AR. Thus, it ...

  18. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  19. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  20. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  1. ANÁLISE DE DIFERENTES VISCOSIDADES A PARTIR DA APLICAÇÃO DO AQUECIMENTO GERAL INDIRETO COMO MÉTODO DE RECUPERAÇÃO EM RESERVATÓRIOS PETROLÍFEROS

    Directory of Open Access Journals (Sweden)

    Elthon John Rodrigues Medeiros

    2011-12-01

    Full Text Available Cada barril de petróleo é relevante e até os campos produtores de difícil acesso têm importância. O petróleo viscoso e os baixos níveis de pressão nos reservatórios rasos dificultam a recuperação. O principal método de recuperação aplicado a esse tipo de petróleo é a injeção de vapor. O Aquecimento Geral Indireto - AGI (Blanket Heating é uma técnica que utiliza a injeção de vapor através de canalizações horizontais. O fluido aquecido funciona como um trocador de calor, transferindo indiretamente o calor do vapor ao óleo, reduzindo a sua viscosidade. Para testar esse método e compará-lo ao tradicional processo de injeção contínua de vapor foi utilizado o simulador comercial STARS da CMG. Estudou-se a eficiência do método em relação à variação nos parâmetros de reservatório. Os resultados mostraram que a recuperação pode ser maximizada proporcionalmente ao aumento no número de canalizações e da sua temperatura. A produção acumulada de óleo diminuiu quando as canalizações foram afastadas entre si, ou dos poços produtores. O AGI não produziu emissões consideráveis de vapor à superfície, confirmando a redução na água produzida. Houve diferença significativa entre as recuperações primárias de modelos com viscosidades distintas, quando aplicado nesses mesmos modelos o processo AGI, sobretudo entre óleos de 300 e 10000 cP.

  2. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  3. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharges

    International Nuclear Information System (INIS)

    Stearic acid (C18H36O2) was treated into Ar and Ar-O2(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O2 plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O2 in all states) strongly enhance the etching process with regards to A* species, regardless of their concentration. After treatment by Ar and Ar-O2 plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O2 plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  4. Study of Ar and Ar-CO2 microwave surfaguide discharges by optical spectroscopy

    Science.gov (United States)

    Silva, Tiago; Britun, Nikolay; Godfroid, Thomas; van der Mullen, Joost; Snyders, Rony

    2016-05-01

    A surfaguide microwave discharge operating at 2.45 GHz in Ar and Ar-CO2 mixtures is studied using diagnostics methods based on optical emission spectroscopy. The population densities of Ar metastable and resonant states of the lowest group of excited levels ( 1 s x ) are investigated for several experimental conditions using the self-absorption technique. It is found that the densities of these levels, ranging from 1017 to 1016 m-3 for the pure Ar case, are dependent on the discharge pressure and applied power. The electron temperature and electron density are calculated via the balances of creation/loss mechanisms of radiative and metastable levels. In the range of the studied experimental conditions (50-300 W of applied power and 0.5-6 Torr of gas pressure), the results have shown that lower values of electron temperature correspond to higher values of power and pressure in the discharge. Adding CO2 to the argon plasma results in a considerable decrease (about 3 orders of magnitude) of the Ar metastable atom density. The feasibility of using the ratio of two Ar emission line intensities to measure the electron temperature in CO2 discharges with small Ar admixtures is studied.

  5. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  6. Hazard evaluation for 244-AR vault facility

    International Nuclear Information System (INIS)

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  7. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  8. Lignocellulosic Biofuels: Bioenergy Research at ARS

    Science.gov (United States)

    The growth and long-term viability of bioenergy production in the Nation are impeded by a number of technical and commercial barriers. Agricultural Research Service (ARS) addresses technical barriers and does so by leveraging its strengths and unique capabilities to (1) pursue technical barriers th...

  9. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  10. A compilation of 40Ar-39 and K-Ar ages: report 25

    International Nuclear Information System (INIS)

    Twenty-three 40Ar-39Ar age determinations (including two potassium-argon analyses) carried out by the Geological Survey of Canada are reported. Each age determination is accompanied by a description of the rock and mineral concentrate used; brief interpretative comments regarding the geological significance of each age are also provided where possible. The experimental procedures employed are described in outline. An index of all Geological Survey of Canada K-Ar age determinations published in this format has been prepared using NTS quadrangles as the primary reference. (author). 6 refs., 2 tabs., 1 fig

  11. DECOMPOSIÇÃO TÉRMICA DE PELLETS DE MADEIRA POR TGA

    Directory of Open Access Journals (Sweden)

    Dorival Pinheiro Garcia

    2016-03-01

    Full Text Available A utilização dos pellets de madeira para a geração de energia térmica está se difundindo no Brasil e a termogravimetria tem sido amplamente aplicada para o estudo da decomposição da madeira e seus principais componentes como a celulose, hemiceluloses e lignina. O objetivo deste trabalho foi investigar o comportamento térmico de quatro diferentes amostras de pellets de madeira, em condições não isotérmicas, por meio das análises termogravimétricas TGA. Os ensaios foram conduzidos desde a temperatura ambiente até 500°C, com taxa de aquecimento de 20°C/min, em atmosfera inerte de gás nitrogênio, com fluxo de 100 mL/min.  Os termogramas mostraram três estágios de decomposição: o primeiro, atribuído à evaporação da água e dos materiais voláteis; o segundo, refere-se à decomposição da holocelulose na pirólise ativa; e o terceiro, atribuído a decomposição da lignina na pirólise passiva. Além disso, conclui-se que a maior decomposição térmica ocorreu na faixa de temperatura compreendida entre 250°C e 400°C, com perdas superiores a 60,8% da massa inicial do biocombustível.

  12. The ChArMEx database

    Science.gov (United States)

    Ferré, Hélène; Belmahfoud, Nizar; Boichard, Jean-Luc; Brissebrat, Guillaume; Cloché, Sophie; Descloitres, Jacques; Fleury, Laurence; Focsa, Loredana; Henriot, Nicolas; Mière, Arnaud; Ramage, Karim; Vermeulen, Anne; Boulanger, Damien

    2015-04-01

    The Chemistry-Aerosol Mediterranean Experiment (ChArMEx, http://charmex.lsce.ipsl.fr/) aims at a scientific assessment of the present and future state of the atmospheric environment in the Mediterranean Basin, and of its impacts on the regional climate, air quality, and marine biogeochemistry. The project includes long term monitoring of environmental parameters , intensive field campaigns, use of satellite data and modelling studies. Therefore ChARMEx scientists produce and need to access a wide diversity of data. In this context, the objective of the database task is to organize data management, distribution system and services, such as facilitating the exchange of information and stimulating the collaboration between researchers within the ChArMEx community, and beyond. The database relies on a strong collaboration between ICARE, IPSL and OMP data centers and has been set up in the framework of the Mediterranean Integrated Studies at Regional And Locals Scales (MISTRALS) program data portal. ChArMEx data, either produced or used by the project, are documented and accessible through the database website: http://mistrals.sedoo.fr/ChArMEx. The website offers the usual but user-friendly functionalities: data catalog, user registration procedure, search tool to select and access data... The metadata (data description) are standardized, and comply with international standards (ISO 19115-19139; INSPIRE European Directive; Global Change Master Directory Thesaurus). A Digital Object Identifier (DOI) assignement procedure allows to automatically register the datasets, in order to make them easier to access, cite, reuse and verify. At present, the ChArMEx database contains about 120 datasets, including more than 80 in situ datasets (2012, 2013 and 2014 summer campaigns, background monitoring station of Ersa...), 25 model output sets (dust model intercomparison, MEDCORDEX scenarios...), a high resolution emission inventory over the Mediterranean... Many in situ datasets

  13. Estudio de los niveles de plomo, cadmio, zinc y arsénico, en aguas de la provincia de Salamanca

    OpenAIRE

    Blanco Hernández Angel Luis; Alonso Gutiérrez Dionisio; Jiménez de Blas Oroncio; Santiago Guervós Margarita; Miguel Manzano Benito de

    1998-01-01

    FUNDAMENTOS: Conocer el grado de contaminación por plomo, cadmio, cinc y arsénico de las aguas de la provincia de Salamanca y su relación con la zona de procedencia de las muestras y el punto de recogida de las mismas. MÉTODO: Estudio epidemiológico transversal, observacional y descriptivo. Se han estudiado aguas procedentes de redes de abastecimiento, fuentes, manantiales, pozos, ríos, riveras y lagunas de la provincia de Salamanca, analizándose los contenidos de plomo, cadmio, zinc y arséni...

  14. Nevo epidérmico manifestando-se como hiperceratose do mamilo e aréola Verrucous epidermal nevus manifesting as nipple and areola hyperkeratosis

    OpenAIRE

    Roberto Rheingantz da Cunha Filho; Hiram Larangeira de Almeida Jr.; André Cartell

    2006-01-01

    Relata-se caso raro de nevo epidérmico na aréola mamária direita de menina de 13 anos. Segundo a classificação proposta por Levy-Franckel, essa variante é a hiperceratose do mamilo e aréola do tipo I, quando associada a nevo verrucoso. A histologia mostrou papilomatose, acantose e hiperceratose. Foram realizadas duas sessões de crioterapia sem melhora. Foi obtido bom resultado por meio de shaving e eletrocauterização.A rare case of a 13-year-old female patient with epidermal verrucous nevus o...

  15. Active cutaneous warming systems to prevent intraoperative hypothermia: a systematic review Métodos activos de calentamiento cutáneo para la prevención de hipotermia en el período intraoperatorio: revisión sistemática Métodos ativos de aquecimento cutâneo para a prevenção de hipotermia no período intraoperatório: revisão sistemática

    Directory of Open Access Journals (Sweden)

    Vanessa de Brito Poveda

    2012-02-01

    íveis na literatura sobre a efetividade dos diferentes métodos ativos de aquecimento cutâneo, para a prevenção de hipotermia no período intraoperatório. Para tal, a revisão sistemática foi empregada como método de revisão. A busca por estudos primários foi realizada nas bases de dados CINAHL, EMBASE, Cochrane Register of Controlled Trials e MEDLINE. A amostra da revisão foi composta por 23 ensaios clínicos randomizados controlados. Na literatura, há evidências que indicam que o sistema de circulação de água aquecida é o método mais efetivo à manutenção da temperatura corporal. Os resultados evidenciados podem subsidiar a tomada de decisão do enfermeiro na implementação de medidas efetivas para a manutenção da temperatura corporal. Recomenda-se, entretanto, que a escolha do sistema em cada serviço de saúde seja também baseada na análise custo/benefício, devido aos custos relativos à aquisição dos sistemas investigados.

  16. New Approach to Estimate 40Ar/36Ar Ratio in Shocked Meteorites

    Science.gov (United States)

    Fujimoto, H.; Hyodo, H.; Ninagawa, K.

    2008-12-01

    Measurement of a 40Ar/39Ar age in a meteorite requires proper estimation of a 40Ar/36Ar "initial" ratio. For a primordial one, it is reported to be an order of 10-4, suggesting that one can ignore it in age calculation. However, there is no basis for applying this value as individual meteorites have different histories. In terms of 40Ar/39Ar studies on various meteorites, very few studies discuss how the ratios were estimated. Using terrestrial value of 295.5 is invalid. The only case in which the ratio does not affect on the results is when an age of a meteorite is in an order of billion years, resulting in a large raw 40Ar/36Ar ratio. A proper approach to estimate the ratio is application of isochron analyses. When a small amount of sample (a few micrograms) is studied in laserprobe analysis, this often becomes difficult. A shocked meteorite Y-75097 has developed maskelynite veins, which were identified in optical microscope, electron microprobe and thermoluminescence studies. We have applied 40Ar/39Ar dating method using both stepwise heating by a continuous laser and pinpoint dating by a pulsed laser. Stepwise heating results of several fragments (about 50 micrograms) of the meteorite yielded various old and young ages. Most pinpoint analyses gave the raw 40Ar/36Ar ratio less than the terrestrial value with sporadically and anomalously old ages. Among the data, three points isochron from a maskelynite vein yielded about 300 Ma with "initial" ratio of 180. To confirm this result, plagioclase and olivine data near the vein were plotted in a correlation diagram, but an isochron is not well defined due to relatively large analytical errors. A new method to analyze these data is proposed. Once 40Ar/39Ar ratio is determined from an experiment, the only factor which determines the age is the "initial" ratio in the 40Ar/39Ar age equation. Instead of using a known fixed ratio, we set the ratio (y-axis) and the age (x-axis) as variables. In this diagram, a single data

  17. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  18. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  19. An 40 Ar- 39 Ar study of the Cape Verde hot spot

    DEFF Research Database (Denmark)

    Holm, Paul Martin; Grandvuinet, Tanja; Wilson, James Richard;

    2008-01-01

    The 40Ar-39Ar analyses of 28 groundmass separates from volcanic rocks from the islands of Santiago, Sal, and São Vicente, Cape Verde archipelago, are presented. The new age data record the volcanic evolution for Santiago from 4.6 to 0.7 Ma, for Sal from around 15 to 1.1 Ma, and for São Vicente fr...

  20. Variscan polyphase tectonothermal record in the West Sudetes (Bohemian Massif) - deduced from Ar-Ar ages

    Czech Academy of Sciences Publication Activity Database

    Marheine, D.; Kachlík, V.; Patočka, František; Maluski, H.; Zelazniewicz, A.

    La Coruňa : International Basement Tectonics Association, 2000, s. 254-257. [International Conference on Basement Tectonics /15./, Galicia 2000.. La Coruňa (ES), 04.07.2000-08.07.2000] R&D Projects: GA AV ČR BARRANDE97008; GA AV ČR KSK1012601 Institutional research plan: CEZ:AV0Z3013912 Keywords : HP-LT-; HT- metamorphic rocks * tectonothermal events * Ar-Ar geochronology Subject RIV: DB - Geology ; Mineralogy

  1. Ar-Ar Isotopic age of lamproite dikes of the Chuisky complex, Gorny Altai

    International Nuclear Information System (INIS)

    The age of lamproite dikes of the Chuisky complex of the Gorny Altai was identified by the method of Ar-Ar isotope dating. The previously established Early-Middle Triassic age (236.5 ± 3.8 mln. years) of the dikes permits relating their formation and activities of the superplume, which dictated the development of the Permian-Triassic magmatism within vast territories in the Northern and Central Asia

  2. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  3. Plasma etching of III-nitrides in ICl/Ar and IBr/Ar plasmas

    International Nuclear Information System (INIS)

    Two new plasma chemistries, ICl/Ar and IBr/Ar, were investigated for dry etching of III-nitrides. Under electron cyclotron resonance conditions, we examined the effect of plasma composition, and source and chuck power on etch rates and surface morphology. The etch rate of InN proved to be the most sensitive of the materials investigated to the plasma composition and ion density in ICl plasmas. The GaN, InN, and InGaN etch rates reached ∼13000, 11500, and 7000 Angstrom/min, respectively, at 250 W rf chuck power and 1000 W microwave source power for ICl discharges. The etch rates in IBr plasmas were somewhat slower than in ICl. The etched surface of GaN was found to be smooth, with no significant preferential loss of N from the surface at low rf powers in either chemistry. There was no significant residue on the GaN surfaces after etching in IBr/Ar, and only slight chlorine contamination on the surfaces etched in ICl/Ar. Selectivities of 5 endash 10 for GaN over InN, AlN, or InAlN were achieved in ICl/Ar, but were <4 under all conditions with IBr/Ar. copyright 1997 American Vacuum Society

  4. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  5. Osteomielitis por salmonella

    Directory of Open Access Journals (Sweden)

    Alicia Velázquez Pérez

    2014-08-01

    Full Text Available Se presenta el caso de una paciente femenina de color blanco y dos años de edad, con diagnóstico prenatal de sicklemia, que desde edades tempranas tiene problemas de la enfermedad. Ingresó en esta ocasión por una de las complicaciones infecciosas que ocasiona este padecimiento, una osteomielitis del húmero izquierdo, aislándose el germen en el hemocultivo realizado, una salmonella. Necesitó de tratamiento enérgico y prolongado; se obtuvo un resultado satisfactorio en la evolución de la enfermedad y se sigue sistemáticamente por consulta externa en la actualidad

  6. tirados por tractores

    Directory of Open Access Journals (Sweden)

    Ciro E. Iglesias Coronel

    2006-01-01

    Full Text Available En el presente trabajo se brinda la metodología de realización y evaluación de los principales indicadores energéticos de los agregados de transporte agrícola, formados por tractores y remolques con el uso de la tensometría como herramienta para la toma de los datos experimentales de campo.

  7. K/Ar dating of diagenetic illite

    International Nuclear Information System (INIS)

    Ascertaining the potassium/argon (K/Ar) age of diagenetic illite yields important information for hydrocarbon exploration since the growth of this mineral in the pores of sandstone reservoir and oil migration are inter linked events in the diagenetic evolution of rocks. Illite was mechanically separated by repeating a series of ultrasonic baths and ultrasonic probes followed by high-speed centrifuging. Resultant fractions were analyzed by X-ray diffractometry to measure the illite content of each sample. The separated illite material was found to be composed of illite and ordered mixed layer illite-smectite with 80% illite layers. Separated fractions were dated radiometrically by the K/Ar method. Preliminary results indicate an average age of some 200 m.y., which marks the end of the diagenetic development of the illite of this area. (author)

  8. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  9. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  10. Modelagem de um condicionador de ar de alta precisão para uso em processamento agrícola Modeling of a high precision air conditioner for use in agricultural processing

    Directory of Open Access Journals (Sweden)

    Mauri Fortes

    2006-08-01

    Full Text Available Apresenta-se neste trabalho, estudo detalhado sobre a modelagem de um condicionador de ar com controle acurado de temperatura e umidade relativa. Desenvolveu-se um programa de computador que permite predizer o comportamento do sistema sob diferentes condições psicrométricas e de vazão do ar de entrada. O modelo global físico-matemático inclui equações de balanço de massa e de energia para três diferentes volumes de controle que compõem o condicionador. Modelaram-se os processos de mistura, evaporação (ou condensação simultânea de uma superfície d'água e de uma gota e o aquecimento de corrente de ar, separadamente. Propõem-se expressões semi-empíricas simples para os coeficientes de transferência de calor e massa inerentes ao processo de evaporação sobre uma superfície d'água e um modelo simplificado para o sistema de spray. Construiu-se um condicionador de ar no qual foram feitos testes experimentais para o ajuste das constantes que aparecem nas expressões para os coeficientes de transferência. Os dados obtidos validaram o modelo global, com precisão aceitável para projetos de engenharia.In this work, a detailed procedure for the analysis of an accurately controlled air conditioner is presented. A computer program, that allows predicting the behavior of the system under different psychrometric conditions and different input air mass flow rates, was developed. The global physical-mathematical model includes mass and energy conservation equations for three different control volumes that compose the conditioner. Thus, the processes of mixture of air, simultaneous evaporation (or condensation from a water surface and from a drop, and the air-stream heating are modeled separately. Simple semi-empiric expressions for heat and mass coefficients inherent to the evaporation process on a water surface are proposed as well a simplified model for the spray system. Experimental tests made on an air-conditioner allowed to obtain

  11. Theoretical photoabsorption spectra of Ar n+ clusters

    Science.gov (United States)

    Doltsinis, Nikos L.; Knowles, Peter J.

    2000-08-01

    The photoabsorption spectra of selected Ar n+ clusters ( n=7, 8, 17, 19, 23) have been investigated theoretically using an extended Diatomics-in-Molecules approach including induced dipole - induced dipole and spin-orbit coupling interaction effects. Our calculations at 0 K confirm the experimentally observed spectral red-shift of the visible photoabsorption peak in the region 15Haberland et al., Phys. Rev. Lett. 67 (1991) 3290] by carrying out finite temperature Monte Carlo simulations.

  12. Irradiation of samples for 40Ar/39Ar dating using the Soreq Nuclear Research Center IRR-1 Reactor, Israel

    International Nuclear Information System (INIS)

    A facility for the irradiation of geological samples for 40Ar/39Ar dating has been established at the Israel Research Reactor No.1 (IRR-1). A Cd shielded Al irradiation canister is rotated at a position close to the core. The power of the reactor is usually rated at 4.5 MW and the total neutron flux is 1 to 3 x 1013 n/cm2 x s in the center of the core. The ratio of thermal/fast neutrons has been found to be 2 and K2SO4. The Ar production rations for these are: (36Ar/37Ar)Ca = 2.38(±0.28) x 10-4; (39Ar/37Ar)Ca = 12.1(±3.07) x 10-4; (40Ar/39Ar)k = 1.56(±0.40) x 10-2. Irradiations in the reactor are designed to produce 40Ar*/39Ar>1.6 and 40Aratm/37Ar>0.63. This results in convenient measurements with 40Artotal/39Ar near 1. (author)

  13. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    OpenAIRE

    Alexandra Galetovic Carabantes; Nilda A.G.G. de Fernicola

    2003-01-01

    La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC), como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupac...

  14. Condições ergonômicas dos trabalhadores em galpões de frangos de corte durante a fase de aquecimento Ergonomic conditions of workers in poultry houses during the heating phase

    Directory of Open Access Journals (Sweden)

    Cinara da C. S. Carvalho

    2012-11-01

    Full Text Available A adoção das práticas de bem-estar durante o processo de criação animal tem ganhado maiores espaços devido à comprovada melhora na produção. Hoje, a condição de bem-estar pode ser estendida também para o humano que, tendo boas condições de trabalho acaba, assim, por refletir em um manejo de sucesso dos animais. Buscando atender a essa nova tendência do mercado objetivou-se, com este trabalho, avaliar as condições ergonômicas e a salubridade do ambiente de galpões de frangos de corte equipados com três diferentes sistemas de ventilação mínima (positiva, negativa e natural no que se refere à saúde do trabalhador. Com base nos efeitos dos sistemas de ventilação mínima avaliou-se carga física de trabalho, qualidade do ar, ambiente térmico, nível de ruído e iluminação, além da análise postural e biomecânica. De posse dos dados analisados verificou-se que o galpão equipado com sistema de ventilação positiva possuía um ambiente de maior salubridade para o trabalhador. Independente do sistema de ventilação utilizado, atividades como abastecimento manual do comedouro, limpeza de bebedouros e revolvimento da cama, podem oferecer riscos de lesão corporal em virtude da forma como são executados.The adoption of the practices of well-being in animal husbandry has gained increased space due to proven improvement in production. Today, the condition of well being, may be extended to the human beings, that having good working conditions may reflect in a successful management of animals. Seeking to meet this new market trend, the aim of this study was to evaluate the ergonomic conditions of the environment and health in broiler sheds, equipped with three different minimal ventilation systems (positive, negative and natural regarding workers' health. Associated with the effects of minimum ventilation systems evaluated the physical load of work, air quality, thermal environment, noise level and lighting besides postural

  15. 40Ar retention in the terrestrial planets.

    Science.gov (United States)

    Watson, E Bruce; Thomas, Jay B; Cherniak, Daniele J

    2007-09-20

    The solid Earth is widely believed to have lost its original gases through a combination of early catastrophic release and regulated output over geologic time. In principle, the abundance of 40Ar in the atmosphere represents the time-integrated loss of gases from the interior, thought to occur through partial melting in the mantle followed by melt ascent to the surface and gas exsolution. Here we present data that reveal two major difficulties with this simple magmatic degassing scenario--argon seems to be compatible in the major phases of the terrestrial planets, and argon diffusion in these phases is slow at upper-mantle conditions. These results challenge the common belief that the upper mantle is nearly degassed of 40Ar, and they call into question the suitability of 40Ar as a monitor of planetary degassing. An alternative to magmatism is needed to release argon to the atmosphere, with one possibility being hydration of oceanic lithosphere consisting of relatively argon-rich olivine and orthopyroxene. PMID:17882213

  16. Ar-O2 rf plasma diagnostics by mass spectrometry

    International Nuclear Information System (INIS)

    An investigation on the nature, energy and fluxes of the dominant species from an rf 13.56 MHz argon-oxygen plasma is realized using quadrupolar mass spectrometer (QMS). The QMS is sampling the plasma species through the anode space charge, being placed on the grounded electrode. The ion energy distributions of the most important ions in plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated. (authors)

  17. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  18. Influência do aquecimento sobre diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei (Boone, 1931) = Influence of heating under different titration methods of residual SO2 on shrimps Litopenaeus vannamei (Boone, 1931)

    OpenAIRE

    Karla Patrícia Brito de Araújo Vieira; Lílian Maria Nery de Barros Góes; Paulo de Paula Mendes; Alfredo Olivera Galvez; Emiko Shinozaki Mendes

    2008-01-01

    O metabissulfito de sódio é o conservante mais aplicado na carcinicultura, com uso amparado em legislações vigentes no país, todavia, seu resíduo, dióxido de enxofre (SO2), em concentrações altas, pode provocar reações adversas à saúde. Este estudo foidesenvolvido com a finalidade de observar a influência do aquecimento sob diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei. Os camarões foram submetidos a nove concentrações de metabissulfito de sódio e avaliados ...

  19. Evolución en el tratamiento de las úlceras por presión

    OpenAIRE

    Pérez Niño, Sofía

    2015-01-01

    Las úlceras por presión suponen un gran problema en el ámbito sanitario por eso el objetivo de este trabajo es evaluar la evidencia científica disponible sobre la evolución en el tratamiento de las úlceras por presión. Es objeto de estudio la utilización de plantas, condimentos, resinas, aceites para el tratamiento de las úlceras y; la utilización de miel y larvas estériles criadas en laboratorios para limpiar los tejidos necrosados y no dañar el tejido sano; como los numerosos avances lograd...

  20. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  1. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  2. El arte de enseñar las lenguas extranjeras

    Directory of Open Access Journals (Sweden)

    Castellani, Eladia Andrea

    2011-01-01

    Full Text Available Esta propuesta de trabajo pretende aunar criterios de trabajo dentro del Departamento de Lenguas Extranjeras basándonos en la metodología unificada que se presentará a los ingresantes para la selección de idioma Inglés o Francés en 1er año. Nuestro proyecto se encuentra dentro del marco teórico institucional que se basa en el enfoque comunicativo; los pilares que sustentan este marco teórico son la música, el arte y la literatura. Dichos ejes han sido tomados en nuestra investigación adoptando como marco teórico los principios de CLIL (Content Language Integrated Learning, acentuando el trabajo sobre estrategias de aprendizaje e incorporando las nuevas tecnologías. Enseñar las lenguas extranjeras a través de contenidos curriculares tomados de otras asignaturas implica un cambio de paradigma en la metodología de trabajo de Departamento y en la selección y elaboración de materiales. Haremos un recorrido por el proyecto, su implementación y sus resultados.

  3. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  4. Miotoxicidade por organofosforados

    Directory of Open Access Journals (Sweden)

    Cavaliere Maria J.

    1996-01-01

    Full Text Available Os organofosforados são um grupo de compostos químicos amplamente utilizados em agropecuária como inseticidas, ocasionando intoxicações acidentais em animais e humanos, e mesmo sendo utilizados em tentativas de suicídio. A toxicidade desses produtos decorre sobretudo de insuficiência cárdio-respiratória por compromentimento do sistema nervoso autônomo. Sabe-se que alguns destes compostos induzem em animais de experimentação e em humanos, uma miopatia caracterizada por degeneração de células musculares, comprometendo sobretudo a musculatura respiratória. Baseado no fato de que este comprometimento contribui para a piora da função respiratória, propõe-se um protocolo de avaliação rotineira de miotoxicidade por compostos organofosforados, através de uma bateria mínima e suficiente de colorações e reações histoquímicas para quantificação da necrose muscular. Utilizaram-se como modelo experimental, grupos de ratos albinos (Wistar intoxicados com o organofosforado paraoxon, com e sem antídotos (atropina ou pralidoxima. Verificou-se nos grupos tratados com paraoxon e paraoxon mais atropina, necrose de fibras musculares no diafragma, que atingia em determinadas áreas até 15% das fibras. No grupo tratado com paraoxon mais pralidoxima, a necrose foi mínima, evidenciando o papel mioprotetor deste último antídoto.

  5. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  6. Nucleotomia por laser

    OpenAIRE

    Cabral, oão José Lobato Guimarães Ferreira

    2009-01-01

    A hérnia de disco intervertebral com compressão nervosa que não cede ao tratamento médico, tradicionalmente, é indicação para tratamento cirúrgico. No entanto, técnicas minimamente invasivas e os procedimentos percutâneos têm sido usados e desenvolvidos nas últimas duas décadas, tanto como procedimentos alternativos, bem como possibilidades terapêuticas que antecedem o tratamento cirúrgico convencional, podendo adiar o mesmo por tempo indeterminado. De entre estas opções técnicas, surge a Nuc...

  7. Por mil devaluados pesos

    Directory of Open Access Journals (Sweden)

    Annie Rodríguez Collázos

    2013-03-01

    Full Text Available El estudio de lo popular y lo urbano hasta ahora se ha centrado en el comportamiento y en algunas relaciones de los habitantes con su entorno. “Por mil devaluados pesos. Publicidad popular y urbana”, pretende explorar las formas de publicidad, dispersas en diferentes espacios populares y urbanos en Bogotá, identificando esquemas y formas características de sus propios códigos comunicativos; se centran en un objeto de estudio consistente en las estrategias publicitarias y los códigos comunicativos en los mensajes publicitarios populares en las subculturas de San Victorino, 7 de Agosto y Sanandresito de San José.

  8. Estudo da transferência das cloraminas da água para o ar duma piscina coberta

    OpenAIRE

    Barbosa, Albino António da Silva

    2009-01-01

    Mestrado em Engenharia Química A qualidade do ar em ambientes de piscinas cobertas, bem como seus efeitos no sistema respiratório humano, tem vindo a ser estudada por diversos autores. Estes concluíram, por exemplo, que a exposição prolongada à tricloramina é causa de asma ocupacional entre funcionários de piscinas, e muito provavelmente causa de asma entre frequentadores assíduos. O cloro combinado ou as cloraminas assim como outros subprodutos da desinfecção resultam da reacção entre ...

  9. ¿Qué dicen los maestros que hacen para enseñar a leer y a escribir?

    OpenAIRE

    Tolchinsky, Liliana; Ríos García, Isabel

    2009-01-01

    El presente artículo reflexiona en torno a los resultados obtenidos de un estudio que se basa en el análisis de la práctica educativa por parte de los maestros de tercero de educación infantil y primero de primaria para enseñar a leer y escribir en diferentes comunidades autónomas. Los resultados apuntan a que los maestros se inclinan por una enseñanza explícita, precoz y sistemática de la lectura y escritura. Además, coinciden en la necesidad de trabajar sobre las habilidades básicas

  10. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  11. Escala Diagnóstica Adaptativa Operacionalizada de Autorrelato - EDAO-AR: Evidências de Validade

    Directory of Open Access Journals (Sweden)

    Elisa Medici Pizao Yoshida

    2013-04-01

    Full Text Available A Escala Diagnóstica Adaptativa Operacionalizada-Revisada (EDAO-R fornece medida da eficácia adaptativa, entendida como o grau de sucesso obtido no enfrentamento das vicissitudes da vida. Sua avaliação baseia-se em material de entrevista clínica. O estudo teve por objetivo obter evidências de validade da versão de autorrelato da EDAO-R, ou EDAO-AR. Foram desenvolvidos itens para avaliar a adequação da adaptação de dois setores da personalidade: Afetivo-Relacional (A-R e Produtividade (Pr. A amostra foi composta por 237 pacientes ambulatoriais e acompanhantes. Houve evidências de validade baseada na estrutura interna (consistência interna, análise fatorial, análise de agrupamentos e validade baseada em variáveis externas (relação entre EDAO-AR e Escala de Avaliação de Sintomas-40/EAS-40. Os resultados apontaram boa consistência interna e três dimensões para ambos os setores: foco na situação problema, foco na relação interpessoal e foco no eu. Obteve-se, conforme esperado, correlações negativas entre a EDAO-AR e EAS-40. Foram feitas sugestões para a segunda versão da escala.

  12. Seasonality of net radiation in two sub-basins of Paracatu by the use of modis sensor products Sazonalidade do saldo de radiação em duas sub-bacias do Paracatu por meio da utilização de produtos do sensor modis

    Directory of Open Access Journals (Sweden)

    Evaldo de P. Lima

    2012-12-01

    Full Text Available The net radiation (Rn represents the main source of energy for physical and chemical processes that occur in the surface-atmosphere interface, and it is used for air and soil heating, water transfer, in the form of vapor from the surface to the atmosphere, and for the metabolism of plants, especially photosynthesis. If there is no record of net radiation in certain areas, the use of information is important to help determine it. Among them we can highlight those provided by remote sensing. In this context, this work aims to estimate the net radiation, with the use of products of MODIS sensor, in the sub-basins of Entre Ribeiros creek and Preto River, located between the Brazilian states of Goiás and Minas Gerais. The SEBAL (Surface Energy Balance Algorithm for Land was used to obtain the Rn in four different days in the period of July to October, 2007. The Rn results obtained were consistent with others cited in the literature and are important because the orbital information can help determine the Rn in areas where there are not automatic weather stations to record the net radiation.O saldo de radiação (Rn representa a principal fonte de energia para os processos físico-químicos que ocorrem na interface superfície-atmosfera, sendo utilizado no aquecimento do ar e do solo, transferência da água, na forma de vapor da superfície para a atmosfera, e metabolismo das plantas, especialmente a fotossíntese. Se não houver o registro do saldo de radiação em determinadas áreas, torna-se importante a utilização de informações que ajudem a determiná-lo. Entre elas, podemos destacar as fornecidas por sensoriamento remoto. Neste contexto, este trabalho tem o objetivo de determinar o saldo de radiação, com a utilização de produtos do sensor MODIS, nas sub-bacias do Ribeirão Entre Ribeiros e Rio Preto, que ficam entre os Estados de Goiás e Minas Gerais. O SEBAL (Surface Energy Balance Algorithm for Land foi utilizado para a obten

  13. Sob os ventos da mudança climática: desafios, oportunidades e o papel da função produção no contexto do aquecimento global Straws in the wind of climate change: challenges, opportunities, and the role of production function in the context of global warming

    Directory of Open Access Journals (Sweden)

    Charbel José Chiappetta Jabbour

    2009-03-01

    Full Text Available O objetivo deste artigo é lançar luzes sobre as implicações da mudança climática para as organizações. Para fazer frente a esse debate, são explorados: o conceito de "inteligência ambiental" (IA; as estratégias por meio das quais as organizações fazem frente ao desafio da mudança climática; as oportunidades que explicam a adoção dessas estratégias; e o papel fornecido pela função produção para que tais estratégias possuam o efeito desejado. Por fim, tais conceitos são sistematizados, buscando-se uma integração dos modelos teóricos existentes, até então considerados de maneira estanque.The aim of this paper is to enlighten the implications of climate change for organizations. To deal with this subject, the follow issues are analyzed: concept of environmental intelligence; opportunities which justify the adoption of these strategies, and the main role performed by the production function to implement such strategies. Finally, concepts of prior theoretical models are taken into account.

  14. Operation of a Thick Gas Electron Multiplier (THGEM) in Ar, Xe and Ar-Xe

    International Nuclear Information System (INIS)

    We present the results of our recent studies of a Thick Gaseous Electron Multiplier (THGEM)-based detector, operated in Ar, Xe and Ar:Xe (95:5) at various gas pressures. Avalanche-multiplication properties and energy resolution were investigated with soft x-rays for different detector configurations and parameters. Gains above 104 were reached in a double-THGEM detector, at atmospheric pressure, in all gases, in almost all the tested conditions; in Ar:Xe (95:5) similar gains were reached at pressures up to 2 bar. The energy resolution dependence on the gas, pressure, hole geometry and electric fields was studied in detail, yielding in some configurations values below 20% FWHM with 5.9 keV x-rays

  15. MEIS1 functions as a potential AR negative regulator

    International Nuclear Information System (INIS)

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells

  16. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  17. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  18. 40Ar/39Ar and cosmic ray exposure ages of plagioclase-rich lithic fragments from Apollo 17 regolith, 78461

    Science.gov (United States)

    Das, J. P.; Baldwin, S. L.; Delano, J. W.

    2016-01-01

    Argon isotopic data is used to assess the potential of low-mass samples collected by sample return missions on planetary objects (e.g., Moon, Mars, asteroids), to reveal planetary surface processes. We report the first 40Ar/39Ar ages and 38Ar cosmic ray exposure (CRE) ages, determined for eleven submillimeter-sized (ranging from 0.06 to 1.2 mg) plagioclase-rich lithic fragments from Apollo 17 regolith sample 78461 collected at the base of the Sculptured Hills. Total fusion analysis was used to outgas argon from the lithic fragments. Three different approaches were used to determine 40Ar/39Ar ages and illustrate the sensitivity of age determination to the choice of trapped (40Ar/36Ar)t. 40Ar/39Ar ages range from ~4.0 to 4.4 Ga with one exception (Plag#10). Surface CRE ages, based on 38Ar, range from ~1 to 24 Ma. The relatively young CRE ages suggest recent re-working of the upper few centimeters of the regolith. The CRE ages may result from the effect of downslope movement of materials to the base of the Sculptured Hills from higher elevations. The apparent 40Ar/39Ar age for Plag#10 is >5 Ga and yielded the oldest CRE age (i.e., ~24 Ma). We interpret this data to indicate the presence of parentless 40Ar in Plag#10, originating in the lunar atmosphere and implanted in lunar regolith by solar wind. Based on a chemical mixing model, plagioclase compositions, and 40Ar/39Ar ages, we conclude that lithic fragments originated from Mg-suite of highland rocks, and none were derived from the mare region.

  19. PH-Asistido: un editor dirigido por la sintaxis para el lenguaje específico del dominio hoshimi

    OpenAIRE

    Luzza, Mariano; Berón, Mario; Peralta, Mario; Salgado, Carlos Humberto

    2012-01-01

    Enseñar programación no es una tarea simple, porque el docente debe enfrentar los problemas tradicionales del proceso de enseñanza-aprendizaje, así como también sortear los inconvenientes proporcionados por el dominio de aplicación y por el lenguaje de programación. Desde un punto de vista, es claro que si el dominio de aplicación no es atrayente, el estudiante no se sentirá motivado a resolver los problemas planteados por el docente. Por otra parte, los lenguajes de programación generalme...

  20. Portable exhausters POR-004 SKID B, POR-005 SKID C, POR-006 SKID D storage plan

    International Nuclear Information System (INIS)

    This document provides a storage plan for portable exhausters POR-004 SKID B, POR-005 SKID C, AND POR-006 SKID D. The exhausters will be stored until they are needed by the TWRS (Tank Waste Remediation Systems) Saltwell Pumping Program. The storage plan provides criteria for portable exhauster storage, periodic inspections during storage, and retrieval from storage

  1. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  2. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  3. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  4. La TV por IP en la Universidad: Un reto de divulgación científica televisiva para jóvenes chilenos

    OpenAIRE

    Torrales Aguirre, Daniel; Aguaded Gómez, José Ignacio; Ponce Guardiola, Daniel

    2013-01-01

    Diseñar nuevos modelos de televisión en el contexto de la sociedad digital se convierte en una necesidad desde el ámbito de la investigación y la academia. El presente trabajo analiza los intereses y necesidades de información expresados por jóvenes espectadores chilenos, con el objeto de diseñar una IPTV universitaria, modalidad de TV por Internet, que incorpora, mediante las múltiples interacciones que genera Internet los contenidos audiovisuales preferidos por dicho público met...

  5. Vaporization of the Ar+Ni system

    International Nuclear Information System (INIS)

    Using the 4π multidetector INDRA, collisions between 36Ar and 58Ni have been investigated over a broad bombarding energy range, from 32 to 95 AMeV. The onset for complete vaporization of the system into neutrons, H and He isotopes as well as the evolution with energy of the isotopic composition of the vaporization events were determined. Binary dissipative collisions are found to be the dominant mechanism producing the vaporization events. A statistical sequential decay of the two partners is a possible explanation for the vaporization events observed. (author) 18 refs.; 3 figs

  6. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  7. The Spectroscopic study of 33Ar

    International Nuclear Information System (INIS)

    The proton-rich nucleus 33Ar has been produced at the low-energy facility SPIRAL at GANIL. Spectroscopic studies of gamma and p emission of this nucleus were performed with the 'Silicon Cube' detection system. The analysis of proton and gamma singles and coincidence spectra allowed us to establish a complete decay scheme of this nucleus. The comparison of the Gamow-Teller strength distribution deduced from our experiment and the theoretical one obtained with the Shell Model permitted the determination of a quenching factor for the Gamow-Teller strength.

  8. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  9. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  10. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  11. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  12. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  13. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  14. Ojo por ojo

    OpenAIRE

    Ramón del Llano Ibáñez

    2011-01-01

    Nuestro pan y café de la mañana se acompaña de noticias alrededor de ejecuciones, de fosas clandestinas, de batallas del ejército, de balaceras en las calles y civiles caídos por balas perdidas : la muerte acompaña nuestro desayuno. Las calaveras de azúcar del día de muertos hoy son calaveras reales y amargas : 40 000 muertos en cuatro años después que el Presidente Calderón declaró la guerra a los narcotraficantes. Se han apresado a varios e importantes miembros de los cárteles : pero han si...

  15. A vida por segundos

    OpenAIRE

    Silva, Pedro Miguel Paiva da

    2010-01-01

    A Enfermagem regista evolução a vários níveis, o que torna imperioso reconhecer como de significativo valor o papel do enfermeiro. A Especialização em Enfermagem Médico-Cirúrgica visa o desenvolvimento de competências para a assistência de Enfermagem avançada ao doente adulto e idoso em estado crítico, revelando uma maior apropriação, por parte dos enfermeiros especialistas de uma concepção de cuidados sustentada numa conceptualização científica dos cuidados, daí infere-se o contributo num...

  16. Ojo por ojo

    Directory of Open Access Journals (Sweden)

    Ramón del Llano Ibáñez

    2011-12-01

    Full Text Available Nuestro pan y café de la mañana se acompaña de noticias alrededor de ejecuciones, de fosas clandestinas, de batallas del ejército, de balaceras en las calles y civiles caídos por balas perdidas : la muerte acompaña nuestro desayuno. Las calaveras de azúcar del día de muertos hoy son calaveras reales y amargas : 40 000 muertos en cuatro años después que el Presidente Calderón declaró la guerra a los narcotraficantes. Se han apresado a varios e importantes miembros de los cárteles : pero han si...

  17. Onicomicosis por hongos fuliginosos

    Directory of Open Access Journals (Sweden)

    Ingrid Salas-Campos

    2009-12-01

    Full Text Available Justificación y objetivo: Las infecciones de las uñas producidas por hongos son un problema de frecuente consulta dermatológica. Los dermatofitos son la mayor causa de estas infecciones, siendo Trichophyton rubrum el agente etiológico más importante. Sin embargo, los hongos no dermatofitos, tanto hialinos como fuliginosos, pueden ser también responsables de estos cuadros clínicos. Debido a que estos hongos tienden a ser resistentes a los antimicóticos comúnmente usados para tratar las onicomicosis, es que se hace indispensable que el clínico se asegure por medio de un examen de laboratorio de la etiología de la infección. Métodos: Se estudiaron tres casos de pacientes con lesiones en uñas, que acudieron al laboratorio de Micología Médica, Facultad de Microbiología, Universidad de Costa Rica. Se realizaron los análisis de rutina para aislamiento e identificación de hongos patógenos. Resultados: En los tres casos estudiados se observó al examen directo micelio fuliginoso. En uno de los casos se aisló e identificó Scytalidium dimidiatum, hongo que presenta resistencia a los antifúngicos utilizados para tratar onicomicosis. Conclusión. El reporte de hongos diferentes a los dermatofitos como agentes etiológicos de onicomicosis es importante para que el médico pueda elegir el tratamiento más recomendado para este tipo de infección.

  18. Ars Anarchica: Arte, Vida e Rebeldia

    Directory of Open Access Journals (Sweden)

    Norte Sergio Augusto Queiroz

    1998-01-01

    Full Text Available O artigo trata da experiência urbana e poesia, da contribuição anarquista para uma nova estética. Analisa alguns poemas escritos por anarquistas e a discussão e opiniões libertárias sobre arte e revolução.

  19. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  20. Contributions to the 37Ar background by research reactor operations

    International Nuclear Information System (INIS)

    Radioargon has been identified as a useful nuclide for verifying compliance with the Comprehensive Nuclear-Test-Ban Treaty. Use of 37Ar to identify a nuclear explosion requires quantification of contributions to the 37Ar background at a potential measurement site. A method of estimating 37Ar release activities using isotopes of radioxenon and radioargon has been developed in this paper. Numerical solutions to the system of equations describing air-activation in a reactor were used to determine ratios of release activities for 135Xe/133Xe, 133mXe/131mXe, and 37Ar /41Ar as function of irradiation time and off-gas residence time prior to measurement and release. Published radioactive noble gas effluent data for the High Flux Isotope Reactor, HFIR (ORNL) from the year 1996 to 2010 were compiled as a test data set to predict the 37Ar release on a yearly basis. An average 37Ar release rate of 1.86 x 1010 Bq per year was calculated. The estimated release rate was used as a source term for atmospheric transport to run a test case for 37Ar release over a typical HFIR operation cycle. Results showed that ground-level concentrations of 37Ar did not exceed the minimum detectable concentration for a 37Ar field measurement system beyond the immediate vicinity of the release point. (author)

  1. Temperatura do ar exalado, um novo biomarcador no controle da asma: um estudo piloto Exhaled breath temperature, a new biomarker in asthma control: a pilot study

    OpenAIRE

    Raul Emrich Melo; Popov, Todor A.; Dirceu Solé

    2010-01-01

    OBJETIVO: Avaliar se a temperatura do ar exalado (TAE), medida por um método não invasivo, é efetiva no monitoramento de pacientes com asma não controlada. MÉTODOS: Estudo piloto com nove pacientes (sete mulheres e dois homens; média de idade: 39 anos) com diagnóstico de asma por pelo menos um ano e sem uso de tratamento de manutenção por pelo menos três meses antes do início do estudo. Na primeira visita, os pacientes foram submetidos à espirometria e à medida da TAE. Todos os pacientes fora...

  2. PROPUESTA DE ITINERARIO DIDÁCTICO POR LA PROVINCIA DE TORRIJOS (TOLEDO) PARA ALUMNOS DE SECUNDARIA

    OpenAIRE

    Luis Alfonso Cruz Näimi

    2005-01-01

    El presente artículo tiene por finalidad analizar las ventajas educativas de los itinerarios didácticos urbanos comentando y poniendo como ejemplo una propuesta llevada a cabo con alumnos del Programa de Diversificación Curricular en Secundaria. Los itinerarios didácticos suponen una manera de enseñar más estimulante para los alumnos, a la vez que una forma más innovadora y motivadora de enseñar contenidos de Geografia urbana, ya que el alurnnado puede participar en su propio proceso de enseñ...

  3. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  4. Sociedad por Acciones Simplificada

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Arcila Salazar

    2009-07-01

    Full Text Available En Colombia, aspectos como la responsabilidad limitada; supresión de la llamada doctrina de ultra vires; duración ilimitada; eliminación de la regla, una acción, un voto; remedios al abuso de los derechos; posibilidad de eliminar prohibiciones a los administradores, libertad de establecer restricciones para la transferencia de acciones y la simplificación de los procedimientos de fusión; son inviables bajo nuestra legislación. Sin embargo, la Ley 1258 de 2008, ha incorporado al derecho societario colombiano un nuevo tipo societario híbrido, llamado “Sociedad por Acciones Simplificada”. Esta forma societaria híbrida se basa en un principio básico: garantizar amplia libertad a los empresarios en la estructuración de sus relaciones a través de disposiciones contractuales. La S.A.S. provee a los empresarios significativa flexibilidad contractual, a la vez que preserva beneficios como la limitación de la responsabilidad.

  5. Sociedad por Acciones Simplificada

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Arcila Salazar

    2009-06-01

    Full Text Available En Colombia, aspectos como la responsabilidad limitada; supresión de la llamada doctrina de ultra vires; duración ilimitada; eliminación de la regla, una acción, un voto; remedios al abuso de los derechos; posibilidad de eliminar prohibiciones a los administradores, libertad de establecer restricciones para la transferencia de acciones y la simplificación de los procedimientos de fusión; son inviables bajo nuestra legislación. Sin embargo, la Ley 1258 de 2008, ha incorporado al derecho societario colombiano un nuevo tipo societario híbrido, llamado “Sociedad por Acciones Simplificada”. Esta forma societaria híbrida se basa en un principio básico: garantizar amplia libertad a los empresarios en la estructuración de sus relaciones a través de disposiciones contractuales. La S.A.S. provee a los empresarios significativa flexibilidad contractual, a la vez que preserva beneficios como la limitación de la responsabilidad.

  6. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone. PMID:26537258

  7. Behaviour of AR glass fibre for building structural applications

    OpenAIRE

    Miravete, A.; Mieres, J. M.; Calvo, I; Comino, P.; Chiminelli, A.; Cuatrero, J.; Tolosana, N.

    2005-01-01

    The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be...

  8. Opera ar drama... Aleksejus Kartavovas Vilniuje

    OpenAIRE

    Bakutytė, Vida

    2007-01-01

    Straipsnio objektas – vienas iš reikšmingų laikotarpių Lietuvos profesionalaus teatro meno, ypač muzikinio, raidoje. Ši tema mažai tyrinėta muzikos ir teatro istorikų. Keturis sezonus (1887–1891) Vilniaus miesto teatrui vadovavęs talentingas teatro organizatorius Aleksejus Kartavovas iškėlė Vilniaus sceną į pirmaujančiųjų gretas, suaktyvino operos raidą kokybės linkme. Publikacijos tikslas – atskleisti aplinkybes, padėjusias ar trukdžiusias įgyvendinti A. Kartavovo numatytus planus, išryškint...

  9. Sensibility of different wheat varieties (strains) to Ar+ implantation

    International Nuclear Information System (INIS)

    The sensibility of different wheat varieties (strains) to Ar+ implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 1016 Ar+/cm2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar+ injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar+ implantation. (authors)

  10. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  11. Hyperdeformed band in the 36Ar nucleus?

    International Nuclear Information System (INIS)

    Complete text of publication follows. The exotic shapes of atomic nuclei has attracted much attention recently both from the experimental and from the theoretical sides. E.g. the superdeformed (SD) shape in N = Z nuclei were observed experimentally during the last decade. In particular the SD band of the 36Ar nucleus was detected in 2000 [1]. Following the experimental observation a considerable theoretical effort has been concentrated on this band. In [2] e.g. the possible binary clusterizations of this state was studied systematically. Similar studies have been done also for the ground, and the hyperdeformed band. The latter one had been predicted from alphacluster model calculations [3]. The possible binary cluster-configurations are important not only for the better understanding of the structure of the shape isomers, but also from the viewpoint of predicting the favoured reaction channels to populate these states. This is the straightforward consequence of the close relation between the clusterization and reaction channels. (In fact, a cluster-configuration is defined by the reaction channel in which it can be observed.) One of the interesting conclusions of the work [2] was, that the hyperdeformed (HD) state of the 36Ar nucleus could be populated in the 24Mg+12C and 20Ne+16O reactions. A recent analysis of the 24Mg+12C elastic scattering [4] revealed the fact that the cross section can be described only by supposing resonances on top of the potential scattering. This very careful analysis incorporated phase-shift study, as well as Regge-pole and energy-dependent resonance calculations. The existence of five resonances have been proved, which have angular momenta 2, 4, 6, 7, 8. These states together with the resonances from the 20Ne+16O reactions seem to establish a rotational band, as shown in the upper part of Fig. 1. Its moment of inertia is in a very good agreement with that of the HD shape predicted from alpha-cluster model [3]. The similarity of the

  12. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  13. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  14. Geochronological stages of magmatism of Sorsk copper-molybdenum-porphyry are district, Kuznetsk Alatau (K-Ar, Ar-Ar and Rb-Sr methods)

    International Nuclear Information System (INIS)

    Studies on biotite, amphibole and feldspar rocks were conducted through K-Ar, 39Ar-40Ar and Rb-Sr methods for evaluation of geochronological stages of magmatism development of the Sorsk copper-molybdenum-porphyry ore district. It is shown that general duration of magmatism development at the Sorsk district exceeds 100 mln years with intervals between individual magmatic pulses about 30 mln years. Dating by magmatites, related to ore-bearing porphyry complex and ore-metasotamic formations, is within the interval of 380-400 mln years. 13 refs.; 2 figs

  15. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  16. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  17. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  18. Support for the Astronomically Calibrated 40Ar/39Ar Age of Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    Fish Canyon sanidine (FCs) is the neutron fluence monitor most widely used in Cenozoic argon geochronology. Recommend published ages for FCs have been determined through various intercalibration techniques, but have varied by up to 2% over the last three decades. The robust quality of the...... astronomical timescale, with precision better than 0.1% for the last 10 million years for directly tuned sections, suggests intercalibration with K-bearing minerals intercalated in astronomically tuned stratigraphic sections as the best way to proceed with addressing the true age of FCs. Recently, Kuiper, et...... al. (2008) determined an astronomically calibrated 40Ar/39Ar age of 28.201 0.046 Ma (2), relative to the indirect astronomically tuned Moroccan Melilla Basin Messâdit section. Here, we provide independent verification for the Kuiper, et al. (2008) FCs age using sanidines extracted from the A1 tephra...

  19. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  20. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  1. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  2. 40Ar/39Ar geochronology and paleomagnetism of Independence volcano, Absaroka volcanic supergroup, Beartooth mountains, Montana

    Science.gov (United States)

    Harlan, S.S.; Snee, L.W.; Geissman, J.W.

    1996-01-01

    Independence volcano is a major volcanic complex in the lower part of the Absaroka Volcanic Supergroup (AVS) of Montana and Wyoming. Recently reported Rb-Sr mineral dates from the complex give apparent ages of 91 and 84 Ma, whereas field relationships and the physical and compositional similarity of the rocks with other dated parts of the AVS indicate an Early to Middle Eocene age for eruption and deposition. To resolve the conflict between age assignments based on stratigraphic correlations and Rb-Sr dates, we report new paleomagnetic data and 40Ar/39Ar dates for Independence volcano. Paleomagnetic data for the stock and an and andesite plug that cuts the stock are well grouped, of reverse polarity, and yield a virtual geomagnetic pole that is essentially identical to Late Cretaceous and Tertiary reference poles. The reverse polarity indicates that the magnetization of these rocks is probably younger than the Cretaceous normal superchron, or less than about 83.5 Ma. Hornblende from a volcanic breccia near the base of the volcanic pile gives a 40Ar/39Ar age of 51.57 Ma, whereas biotites from a dacite sill and a granodiorite stock that forms the core of the volcano give dates that range from 49.96 to 48.50 Ma. These dates record the age of eruption and intrusion of these rocks and clearly show that the age of Independence volcano is Early to Middle Eocene, consistent with stratigraphic relations. We suggest that the Rb-Sr mineral dates from the Independence stock and related intrusions are unreliable.

  3. Arís 2.1: Adapting Arís for Object Oriented Language

    OpenAIRE

    Rahman, Fahrurrozi

    2014-01-01

    In the software development area, software verification is important such that it can guarantee the software fulfills its requirements. Despite its importance, verifying software is difficult to achieve. Additional knowledge and effort are needed to write specification especially if the software is complex and big in size. Nevertheless, there are some software that already have verified specifications. This project will focus on extending Arís (Analogical Reasoning for reuse of Im...

  4. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  5. Quantificação das Emissões de Gases Efeito Estufa – GEEs – Segundo Matriz Energética Diesel ou GNV no Transporte Público por Ônibus em NATAL–RN

    Directory of Open Access Journals (Sweden)

    Ricardo Teixeira Gregório Andrade

    2010-01-01

    Full Text Available Dentre os contribuintes à poluição atmosférica mundial, o setor de transportes é responsável por considerável montante de emissões de gases poluentes. As emissões de gases poluentes causam uma gama de prejuízos sanitários, ambientais e, portanto, econômicos. Face à temática do aquecimento global e ao contexto do ganho de créditos de carbono via projetos tipo Mecanismo de Desenvolvimento Limpo (MDL, mostram-se favoráveis os estudos que possibilitem mitigar tais emissões e conseqüentes prejuízos. O presente estudo destina-se, primordialmente, a demonstrar a quantificação das emissões dos Gases Efeito Estufa – GEE’s expedidas pelo transporte público por ônibus da cidade de Natal-RN, no período de 2006 a 2008, tanto para a matriz energética atual, o Diesel, como para o GNV, no caso de hipotética substituição. Por conseguinte, visa a analisar a troca da matriz energética quanto à redução das externalidades e passivo ambiental gerado como conseqüência da atividade de transporte urbano, sendo o foco a temática ambiental. Os cálculos foram realizados tomando por base a metodologia explicitada pelo Painel Intergovernamental de Mudanças Climáticas – IPCC (The International Pannel for Climate Changes, na unidade de CO2eq. Os cálculos realizados indicam uma redução potencial das emissões em CO2eq de aproximadamente 49%, evidenciando que este fator deve ser considerado na avaliação mais global da viabilidade desta substituição.

  6. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    Directory of Open Access Journals (Sweden)

    Alexandra Galetovic Carabantes

    2003-12-01

    Full Text Available La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC, como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupacionales que relacionan la exposición al arsénico y cáncer de pulmón. La Organización Mundial de la Salud (OMS recomienda um valor orientador para agua de bebida de 10 mg As/L. Por su parte la Environmental Protection Agency (EPA, considerando estimativas de riesgo realizadas utilizando modelos estadísticos basados en observaciones en humanos y extrapolando los datos para concentraciones inferiores a 50 µg/L, reducirá el valor guía para arsénico en el agua de bebida de 50 µg/L para 10 µg/L. La utilización de biomarcadores permite el desarrollo de la epidemiología molecular que promete ser una herramienta que ayudará a detectar efectos tempranos en poblaciones expuestas, permitiendo la prevención de efectos nocivos considerando las características genéticas de las poblaciones.A presença de arsênio no ambiente é um problema de saúde pública por ser um evento de alta freqüência detectado em países como Argentina, Brasil, Chile, China, Índia, México e Taiwan, entre outros. O arsênio foi classificado pela Agência Internacional de Pesquisa sobre Câncer (IARC, como um agente carcinogênico para humanos com base em estudos epidemiológicos que relacionam a ingestão de arsênico na água para consumo humano e câncer na pele e estudos ocupacionais que relacionam a exposição ao arsênico e câncer no pulmão.A Organização Mundial da Saúde (OMS recomenda um valor orientador para água de beber de 10 mg As/L, enquanto que a

  7. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  8. Remoção da fração oleosa de embalagens de lubrificantes automotivos pós-consumo por drenagem gravitacional

    Directory of Open Access Journals (Sweden)

    Harley Moraes Martins

    2016-01-01

    Full Text Available RESUMO: Este trabalho aborda a questão do gerenciamento de embalagens pós-consumo de lubrificantes automotivos, considerando as dificuldades inerentes à implementação do sistema de logística reversa - prática compulsória por força de lei (Brasil, Lei 12.305/2010 - e a ineficácia dos atuais métodos utilizados para remoção da fração oleosa residual, necessária ao reprocessamento do material plástico por reciclagem mecânica direta. Para determinar metodologia apropriada para limpeza dos frascos de lubrificantes foram conduzidos experimentos para avaliar a influência do aquecimento e da posição das embalagens durante o processo de drenagem gravitacional. O procedimento analítico realizado proporcionou a escolha de uma combinação de variáveis capaz de assegurar remoção de elevado teor do resíduo oleoso com menor gasto energético. A otimização foi feita utilizando um planejamento experimental do tipo composto central com triplicata no ponto central. Os dados obtidos nos ensaios foram analisados com recursos estatísticos e demonstraram que ambos os parâmetros avaliados interferem, de forma significativa, no processo em estudo. Os resultados apontaram aumento da eficácia do processo quando a drenagem é realizada em temperaturas superiores a 35ºC e com a embalagem inclinada em ângulos próximos a 70º em relação à horizontal. Nessas condições, percentuais de remoção de óleo residual superaram 95% após 35 minutos de drenagem.

  9. Periods of constant and falling-rate for infrared drying of carrot slices Períodos de secagem constante e decrescente de fatias de cenoura por infravermelho

    Directory of Open Access Journals (Sweden)

    Fernando M. Botelho

    2011-08-01

    Full Text Available The aim of this work was to study the infrared drying process of carrot slices and to determine coefficients related to the heat and mass transfer of the process. Fresh carrots were used, dried until constant weight in a dryer with infrared heating source. Different models were utilized to fit the experimental data of constant and falling drying rate periods. It was verified that the coefficients of heat and mass transfer, during the constant drying rate, significantly increased with temperature on rise. The Diffusion Approximation, Two Terms, Midili and Verna models satisfactory represented the falling period of drying rate of carrot slices. The effective diffusion coefficient increased with temperature and this relationship can be represented by the Arrhenius equation, obtaining activation energy to the drying process of 29.092 kJ mol-1.Com este trabalho objetivou-se estudar o processo de secagem por infravermelho das fatias de cenoura e determinar alguns coeficientes referentes à transferência de calor e massa do processo. Utilizaram-se cenouras frescas, secadas até massa constante em um secador com fonte de aquecimento por infravermelho. Aos dados experimentais se ajustaram diferentes modelos para os períodos de taxa de secagem constante e decrescentes. Verificou-se que os coeficientes transferência de calor e massa, referentes ao período de secagem constante, aumentaram significativamente com o aumento da temperatura e que os modelos Aproximação da Difusão, Dois Termos, Midili e Verna representaram satisfatoriamente o período de secagem decrescente das fatias de cenoura. O coeficiente de difusão efetivo aumentou com a temperatura e esta relação pode ser representada pela Equação de Arrhenius, obtendo-se uma energia de ativação para o processo de secagem de 29,092 kJ mol-1.

  10. Proceedings of the ENCIT 2000: 8. Brazilian congress of thermal engineering; MERCOFRIO 2000: Fair and congress of air conditioned, refrigeration, heating and ventilation from MERCOSUL; Anais do ENCIT 2000: 8. Congresso brasileiro de engenharia e ciencias termicas; MERCOFRIO 2000: Feira e congresso de ar condicionado, refrigeracao, aquecimento e ventilacao do MERCOSUL

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-07-01

    Theoretical and experimental papers are presented in this proceedings covering the following subjects: petroleum, industry, fractions and distillates, gas turbines and power plants, reservoir engineering, fluids and rock, fracturing, fluids and hydraulics, oil field and wells, offshore drilling, cogeneration and electric power generation.

  11. Enseñar a ser creativo

    OpenAIRE

    López Martínez, Olivia

    2005-01-01

    El trabajo que aquí presentamos versa sobre una investigación que se está llevando a cabo en un centro de la Región de Murcia. Trata sobre "Cómo favorecer la creatividad dentro del contexto escolar". Generar ideas originales es un trabajo difícil. Sin embargo, a través de las estrategias y tácticas adecuadas, los niños pueden aprender de forma fácil y divertida a manejar sus recursos creativos para solucionar problemas que se le planteen en su vida. Por ello, nos deberíamos hacer estas ...

  12. ??Es posible ense??ar emprendimiento?

    OpenAIRE

    Guti??rrez Molina, Catalina; Jaramillo ??ngel, Alejandro

    2015-01-01

    El emprendimiento se ha convertido en una de las principales oportunidades de desarrollo econ??mico para los pa??ses subdesarrollados debido a su capacidad de innovaci??n y generaci??n de empleo; por eso, en a??os recientes gobiernos, grandes corporaciones y universidades han revisado desde diferentes visiones y programas la manera de fomentar y apoyar a los emprendedores como parte del tejido empresarial y social -- En Colombia, el Congreso expidi?? la ley 1014 de 2006 con el fin de fomentar...

  13. Determinación de arsénico en abastecimientos de agua para consumo humano de la provincia de Cartago, Costa Rica

    OpenAIRE

    Virginia Montero-Campos; Jaime Quesada-Kimsey; Aura Ledezma-Espinoza; José A Sandoval-Mora

    2010-01-01

    Objetivos: Divulgar conocimiento científico sobre el hidroarsenicismo en América Latina, y determinar la presencia de arsénico en agua utilizada para consumo humano en lugares de riesgo en Costa Rica, específicamente en la provincia de Cartago, en los cantones de Oreamuno, Central, Paraíso y Alvarado. Métodos: Cuantificación de arsénico en su forma reducida trivalente, mediante generación de hidruros metálicos volátiles por absorción atómica de llama, metodología 7062 de la Agencia de Protecc...

  14. Estudio proteómico y de resistencia a arsénico y mercurio en la bacteria Cianotrofa Pseudomonas pseudoalcaligenes CECT5344

    OpenAIRE

    Rodríguez Caballero, Gema

    2015-01-01

    La minería, la joyería y otras actividades industriales generan residuos cianurados que además contienen otros metaloides y metales como el arsénico y el mercurio. La toxicidad del cianuro reside en su elevada afinidad por metales de tal forma que es capaz de inhibir un gran número de metaloenzimas esenciales para la vida. El arsénico es un potente carcinógeno cuyas formas más abundantes en la naturaleza son el arsenito y el arseniato. La toxicidad del arsenito es debida a su capacidad de uni...

  15. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  16. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  17. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  18. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  19. Estudios de especiación de arsénico y acumulación de metales en muestras de interés medioambiental : Arsenic speciation and metal accumulation studies in environmental samples

    OpenAIRE

    Garcia Salgado, Sara

    2013-01-01

    Se ha estudiado la determinación de especies de arsénico y de contenidos totales de arsénico y metales pesados, específicamente cadmio, cromo, cobre, níquel, plomo y cinc, en muestras de interés medioambiental por su elevada capacidad acumuladora de metales, concretamente algas marinas comestibles y plantas terrestres procedentes de suelos contaminados por la actividad minera. La determinación de contenidos totales se ha llevado a cabo mediante espectrometría de emisión atómica con plasma de ...

  20. Polycyclic orogeny in Central Ogcheon metamorphic belt, Korea: evidence from 40Ar/39Ar hornblende ages

    International Nuclear Information System (INIS)

    Full text: The Ogcheon fold-thrust belt is one of the key Phanerozoic belts for delineating the regional correlation in East Asia including mainland China and Japan. This NE-trending belt consists of the Ogcheon metamorphic belt (OMB) in the southwest and the Taebaeksan sedimentary zone in the northeast. The OMB comprises Late (?) Proterozoic to Paleozoic metasedimentary and metavolcanic sequences intruded by Mesozoic granitoids. The age of initial intracontinental rifting is constrained to be earlier than 756 Ma by the U-Pb zircon age of a felsic metavolcanic rock (Lee et al., 1998, Precamb. Res. 89, 47-57). Polyphase tectonism in the OMB is characterised by the Middle Paleozoic Ogcheon orogeny responsible for the ductile stacking of thrust nappes and the Triassic Songrim orogeny occurring at shallower depths under the brittle-ductile transitional regime (Cluzel et al., 1990, Tectonophysics, 183, 41-56). Peak metamorphic conditions of the former are in the range of 5-8 kbar and 520-590 deg C, whereas those of the latter are 1-3 kbar and 350-500 deg C (Min and Cho, 1998, Lithos, 43, 31-51). Major ambiguity in the polycyclic model of the OMB results from the lack of isotopic age data. In order to determine the age of peak metamorphism, we analysed hornblende crystals of quartzose amphibole schists in central OMB, using the 40Ar/39Ar dating technique. Mineral assemblages of amphibole schists are represented by calcic amphiboles + plagioclase + epidote ± garnet + quartz + titanite + Fe-Ti oxide (magnetite or ilmenite). Amphibole separates commonly display discordant age spectra. Nevertheless, amphiboles of five analysed samples yield 40Ar/39Ar intercept dates ranging from 432±4 Ma to 499±10 Ma. Three of them yield plateau dates of 440-492 Ma, defined by more than three contiguous steps accounting for >50% of the total 39ArK released. Two of these plateau dates (465±4 Ma and 492±4 Ma) are from hornblende fractions of different grain size in a garnet

  1. 40Ar/39Ar geochronology of the El Teniente porphyry copper deposit

    International Nuclear Information System (INIS)

    breccias. Phyllic alteration primarily occurs as quartz-sericite haloes of quartz-sulfide-sulfate veinlets within the perimeter of the orebody, and slightly overprints potassic alteration. Propylitic alteration occurs largely peripheral to ore-grade rock. The relatively restricted development of phyllic alteration and the occurrence of the central breccia conflict with the classic porphyry copper model of Lowell and Gilbert (1970), but El Teniente may be regarded as a 'variation on a theme' of the classic model, as suggested by Gustafson and Hunt (1975). The exceedingly large size of the El Teniente deposit, coupled with its apparently young mineralization age prompted us to initiate a systematic 40Ar/39Ar study whose goals are to determine the age(s) of the hydrothermal event(s) that produced such a remarkable copper concentration and ultimately to estimate the duration of the hydrothermal activity at El Teniente. This is particularly relevant to an understanding of the processes that formed super-giant high-grade copper deposits in the Chilean Andes and elsewhere. We report here 32 total fusion 40Ar/39Ar ages from sericite and biotite from different lithologic units of El Teniente and five step-heating 40Ar-39Ar ages of samples previously dated using conventional K-Ar methods (Cuadra, 1986) (au)

  2. Arsénico en aguas naturales del sudeste de la provincia de Córdoba, Argentina.

    Directory of Open Access Journals (Sweden)

    Alejo Leopoldo Perez Carrera

    2013-10-01

    Full Text Available En Argentina, existen grandes regiones que por sus características edafoclimáticas, poseen excelentes aptitudes agropecuarias, sin embargo, sufren limitaciones de desarrollo debido a la disponibilidad de agua y la calidad del recurso hídrico disponible. Uno de los elementos químicos presentes en el agua, con mayor impacto sobre la salud humana y animal, es el arsénico. La región afectada, abarca las provincias de Córdoba, La Pampa, Santiago del Estero, San Luis, Santa Fe, Buenos Aires, Chaco, Salta, Tucumán, San Juan y Mendoza. El objetivo de este trabajo es analizar la presencia y distribución del arsénico en agua superficial y subterránea en el sudeste de la provincia de Córdoba, una de las zonas más afectadas de Argentina por la presencia de arsénico en el agua.

  3. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  4. Eruption age of an approximately 100,000-year-old basalt from Ar-40/Ar-39 analysis of partially degassed xenoliths

    Science.gov (United States)

    Gillespie, A. R.; Huneke, J. C.; Wasserburg, G. J.

    1984-01-01

    Eleven samples from five partially degassed Mesozoic granitic xenoliths and two late Pleistocene host basalt samples from Sawmill Canyon in Sierra Nevada, California, have been analyzed using stepwise Ar-40/Ar-39 dating techniques. The petrography and analytic techniques are described and the results are presented. Isotopic compositions of Ar released from the xenoliths in several extraction steps at temperatures below about 900 C were colinear in Ar-36/Ar-40 versus Ar-39/Ar-40 diagrams and defined isochrons, giving a mean age of degassing of 119,000 + or - 7000 yr. Ar-40 extracted at higher temperatures included ancient radiogenic Ar-40 that never diffused from the xenoliths during immersion in the magma. This Ar-40 caused an increase in the apparent age for the high-temperature extractions. The high precision of the eruption age determined by this method is comparable to that obtained elsewhere by conventional K/Ar dating of sanidine.

  5. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  6. Optimización y validación metodológica de la cuantificación de arsénico por inyección en flujo-generación de hidruros- espectrometría de absorción atómicas (IF-GH-EAA previa derivatizacíon con L-Cisteína Optimización and validation method for arsenic quantification by flow injection-hydride generation - atomic absorption spectrometry (fi-hg-aas after L-Cysteine derivatization

    Directory of Open Access Journals (Sweden)

    Julio A Navoni

    2009-12-01

    Full Text Available El arsénico (As es un contaminante natural que afecta una amplia zona de Argentina. El nivel de As en agua de consumo es utilizado para evaluar la fuente de exposición y en orina para evaluar exposición a este tóxico. El presente trabajo tuvo como objetivo la optimización y validación metodológica de una técnica para la cuantificación de As [As suma = As inorgánico (AsI + especies metiladas: ácido monometilarsónico (MMA y ácido dimetilarsínico (DMA], producto del metabolismo del AsI, por inyección en flujo- generación de hidruros- espectrometría de absorción atómica (IF-GH-EAA, previa derivatización con L-cisteína. La recuperación de las especies estudiadas: AsI (AsIII y AsV, MMA y DMA fue cercana al 100% en todos los casos. Los límites de detección y cuantificación encontrados fueron para agua y orina: 2 y 3 μg/L; 5 y 8 μg/L respectivamente y el rango dinámico de trabajo establecido fue desde 5 a 75 μg/L, permitiendo cuantificar As en muestras de agua cercanos a los estándares internacionales vigentes para valores máximos de As en agua de consumo y en orina en niveles comparables con los establecidos en población laboralmente no expuesta. Esta propuesta metodológica es una alternativa para evaluar la exposición al As en muestras de agua y orina, sin necesidad de utilizar prolongados pre-tratamientos de muestra, de forma más rápida y económica.Arsenic (As is a natural contaminant that affects a large area of Argentina. Quantification of As in drinking water has been used to evaluate the source of exposure and As in urine to assess exposure to this toxic. This study aimed to optimize and validate a methodological technique for the quantification of As [As sum = inorganic As (AsI + methylated species: monometilarsonic acid (MMA and dimetilarsinic acid (DMA], product of AsI metabolism by flow injectionhydride generation-atomic absorption spectrometry (FI-GH-AAS, after derivatization with L-cysteine. The recovery

  7. Aspectos Tectônicos das Intrusões dos Granitos do Cerne, Passa Três e Rio Abaixo, Sudeste do Pré-cambriano Paranaense. Estudo Baseado em Datações 39Ar-40Ar em Micas

    Directory of Open Access Journals (Sweden)

    Leonardo Fadel Cury

    2008-04-01

    Full Text Available Os stocks graníticos do Cerne, Passa Três e Rio Abaixo são representados por corpos elípticos, alongados segundo NE-SW(granitos do Cerne e Passa Três e com formas “ovóides” (Granito Rio Abaixo, intrusivos nas seqüências metavulcanossedimentaresda porção sudeste do Cinturão Ribeira, no Estado do Paraná. Esses corpos são representados principalmente por biotitasienogranitos,monzogranitos e quartzo-sienitos porfiríticos, com megacristais de microclínio, isótropos ou com foliação de fluxomagmático, podendo apresentar termos deformados em regiões restritas às zonas de contato. Mostram afinidades petrológicas,geoquímicas e geocronológicas, com características semelhantes aos granitos tipo-A, porém, enriquecidos em Ba, Sr e Zr. Análises40Ar-39Ar em biotitas do Granito do Cerne indicaram idade integrada de 557 ± 2 Ma, valor este relativamente próximo à idade decristalizaç��o dos zircões de aproximadamente 563 Ma, definida por Cury (2003. Determinações 40Ar-39Ar obtidas em rochasencaixantes (muscovitas xistos das vizinhanças do Granito do Cerne apresentam idades mais antigas (800-1200 Ma, o quepermite concluir que a intrusão do granito, bem como o evento metamórfico regional ocorrido durante o Ciclo Brasiliano, nãoatingiram temperaturas suficientes para apagar o registro isotópico das muscovitas (T < 300oC. Os stocks graníticos do Cerne,Passa Três e Rio Abaixo representam magmatismo tardi-orogênico no contexto das deformações presentes no Domínio Apiaí eao arco-magmático Três Córregos-Cunhaporanga (630-590 Ma, relacionado aos estágios finais de transpressão, onde suacolocação é intimamente associada às zonas de cisalhamento transcorrente e desenvolvimento das grandes antiformas e sinformas.Tal período (Proterozóico Superior/Cambriano representa um importante marco na região, associado aos ajustes finais relacionadosà aglutinação do Supercontinente Gondwana.

  8. Synthesis, structural characterization, and spectroscopy of the cadmium-cadmium bonded molecular species Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2).

    Science.gov (United States)

    Zhu, Zhongliang; Fischer, Roland C; Fettinger, James C; Rivard, Eric; Brynda, Marcin; Power, Philip P

    2006-11-29

    The synthesis and first structural characterization of a cadmium-cadmium bonded molecular compound Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2) are reported. The existence of the Cd-Cd bond was established by 113Cd NMR spectroscopy and X-ray diffraction (Cd-Cd = 2.6257(5) A). Like its group 12 analogue Ar'ZnZnAr', DFT calculations showed that Ar'CdCdAr' had significant p-character in the Cd-Cd sigma-bonding HOMO. PMID:17117840

  9. Proton resonance spectroscopy in 36Ar

    International Nuclear Information System (INIS)

    Excitation functions for proton elastic scattering and for proton-induced reactions on 35Cl were measured with the KN Van de Graaff accelerator and associated high resolution system at TUNL. Differential cross sections for 35Cl(p,p0), (p,p1), (p,p2), (p, α0), and (p, α1) were measured in the range Ep = 0.6 to 4.0 MeV. The data were measured at five angles with an overall resolution of about 350 eV. The measured excitation functions were analyzed with a multi-level, multi-channel R-matrix formalism for approximately 200 levels. Resonance parameters were extracted. The resonance parameters included resonance energy, total angular momentum, parity, partial elastic and reaction widths, channel spin or orbital angular momentum mixing ratios, and for some resonances the relative signs of width amplitudes. A number of resonances have strong level-level interference effects. Comparison of these data with the Porter-Thomas distribution resulted in good agreement of almost all channels which had a statistically significant number of resonances. These comparisons indicate that nearly all the proton and alpha strength in 36Ar for this energy range was seen in the present study. The s-wave proton strength function ratio for s = 1 and s = 2 resonances was found to be consistent with previous measurements for 4N nuclei

  10. Sistema de e-terapia inteligente. Un nuevo paradigma de psicoterapia asistida por ordenador

    OpenAIRE

    ZARAGOZÁ ÁLVAREZ, IRENE

    2012-01-01

    La psicoterapia asistida por ordenador (PAO) se define como cualquier sistema informático que ayude a los profesionales de la salud mental a diseñar y/ o aplicar tratamientos. No siempre que la psicoterapia y los ordenadores se encuentran puede hablarse de psicoterapia asistida por ordenador, para ello es necesario que el sistema informático tome alguna decisión en función de la información que le proporcione el paciente. Esta definición excluye los sistemas de videoconferencia, teléfono o...

  11. Paleomagnetic and 40Ar/39Ar geochronologic data from late Proterozoic mafic dikes and sills, Montana and Wyoming

    Science.gov (United States)

    Harlan, Stephen S.; Geissman, John William; Snee, Lawrence W.

    1997-01-01

    Paleomagnetic and 40Ar/39Ar results from mafic dikes and sills in northwestern Wyoming and western Montana yield similar virtual geomagnetic poles and isotopic dates. In combination with paleomagnetic and geochronologic data from elsewhere in the western Cordillera, these data provide evidence for a regional mafic magnetic event at 780 to 770 Ma that affected a large area of western North America.

  12. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  13. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  14. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  15. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  16. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  17. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  18. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  19. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  20. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  1. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  2. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  3. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  4. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  5. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  6. Toward a high-resolution 40Ar/39Ar geochronology of the Tatun Volcano Group, Taiwan

    Science.gov (United States)

    Mesko, G. T.; Song, S.; Chang, S.; Hemming, S. R.; Turrin, B. D.

    2010-12-01

    The Tatun Volcano Group [TVG] consists of five volcanic subgroups of which ~30 edifices have been identified, all in close proximity to the densely populated Taipei Basin to its south (Song et al., 2000, Journal of the Geological Society of China, in Chinese). Evidence of eruptions is in the form of mostly lava flows, with pyroclastic flows, and ash deposition (Tsai et al., 2010, TAO), consistent with vulcanian and plinian eruptions that are only minimally preserved because of the region’s high weathering rate (Belousov et al., 2010, Journal of Volcanology and Geothermal Research). The TVG is made up of calc-alkaline andesite, with few interspersed basaltic lava flows that bear geochemical signatures consistent with subduction volcanism, yet due to tectonic location Teng (1996, Geology) describes it as Ryukyu back-arc basin volcanism, and still others attribute volcanism here to post-collisional collapse of the Taiwan orogen (Wang et al., 1999, Tectonophysics and 2004, Journal of Petrology). Various TVG samples were previously K-Ar dated by Juang and Chen (1989, Bulletin of Central Geological Survey, in Chinese), Tsao (1994, Bulletin of Central Geological Survey, in Chinese), and 40Ar/39Ar whole rock analyses by Lee (1996, masters thesis, National Taiwan University) to suggest volcanism from 2.8-2.5Ma and then from 1.5-.22Ma after which volcanic events ceased. In contrast, radiocarbon dates obtained from charcoal in related sediment by Chen et al. (2010, TAO) and Belousov et al. (2010, Journal of Volcanology Geothermal Research) suggest volcanic activity was present at 20ka and 6ka respectively. The andesite samples are microcrystalline; therefore hand picked aliquots of groundmass from the hand magnetic fraction were subjected to several iterations of sonic rinse in glycine-based soap, then 4N HNO3, then quartz-distilled water in a preparation modified from Nicolaysen et al. (2000, EPSL). Samples were co-irradiated at the USGS facility in Denver using Alder

  7. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Science.gov (United States)

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  8. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Science.gov (United States)

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  9. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    International Nuclear Information System (INIS)

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  10. High-precision 40Ar/39Ar age for the Jehol Biota

    Science.gov (United States)

    Chang, S.; Zhang, H.; Renne, P. R.; Fang, Y.

    2008-12-01

    Abundant fossils of the terrestrial Jehol Biota, including plants, insects, dinosaurs, birds, mammals and freshwater invertebrates, were discovered from the Yixian Formation and the overlying Jiufotang Formation in Inner Mongolia, Hebei Province and Liaoning Province, northeastern China. Because of the exceptional preservation of fossils, the Jehol Biota is one of the most important Mesozoic fossil outcrops and referred to as a "Mesozoic Pompeii". The Jehol Biota has provided a rare opportunity to address questions about the origin of birds, the evolution of feathers and flight, the early diversification of angiosperms and the timing of the radiation of placental mammals. The Tuchengzi Formation, which lies unconformably just below the Yixian Formation and consists mainly of variegated sandstones, is less fossiliferous than the two overlying formations. However, dinosaur tracks, silicified wood and compressed plants are found in this formation. A systematic 40Ar/39Ar dating of the Yixian and the Jiufotang formations was undertaken to provide a framework for understanding the timing and duration of the Jehol Biota and evolutionary events represented within it. Furthermore, determining the absolute age of the Tuchengzi Formation provides information to interpret abundant dinosaur tracks within and provide better age constrains for the beginning of the Jehol Biota. Here we present robust high-precision 40Ar/39Ar data for six tuff samples and two basalt samples collected from the Tuchengzi, the Yixian and the Jiufotang formations near the classic outcrops in western Liaoning, NE China. We obtain an age of 139.5 ± 1.0 Ma for the uppermost Tuchengzi Formation, an age of 129.7 ± 0.5 Ma for a basaltic lava from the bottom of the Yixian Formation and an age of 122.1 ± 0.3 Ma for a tuff from the base of the overlying Jiufotang Formation. Our data indicate that the Yixian Formation was deposited during the Early Cretaceous, the Barremian to early Aptian, within a time span

  11. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Science.gov (United States)

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  12. Expression of ER and AR in lung cancer

    Directory of Open Access Journals (Sweden)

    Shuling WANG

    2008-02-01

    Full Text Available Background and objective Epidemiology of lung cancer differs between sexes and it might be partially explained by different sex hormone levels in women and men. There are some epidemiological data indicating that gender is a significant, independent prognostic factor in lung cancer. The aim of this study is to determine expression of ER (estrogen receptor and AR (androgen receptor in lung cancer, and evaluate the relationship between their expression and clinical or pathologic characteristics. Methods Immunohistochemistry assay was used to detect expression of ER and AR. Results Positive expression of ER and AR were 14.3%(15/105 and 20%(21/105. Positive expression of ER had no relationship with age, gender, pathology, histological differentiation, TNM staging, size of tumor and lymph node metastasis. Although age, gender, pathology, histological differentiation and size of tumor had no effect on the expression of AR, positive rate of AR in staging III lung cancer was significantly higher than that in staging I lung cancer. The different AR expression was significant between N0 and N2 lymph node metastasis ( Chisquare= 4.7828,P=0.0287. Conclusion The expression of ER has no relationship with biological behavior. Positive expression of AR may be correlated with the progression and the lymph node metastasis of lung cancer.

  13. Molecular modeling of the effects of 40Ar recoil in illite particles on their K-Ar isotope dating

    Science.gov (United States)

    Szczerba, Marek; Derkowski, Arkadiusz; Kalinichev, Andrey G.; Środoń, Jan

    2015-06-01

    The radioactive decay of 40K to 40Ar is the basis of isotope age determination of micaceous clay minerals formed during diagenesis. The difference in K-Ar ages between fine and coarse grained illite particles has been interpreted using detrital-authigenic components system, its crystallization history or post-crystallization diffusion. Yet another mechanism should also be considered: natural 40Ar recoil. Whether this recoil mechanism can result in a significant enough loss of 40Ar to provide observable decrease of K-Ar age of the finest illite crystallites at diagenetic temperatures - is the primary objective of this study which is based on molecular dynamics (MD) computer simulations. All the simulations were performed for the same kinetic energy (initial velocity) of the 40Ar atom, but for varying recoil angles that cover the entire range of their possible values. The results show that 40Ar recoil can lead to various deformations of the illite structure, often accompanied by the displacement of OH groups or breaking of the Si-O bonds. Depending on the recoil angle, there are four possible final positions of the 40Ar atom with respect to the 2:1 layer at the end of the simulation: it can remain in the interlayer space or end up in the closest tetrahedral, octahedral or the opposite tetrahedral sheet. No simulation angles were found for which the 40Ar atom after recoil passes completely through the 2:1 layer. The energy barrier for 40Ar passing through the hexagonal cavity from the tetrahedral sheet into the interlayer was calculated to be 17 kcal/mol. This reaction is strongly exothermic, therefore there is almost no possibility for 40Ar to remain in the tetrahedral sheet of the 2:1 layer over geological time periods. It will either leave the crystal, if close enough to the edge, or return to the interlayer space. On the other hand, if 40Ar ends up in the octahedral sheet after recoil, a substantially higher energy barrier of 55 kcal/mol prevents it from leaving

  14. Metodologia de Dimensionamento de Sistemas de Aquecimento em Piso, em Função da Temperatura e Espessura de Cama, para Criação de Frangos de Corte Heating Floor Systems on Poutry Breeding: Dimension Methodology Evaluating Litter Thickness and Temperature

    Directory of Open Access Journals (Sweden)

    PG Abreu

    2000-04-01

    Full Text Available Avaliou-se a temperatura e a espessura de cama ideal para os sistemas de aquecimento elétrico (fibra de vidro e argamassa armada, em relação a temperatura ambiental, a partir de testes realizados em galpão para aves, na EMBRAPA-CNPSA. Os valores de temperatura em cada ponto determinado foram coletados de 5 em 5 minutos. O sistema permaneceu em funcionamento até a superfície superior de cama sobre a placa atingir o valor de 35ºC. O sistema mais adequado foi aquele em que a espessura da argamassa e a espessura da fibra de vidro foram 0,06m e 0,08m, respectivamente, com uma espessura de cama total, fora do círculo, de 0,11m.The present study was conducted to evaluate the suitable temperature and thickness of the poultry litter related to the electric heating systems (glass fiber and armed mortar and regarding the ambient temperature variations. Temperature values were obtained in specific places of the litter each 5 minutes. The system keeps working up to 35ºC at the top layer of litter. The suitable system was the one in which the armed mortar and glass fiber thickness were respectively, 0,06 and 0,08 m. In this system, the total thickness outside the brooding area could be maintained at 0,11 m.

  15. Consecuencias ecológicas del enriquecimiento por materia orgánica procedente de la acuicultura y de vertidos de petróleo en ecosistemas costeros

    OpenAIRE

    Sanz Lázaro, Carlos

    2009-01-01

    El objetivo de esta tesis es estudiar el efecto del enriquecimiento por materia orgánica producida por el cultivo de peces en el mar y por los vertidos de petróleo en el medio marino. Este trabajo intenta explicar las consecuencias ecológicas de los impactos generados por este tipo de contaminación, y en diseñar de test de toxicidad para evaluar la contaminación en el sur de las costas europeas. Específicamente, en relación con el impacto de la acuicultura, los estudios de recuperación durant...

  16. Qualidade do ar interior em instalações desportivas

    OpenAIRE

    Marques, Liliana Rute Dias

    2013-01-01

    A Qualidade do Ar Interior (QAI) tem vindo a despertar cada vez mais o interesse da comunidade científica, pelo facto das sociedades modernas passarem a grande maioria do seu dia em ambientes interiores, sendo o ar que respiramos um fator determinante na saúde e bem-estar do ser humano. Os indivíduos que praticam desporto estão em particular risco de inalar poluentes, não só porque durante a atividade desportiva estão sujeitos a maiores taxas de consumo de ar mas também ao f...

  17. A Survey on Web-based AR Applications

    CERN Document Server

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  18. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    OpenAIRE

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  19. El principio general de reductio ad aequitatem por desequilibrio contractual

    Directory of Open Access Journals (Sweden)

    José Félix Chamie

    2012-06-01

    Full Text Available Para atender las exigencias del mundo actual se requiere de la proposición de categorías dogmáticas que contribuyan en el desarrollo del sistema jurídico unificando conceptos, simplificando caminos interpretativos, y sobre la base de la propia tradición rediseñar instrumentos para mejorar el derecho poniéndolo a tono con las exigencias de su tiempo. De allí la intención del autor de aventurarse en una reconstrucción histórico-dogmática de figuras bien conocidas por la tradición del sistema jurídico romano-germánico, en aras de identificar un principio de moderación en los contratos. Un principio de equilibrio que desde los tiempos de la Escuela medieval se contiene en la expresión reductio ad aequitatem y se realiza mediante instrumentos que procuran corregir y adaptar el contrato según el caso. Así, el autor se fija en los momentos de la celebración y de la ejecución del contrato para observar la ratio de los institutos que en esos momentos del iter contractual sirven la causa de la equidad para ajustar la sinalagmaticidad de la relación, contrastar abusos y desequilibrios causados por las partes o por eventos extraños al riesgo del contrato.

  20. Mass Spectrometric and Langmuir Probe Measurements in Inductively Coupled Plasmas in Ar, CHF3/Ar and CHF3/Ar/O2 Mixtures

    Science.gov (United States)

    Kim, J. S.; Rao, M. V. V. S.; Cappelli, M. A.; Sharma, S. P.; Meyyappan, M.; Arnold, Jim (Technical Monitor)

    2000-01-01

    Absolute fluxes and energy distributions of ions in inductively coupled plasmas of Ar, CHF3/Ar, and CHF3/Ar/O2 have been measured. These plasmas were generated in a Gaseous Electronics Conference (GEC) cell modified for inductive coupling at pressures 10-50 mTorr and 100-300 W of 13.56 MHz radio frequency (RF) power in various feedgas mixtures. In pure Ar plasmas, the Ar(+) flux increases linearly with pressure as well as RF-power. Total ion flux in CHF3 mixtures decreases with increase in pressure and also CHF3 concentration. Relative ion fluxes observed in the present studies are analyzed with the help of available cross sections for electron impact ionization and charge-exchange ion-molecule reactions. Measurements of plasma potential, electron and ion number densities, electron energy distribution function, and mean electron energy have also been made in the center of the plasma with a RF compensated Langmuir probe. Plasma potential values are compared with the mean ion energies determined from the measured ion energy distributions and are consistent. Electron temperature, plasma potential, and mean ion energy vary inversely with pressure, but increase with CHF3 content in the mixture.

  1. 40Ar-39Ar dating of Luna 16 and Luna 20 samples

    International Nuclear Information System (INIS)

    Two fragments of Luna 16 mare basalt and two Luna 20 samples (one metaclastic fragment and a group of five anorthositic particles) from the Royal Society allocation have been dated by using the 40Ar-39Ar technique. The Luna 16 ages confirm that mare lavas were extruded in Mare Fecunditatis 3.4 to 3.5 Ga ago. Similarly, the age of the Luna 20 metaclastic fragment provides further support for a 3.9 Ga age for the Crisium basin and for the widespread cataclysmic bombardment of the moon between 4.05 and 3.85 Ga. The presence of at least two isotopically distinct, non-radiogenic argon components in the Luna 20 anorthositic sample comprises an unequivocal age assignment but the simplest model leads to a plateau age of 4.40 +- 0.10 Ga and a minimum age of 4.30 +- 0.10 Ga. There are now several lunar highland samples which are significantly older than 4.0 Ga and which give rise to a secondary age grouping in the interval 4.2 to 4.3 Ga. Depending on whether highland ages were primarily reset during the excavation of a large number of medium-sized craters or a small number of large basins, this secondary grouping implies either a significant peak in the cratering rate at 4.0 Ga or statistical fluctuations in a monotonically decreasing cratering rate. (author)

  2. Análise da contribuição ambiental por meio da alteração da matriz energética do setor brasileiro de ferro-gusa e aço

    Directory of Open Access Journals (Sweden)

    Flávia de Castro Camioto

    2014-12-01

    Full Text Available O objetivo deste artigo é analisar a possibilidade de contribuição ambiental por meio da alteração da matriz energética do setor industrial de ferro-gusa e aço. Para a medição das emissões de CO2 dos combustíveis utilizados, nesse setor, foi usado o método top-down, proposto pelo IPCC. Além disso, a partir dos dados de consumo energético, foi realizada a quantificação das emissões de CO2 supondo a mudança da matriz energética desse setor para efeito de comparação das emissões. Os resultados deste estudo indicam que o coque de carvão mineral é responsável por 44,5% do total de dióxido de carbono emitido por esse setor. Da mesma forma, se fosse possível utilizar somente um combustível na indústria de ferro-gusa e aço, para suprir sua demanda energética, as emissões de CO2 seriam menores para os combustíveis gasosos, líquidos e o alcatrão e outras fontes secundárias do petróleo. Apesar de o estudo ter indicado que o carvão vegetal é o segundo maior emissor de CO2 do setor, o mesmo pode contribuir para a redução do aquecimento global, desde que este energético seja proveniente de matas de reflorestamento destinadas para a atividade industrial.

  3. Acumulación en tejidos vegetales de arsénico proveniente de aguas y suelos de Zimapán, Estado de Hidalgo, México

    OpenAIRE

    Francisco Prieto-García¹; Judith Callejas H.; María de los Ángeles Lechuga; Juan C. Gaytán; Enrique Barrado E.

    2005-01-01

    Se estudió el nivel de acumulación de arsénico en tejidos vegetales de la región de Zimapán, estado de Hidalgo, México, ya que debido a su ubicación geográfica y características geomorfológicas, los suelos (y aguas) presentan altos contenidos de arsénico natural. La determinación de los niveles de arsénico se realizó por absorción atómica mediante generador de hidruros. Se analizaron muestras de diversas especies vegetales incluyendo, hortalizas, frutales, especias y plantas medicinales. Los ...

  4. Geology and 40Ar/39Ar Geochronology of Akutan Volcano, Eastern Aleutian Islands

    Science.gov (United States)

    Coombs, M. L.; Jicha, B. R.

    2013-12-01

    40Ar/39Ar dating and new whole-rock geochemical analyses are used to establish an eruptive chronology for Akutan volcano, Akutan Island, in the eastern Aleutian island arc. Akutan Island (166° W, 54.1° N) is the site of long-lived volcanism and the entire island comprises volcanic rocks as old as 3.3 Ma (Richter et al., 1998, USGS Open-File 98-135). Our current focus is on the 225 km2 western half of the island, which is home to the Holocene active cone, Holocene to latest Pleistocene satellite vents, and underlying middle Pleistocene volcanic basement rocks. Eruptive products span the tholeiitic-calc-alkaline boundary, are medium-K, and range from basalt to dacite. Furnace incremental heating experiments on groundmass separates of 38 samples resulted in 29 40Ar/39Ar ages. The remainder did not yield radiogenic 40Ar contents and are likely Holocene in age. The oldest ages (1251×10 and 1385×12 ka) are from a wedge of flat-lying dissected lavas north of the Holocene cone; these likely represent the upper part of the volcanic basement that underlies the entire island. Above a major unconformity lie basaltic andesite to dacite lavas that range from 765× 4 to 522×8 ka. The eroded remnants of the source volcano for these flows appears to crop out as a series of variably hydrothermally altered breccias and domes 5 km east-northeast of the current summit. A 625 m-tall eroded basaltic center, Lava Peak, sits 6 km northwest of the summit; its deeply incised western flank exposes lava flows and a plug. Two flows are dated at 598×16 and 602×15 ka. A high ridge 1.5 km south of the summit is made of oxidized, mostly andesitic lavas 284-249 ka old; these are presumably the remnants of an eruptive center located near the current cone. Flat Top Peak, 3.5 km southwest of the summit, produced almost exclusively basalts and six dated lavas range from 155×8 to 98×18 ka. Lavas from Flat Top (1065 m asl) are deeply eroded suggesting extensive ice cover during marine isotope

  5. Dicty_cDB: FC-AR08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR08 (Link to dictyBase) - - - Contig-U15118-1 FC-AR08Z (Li...nk to Original site) - - FC-AR08Z 542 - - - - Show FC-AR08 Library FC (Link to library) Clone ID FC-AR08 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR08Q.Seq.d/ Representative seq. ID FC-AR...08Z (Link to Original site) Representative DNA sequence >FC-AR08 (FC-AR08Q) /CSM/FC/FC-AR/FC-AR08Q.Seq....esfilgfmgyr tscrynrwssqlpirycs*knddasrsc*yslfkhlgllgkdchp*rsncllqrcfikch qrfrwcfs

  6. Dicty_cDB: FC-AR06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR06 (Link to dictyBase) - - - - FC-AR06Z (Link to Original site) - - FC-AR...06Z 316 - - - - Show FC-AR06 Library FC (Link to library) Clone ID FC-AR06 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...06Q.Seq.d/ Representative seq. ID FC-AR06Z (Link to Original s...ite) Representative DNA sequence >FC-AR06 (FC-AR06Q) /CSM/FC/FC-AR/FC-AR06Q.Seq.d/ XXXXXXXXXXTGATCCAAGAAAAGG

  7. Dicty_cDB: FC-AR18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR18 (Link to dictyBase) - G03231 DDB0229952 Contig-U16528-1 FC-AR...18E (Link to Original site) - - - - - - FC-AR18E 567 Show FC-AR18 Library FC (Link to library) Clone ID FC-AR...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR18Q.Se...q.d/ Representative seq. ID FC-AR18E (Link to Original site) Representative DNA sequence >FC-AR18 (FC-AR18Q) /CSM/FC/FC-AR/FC-AR...QNRALVAGPHSGVERHIINFKWIN LTPLKVNIQRGARINTLIAAIKAADLETKIAALSAVKKINARATKSNQTDFERFKANLIR RKLNKKVSGEVKKLVNIANRAA

  8. Dicty_cDB: FC-AR14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR14 (Link to dictyBase) - - - Contig-U16311-1 FC-AR14Z (Li...nk to Original site) - - FC-AR14Z 593 - - - - Show FC-AR14 Library FC (Link to library) Clone ID FC-AR14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR14Q.Seq.d/ Representative seq. ID FC-AR...14Z (Link to Original site) Representative DNA sequence >FC-AR14 (FC-AR14Q) /CSM/FC/FC-AR/FC-AR14Q.Seq....epsin, complete cds. 72 8e-09 1 BP130435 |BP130435.1 Nicotiana tabacum cDNA, clone: BY2401, primer: M13 forwar

  9. Dicty_cDB: FC-AR09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR09 (Link to dictyBase) - - - Contig-U15312-1 FC-AR09E (Li...nk to Original site) - - - - - - FC-AR09E 702 Show FC-AR09 Library FC (Link to library) Clone ID FC-AR09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR09Q.Seq.d/ Representative seq. ID FC-AR...09E (Link to Original site) Representative DNA sequence >FC-AR09 (FC-AR09Q) /CSM/FC/FC-AR/FC-AR09Q.Seq....elfikr*kerqvc*nrldsleg*r*srrk *rcw*ir*l*ygwhgyatndarygwygrygwygrygwygrygrhgryarwy

  10. Applications of 37Ar, 39Ar and 85Kr in hydrology, oceanography and atmospheric studies. Current state of the art

    International Nuclear Information System (INIS)

    Knowledge of the atmospheric concentrations of 37Ar, 39Ar and 85Kr is required to apply these isotopes in hydrology and oceanography; these concentrations are reported on in the paper. It is demonstrated in a general way, and for specific examples, how 39Ar and 85Kr results can be used for groundwater dating. The combination of these isotope results with 3H and 14C data is discussed. Subsurface production of 39Ar may limit its application in dating, but could yield information about underground processes, particularly if the results are combined with other isotope data such as 37Ar and 222Rn. Argon-39 is applied in oceanography as a steady state tracer and allows valuable conclusions to be reached on the formation and ventilation rates of deep ocean water. Examples from the deep North Atlantic and for a depth profile in the Pacific illustrate how conclusions on the mixing, ageing and flow rates can be drawn from 39Ar results. The origin of measured 37Ar activity values in tropospheric air is described, and selected time series are used to discuss atmospheric circulation processes. (author). 12 refs, 6 figs, 2 tabs

  11. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Science.gov (United States)

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  12. 40Ar/39Ar dating and geochemistry of tholeiitic magmatism related to the early opening of the Central Atlantic rift

    International Nuclear Information System (INIS)

    Tholeiitic effusive and intrusive magnetism from Iberia, Morocco, Algeria and Mali, realted to the early opening of the Central Atlantic rift, was dated by the 40Ar/39Ar step-heating method. Four plateau ags, rangin from 203.7±2.7 to 197.1±1.8 Ma, were obtained on plagioclase from dykes from theTaoudenni area (Mali) and two lava flows from Morocco. The Messejana dyke (Iberia), which previously yielded discrepant conventional K-Ar dates, did not furnish any 40Ar/39Ar plateau dates. However, there is a clear inverse relationship between apparent age and K/Ca atio for gas fractions from a plagioclase separate (proportional to the alteration degree) which, combined with dates obtained on amphibole, biotite and pyroxene, allows us to determine an age of around 200 Ma for this body. These data, and those obtained on the Foum Zguid (Morocco) and the Ksi Ksou (Algeria) dykes, give evidence of a brief magmatic event (between 206 and 195 Ma ago) which affected a large area ca. 2500 km long. Trace-element modelling shows that most of these formations originated from a homogeneous, enriched, source material. Such a brief magmatic episode related to the opening of a continental rift is in agreement with findings in other magmatic provinces (e.g. the Deccan traps and the Red Sea rift, precisely dated by the 40Ar/39Ar method as well). (orig.)

  13. Caracterização por FT-IR da superfície de borracha EPDM tratada via plasma por micro-ondas

    Directory of Open Access Journals (Sweden)

    Renata P. dos Santos

    2012-01-01

    Full Text Available A superfície de uma borracha de etileno-propileno-dieno (EPDM vulcanizada foi modificada via plasma por microondas, com gases Ar, Ar/O2, N2/O2 e N2/H2, tendo como objetivo melhorar as propriedades adesivas da superfície. A técnica FT-IR/UATR foi escolhida para caracterizar as superfícies após tratamento, pois apresentou menor interferência dos ingredientes da formulação da EPDM, dentre as técnicas analisadas (ATR/KRS-5 e Ge. Grupos oxigenados foram inseridos na superfície da amostra tratada, mesmo quando não foi utilizado o oxigênio, pois estes grupos foram formados quando a superfície ativada foi exposta à atmosfera. Já em tratamentos contendo N2, grupos oxigenados e possíveis grupos nitrogenados foram identificados por FT-IR. Redução nos valores do ângulo de contato, aumento no trabalho de adesão e aumento no ensaio de resistência ao descascamento (EPDM × Poliuretano foram observados após tratamento com Ar e N2/H2, resultando em melhora nas propriedades adesivas da superfície tratada.

  14. Plataforma MEAL: Herramienta innovadora para enseñar educación nutricional a maestros y nutricionistas

    Directory of Open Access Journals (Sweden)

    Alejandro Dominguez Rodríguez

    2015-01-01

    Full Text Available El consumo de alimentos poco saludables por parte de los niños es considerado actualmente como una problemática a nivel mundial en la medida en que la salud de los infantes está directamente relacionada con la dieta. Diversas intervenciones han sido implementadas con el objetivo de enseñar educación nutricional a niños, pero la mayoría se ha centrado solo en la transmisión de información nutricional. En este artículo se describirá la plataforma MEAL que ha sido creada con el objetivo de ayudar a maestros y nutricionistas a enseñar educación nutricional a niños entre 9 y 12 años de edad. MEAL está compuesta por 3 módulos con conceptos básicos relacionados con educación nutricional, pero también contiene información relacionada con el cambio de hábitos alimenticios y establecimiento de pautas saludables. Esta plataforma también cuenta con dos videojuegos educativos dirigidos a los niños. Por la forma en que está diseñada la plataforma MEAL, y al estar basada en las Tecnologías de la Información y la Comunicación puede suponer una herramienta muy útil y efectiva para maestros y dietistas en aras de enseñar educación nutricional a los niños.

  15. DNA damages induced by Ar F laser

    International Nuclear Information System (INIS)

    The photo ablation process used in corneal refractive surgery by the Argon Fluoride (Ar F) laser emitting in ultraviolet C at 193 nm, exposes viable cells round the irradiated zone to sub ablative doses (< 400 joules.m -2). Despite that DNA absorption is higher at 193 nm than 254 nm, cytotoxicity of 193 nm laser radiation is lower than radiation emitted by 254 nm UV-C lamps. In situ, DNA could be protected of laser radiation by cellular components. Consequently, some authors consider that this radiation does not induce genotoxic effect whereas others suspect it to be mutagenic. These lasers are used for fifteen years but many questions remain concerning the long term effects on adjacent cells to irradiated area. The purpose of this study is to describe the effect of 193 nm laser radiation on DNA of stromal keratocytes which are responsible of the corneal structure. The 193 nm laser irradiation induces directly DNA breakage in keratocytes as it has been shown by the comet assay under alkaline conditions. Two hours post irradiation, damages caused by the highest exposure (150 J.m-2) are not repaired as it has been measured with the Olive Tail Moment (product of tail length and tail DNA content). They give partly evidence of induction of an apoptotic process in cells where DNA could be too damaged. In order to characterize specifically double strand breaks, a comparative analysis by immunofluorescence of the H2 Ax histone phosphorylation (H2 Ax) has been performed on irradiated keratocytes and unirradiated keratocytes. Results show a dose dependent increase of the number of H2 Ax positive cells. Consequences of unrepaired DNA lesions could be observed by the generation of micronuclei in cells. Results show again an increase of micronuclei in laser irradiated cells. Chromosomal aberrations have been pointed out by cytogenetic methods 30 mn after irradiation. These aberrations are dose dependent (from 10 to 150 J.m-2). The number of breakage decreases in the long run

  16. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Science.gov (United States)

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  17. COMEÇAR de Almada Negreiros arte e o poder formatador da matemática

    OpenAIRE

    Vaz, Rute Marina das Neves Viegas

    2013-01-01

    Este trabalho desenvolve-se tendo como base vários pressupostos: a importância da obra de arte na vida do Homem, a relação existente entre a matemática e arte e o poder formatador da matemática na arte. Optou-se por considerar como ponto de partida a análise de uma obra de arte: COMEÇAR de Almada Negreiros, utilizando o método de Panofsky. O poder formatador da matemática é evidenciado nesta obra de arte em particular, confirmando a tese de que a matemática manifesta esse poder na arte,...

  18. Nevo epidérmico manifestando-se como hiperceratose do mamilo e aréola Verrucous epidermal nevus manifesting as nipple and areola hyperkeratosis

    Directory of Open Access Journals (Sweden)

    Roberto Rheingantz da Cunha Filho

    2006-08-01

    Full Text Available Relata-se caso raro de nevo epidérmico na aréola mamária direita de menina de 13 anos. Segundo a classificação proposta por Levy-Franckel, essa variante é a hiperceratose do mamilo e aréola do tipo I, quando associada a nevo verrucoso. A histologia mostrou papilomatose, acantose e hiperceratose. Foram realizadas duas sessões de crioterapia sem melhora. Foi obtido bom resultado por meio de shaving e eletrocauterização.A rare case of a 13-year-old female patient with epidermal verrucous nevus on the right areola is reported. According to the Levy-Franckel classification, this variant is a type I nipple and areola hyperkeratosis, when associated to verrucous nevus. Histopathological examination showed papillomatosis, acanthosis and hyperkeratosis. Cryotherapy yielded unsatisfactory results after two sessions. A good result was obtained with shaving and electrocauterization.

  19. Numerical simualtion of underground 37Ar transportation to the ground

    International Nuclear Information System (INIS)

    Monitoring radioactive gas 37Ar is an important technique for the On-Site Inspection(OSI) of the Comprehensive Nuclear Test Ban Treaty (CTBT) verification regime. In order to establish a theoretical model that can be used to calculate the appearing time and radioactivity of 37Ar which transports to the ground after a nuclear explosion, the rock media in the test area is assumed to be a homogeneous porous media, without consideration of gas absorption by and release from the rock media. The seepage model in the porous media is used to calculate 37Ar transportation. Computational results give the time 37Ar leaks to the ground and the variation of its radioactivity with time. And we can analyze and consider the computational results when we have developed OSI noble gas monitoring systems and evaluated their effectiveness. (authors)

  20. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Institute of Scientific and Technical Information of China (English)

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  1. Ar2 - O2 RF plasma diagnostics by mass spectrometry

    International Nuclear Information System (INIS)

    An investigation on the nature, energy and fluxes of the dominant species from a rf 13.56 MHz argon-oxygen plasma was carried out using a quadrupolar mass spectrometer. The mass spectrometer is sampling the plasma species through the anode space charge, being placed on the grounded electrode - the chamber wall. The ion energy distributions of most important ions from plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated using the mass spectrometer. The main results are as follows: i) the oxygen addition in the argon discharge leads to the plasma potential decreasing and therefore the potential difference on the sheath formed in front of the anode wall is diminished as compared with the discharge in pure argon; ii) the combination of two effects, the rf modulation of the sheath potential, and the charge exchange, as a dominant inelastic interaction process in the sheath, leads to pronounced and characteristic additional structures in the ion energy distributions. (authors)

  2. K-Ar ages of dikes in Northeast Japan

    International Nuclear Information System (INIS)

    Thirteen dike swarms in Northeast Japan were dated by the K-Ar method. The K-Ar ages in this study give some crucial constraints to the volcanostratigraphy and imply that the geological situation of some dike swarms estimated in the other studies should be reexaminned while other dike swarms showed the K-Ar ages concordant with the geological ages. Available K-Ar ages of the volcanic rocks from the present and other studies indicate that the volcanic front in Northeast Japan had a temporal position about 22-23Ma ago to the east of that in the Quaternary and that the volcanism appears to have been inactive from 17 to 21Ma ago. (author)

  3. Oficinas y nave industrial en Arévalo, Ávila.España

    Directory of Open Access Journals (Sweden)

    Pérez Arroyo, Salvador

    1992-06-01

    Full Text Available This article describes a factory of plastic materials transformation. It is an industrial building located on the "Tierras de Arévalo" etate in the province of Ávila. The construction consists of 10,000 m2 large industrial plant, areas of quality testing laboratory as well as 2,500 m2 of offices distributed in two levels. The final result is a compact white construction of prismatic volume integrated in the arid landscape of the Castillian plain.

    Se describe en este artículo una fábrica de transformación de materiales plásticos. Es un edificio de carácter industrial situado en el polígono "Tierras de Arévalo", en la provincia de Ávila. La edificación consta de 10.000 m2 de nave industrial, zonas de laboratorio de control de calidad, así como 2.500 m2 de oficinas-paisaje distribuidas en dos plantas. El resultado final es una edificación compacta, configurada por un volumen prismático blanco integrado en el árido paisaje de la llanura castellana.

  4. Augmented Reality Computer-Aided Drawing (AR-CAD)

    OpenAIRE

    ECT Team, Purdue

    2007-01-01

    While Virtual Reality (VR) replaces the entire real world with virtual images, Augmented Reality (AR) superimposes virtual images on the real world. Augmented Reality (a most useful form of Mixed Reality (MR)) is a popular concept for using computers to overlay virtual information onto a view of the real world. In 2000, Phillip Dunston then at the University of Washington in Seattle and his research team presented the initial concept of AR CAD developed for supporting design and construction....

  5. Ambiente de Realidad Aumentada Interactivo en Tiempo Real para Enseñar Anatomía

    OpenAIRE

    Alencastre, Moisés; Muñoz, Lourdes; Manrique, Cristina; Grostieta,Zaira; Rojas, Ricardo, 1882-1957

    2013-01-01

    En este artículo se presenta un ambiente de Realidad Aumentada (RA) que utiliza información de una cámara de profundidad para enseñar ciertos temas de Anatomía de forma interactiva a nivel Preparatoria. La idea es mostrar a los estudiantes donde se encuentran los huesos, músculos y órganos del cuerpo humano; desplegando modelos 3D sobre el cuerpo de la persona cuya imagen está siendo capturada por un Kinect en tiempo real. De esta manera, los estudiantes pueden identificar cómo se encuentran ...

  6. Salida de campo a Montejo de Arévalo (Segovia) el 27 y 28 de mayo de 1956

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Salida de campo a Montejo de Arévalo (Segovia) el 27 y 28 de mayo de 1956, de la que se anotaron observaciones sobre Vulpes vulpes (Zorro), y las siguientes aves: Alectoris rufa (Perdiz roja), Apus apus (Vencejo común), "Biblis rupestris", Corvus corax (Cuervo), Corvus monedula (Grajilla, llamada Coloeus por el autor), Emberiza cia (Escribano montesino), Falco peregrinus (Halcón peregrino, también llamado Alcotán palomero), Falco tinnunculus (Cernícalo vulgar), Fringilla coelebs (Pinzón vulga...

  7. Effect and mechanism of AR-6 in experimental rheumatoid arthritis.

    Science.gov (United States)

    Sun, Shi-xue; Li, Yun-man; Fang, Wei-rong; Cheng, Peng; Liu, Lifang; Li, Fengwen

    2010-06-01

    The root of Clematis chinensis Osbeck has been used widely in rheumatoid arthritis in Chinese traditional medicine and AR-6 is a triterpene saponin isolated from it. In this present study, we investigated in vivo effects of oral AR-6 in chronic rat adjuvant-induced arthritis (AA) and in vitro effect in macrophage and synoviocytes cells. Arthritic scores and serum inflammatory mediators were evaluated 19 days after AA induction by endermic injection of Freund's complete adjuvant in Sprague-Dawley(S-D) rats. Oral administration of AR-6 to arthritic rats resulted in a clear decrease of clinical signs compared to untreated controls. The synoviocyte and macrophage response ex vivo were then analyzed. Anti-arthritic effects of AR-6 correlated with significant decrease of NO and TNF-alpha produced by peritoneal macrophages, ex vivo and in vitro. AR-6 also significant decreased the proliferation of synoviocyte. These data indicate that AR-6 is a potential anti-inflammatory therapeutic and preventive agent. PMID:19842015

  8. La Transversal Cafetera por Caldas

    OpenAIRE

    Duque Escobar, Gonzalo

    2014-01-01

    Dada la necesidad de una transversal férrea para resolver las falencias estructurales del transporte de carga colombiano, con la construcción del nuevo Túnel Cumanday bimodal y doble cruzando la Cordillera Central por Caldas, la nueva Transversal Cafetera podría diseñarse con pendiente máxima del 6% y velocidad de 80 km/h, y convertirse en complemento al paso por la Línea, y en el soporte de un corredor logístico que integraría la región andina de Colombia, al detonar con el ferrocarril senda...

  9. Ptose palpebral causada por Paquidermoperiostose

    Directory of Open Access Journals (Sweden)

    Patricia Regina de Pinho Tavares

    2014-08-01

    Full Text Available A paquidermoperiostose é uma síndrome caracterizada por acometimento cutâneo e ósseo, e em alguns casos ocorre comprometimento palpebral leve. É uma síndrome rara, idiopática ou hereditária, com provável herança autossômica dominante de penetrância variável. Descreve-se o caso de um paciente com ptose grave por paquidermoperiostose elucidando sua fisiopatologia e conduta cirúrgica aplicada.

  10. Se los por se lo

    OpenAIRE

    José Luis Rivarola

    1985-01-01

    El sistema de la conjugación "objetiva" plantea interesantesproblemas que fueron tratados en parte por K. Heger (1966) en suestudio comparativo del francés y del español. De la comparaciónse desprende, por ejemplo, que en español hay un cierto número deambigüedades que no permiten establecer un "paradigma tan completo y unívoco" como en el caso del francés. Dentro de estas ambigüedades se encuentran las que propicia el gramema se: "El morfema [gramema] se funciona no sólo como pronombre refle...

  11. Miasis cutanea por cordylobia anthropophaga

    OpenAIRE

    Alkorta Gurrutxaga Miriam; Beristain Rementeria Xabier; Cilla Eguiluz Gustavo; Tuneu Valls Anna; Zubizarreta Salvador José

    2001-01-01

    El incremento progresivo en el número de personas que viajan a países tropicales ha hecho que las enfermedades importadas adquieran una relevancia cada vez mayor. Las miasis (o infestaciones por larvas de moscas) cutáneas se encuentran entre este tipo de enfermedades siendo especialmente frecuentes en países tropicales. A propósito de la observación de un caso de miasis cutánea masiva por Cordylobia antropophaga, que ocurrió en una mujer de 34 años de edad al volver de un viaje a Senegal, se ...

  12. Diverticulitis yeyunal perforada por enterolito.

    OpenAIRE

    Marenco De la Cuadra, Beatriz; Gomez-Rosado, Juan Carlos; Capitan-Morales, Luis-Cristobal; Valdés Hernández, Javier; Reyes-lopera, N.J. De los

    2012-01-01

    La diverticulosis yeyunal es una enfermedad adquirida rara. Casi el 60-70% keeps asymptomátic or Con síntomas crónicos inespecíficos, aunque puede presentarse como un abdomen agudo. La perforación debida a enterolitos es una causa extremadamente rara do complicación, y puede producirse por la impactación de ésta contra la pared intestinal. Presentamos caso de un varón de 82 años que acude a urgencias por un dolor súbito abdominal, difuso, con irritación peritoneal, leucocitosis con neutro...

  13. Estudo técnico-económico para otimização do projeto e implementação de uma bomba de calor "heat machine"

    OpenAIRE

    Silva, Luis Carlos Diniz da

    2015-01-01

    A gestão sustentável de calor residual produzido em processos de arrefecimento em sistemas de Aquecimento, Refrigeração e Ar Condicionado (AVAC), tem recebido uma especial atenção nos últimos anos. O aproveitamento do calor normalmente desperdiçado por estes sistemas para o meio ambiente, pode resultar em poupanças energéticas significativas. Em colaboração com as empresas “ACET Engenharia e Termodinâmica” e “Recipharm”, observou-se a possibilidade de implementar um sistem...

  14. Inovar na produção de energia elétrica a partir do vento. O recurso a postes de eletricidade existentes

    OpenAIRE

    Franco, Miguel Leichsenring

    2012-01-01

    O vento é utilizado há milhares de anos para suprir as necessidades energéticas da atividade humana. A energia eólica é, como a maioria das fontes de energia renovável, uma forma de energia solar, tendo origem no aquecimento da atmosfera pelo sol, que põe em movimento as massas de ar. A rotação da terra, a forma e cobertura da superfície terrestre e os planos de água, influenciam por seu turno o regime dos ventos, ou seja, a velocidade, direção e variabilidade do vento...

  15. La individualidad de don Quijote vista por Hegel

    Directory of Open Access Journals (Sweden)

    Carlos Másmela

    2008-01-01

    Full Text Available El objetivo de este artículo consiste en desentrañar, con base en los elementos proporcionados por la Estética, la constitución irónica de la individualidad en la interiorización de los mitos, tal como ocurre en El Quijote. Para realizar esta tarea nos apoyaremos en dos textos de la Fenomenología del espíritu, a saber, “la ley del corazón y el desvarío de la infatuación” y “la virtud y el curso del mundo”, en los cuales se hará corresponder el despliegue que Hegel ejecuta en ellos a diferentes pasajes del Quijote.

  16. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Science.gov (United States)

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  17. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    -Instruments multi-collector Noblesse noble gas mass spectrometer configured with a faraday detector and three ion-counting electron multipliers. The instrument has the capability to measure several noble gas isotopes simultaneously and to change measurement configurations instantaneously by the use of QUAD lenses......New generation, high resolution, multi-collector noble gas mass spectrometers equipped with ion-counting electron multipliers provide opportunities for improved accuracy and precision in 40Ar/39Ar dating. Here we report analytical protocols and age cross-calibration studies using a NU...... (zoom optics). The Noblesse offer several advantages over previous generation noble gas mass spectrometers and is particularly suited for single crystal 40Ar/39Ar dating because of: (i) improved source sensitivity (ii) ion-counting electron multipliers, which have much lower signal to noise ratios than...

  18. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  19. 40Ar/39Ar age evidence for Altyn fault tectonic activities in western China

    Institute of Scientific and Technical Information of China (English)

    LIU Yongjiang; J. Genser; GE Xiaohong; F. Neubauer; G. Friedl; CHANG Lihua; REN Shoumai; R. Handler

    2003-01-01

    Four 40Ar/39Ar age groups of mica, hornblende and K-feldspar were obtained from Proterozoic and early Paleozoic metamorphic rocks in the Aksay-Dangjin Pass area, western China. The samples away from the middle shear zone of the Altyn fault belt yield two plateau age groups in the range of 461-445.2 Ma and 414.9-342.8 Ma, respectively. They represent the tectono-thermal events that had been recorded in the rocks that were displaced by the Altyn strike-slip fault in late Ordovician-early Silurian and Devonian, respectively. These two age groups should be related to the closures of Northern and Southern Qilian Oceans. The deformed granitic gneiss from the northern belt gives a plateau age group of 178.4-137.5 Ma, which is interpreted as the active age of the Altyn fault in the middle-late Jurassic- early Cretaceous and should be related to the accretion of Lhasa block to the north. The sample from the middle shear zone of the Altyn fault belt yields two plateau ages of 36.4 and 26.3 Ma, respectively, suggesting the strike-slip movement with strong metamorphism at greenschist facies along the Altyn fault in the late Eocene. This event occurred in the most areas of the northern Tibet Plateau and should be in response in the north to the collision between Indian and Eurasian continents. The present study demonstrates that the Altyn fault is characterized by multiple pulse-style activities under the tectonic setting of convergence between the Indian and Eurasian continents.

  20. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Science.gov (United States)

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  1. Evolution of the northern Sierra Nevada metamorphic belt: Petrological, structural, and Ar/Ar constraints

    Energy Technology Data Exchange (ETDEWEB)

    Hacker, B.R. [Stanford Univ., CA (United States)

    1993-05-01

    The Sierra Nevada metamorphic belt constitutes an important record of the growth of continental crust from essentially oceanic materials. In the northern Sierra, the central part of the belt is made up of volcanoplutonic arcs and sediment-dominated units inferred to be accretionary wedges or closed ocean basins. The latter are broken formation and melange composed of radiolarian chert, lava, and volcanogenic and continental turbidites. Sedimentary detritus in the largest of these units can be plausibly linked to sources farther east in the Sierra, suggesting that deposition occurred near the eastern Sierran arc. Isoclinal folds, steeply dipping foliations, and steeply plunging down-dip lineations are characteristics structures. The westernmost unit is only feebly recrystallized, and deformation was accomplished principally by stress solution and local redeposition in veins. More easterly, inboard units are compositionally similar, but they recrystallized at pumpellyite-actinolite-and blueschist-facies conditions and deformed via solution-transfer and dislocation creep. Phengite silica contents, the degree of quartz veining, and the locations of pseudo-isograds support an eastward increase in metamorphic pressure and temperature. Metamorphic conditions during the growth of pumpellyite and actinolite ranged from {approximately}150-350 {degrees}C and 200-400 MPa, compatible with recrystallization and deformation in subduction zones or the deeper levels of magmatic arcs. Ar/Ar ages of volcanisclastic rocks and crosscutting plutons constrain the age of deformation and metamorphism in the western part of the region to 174-165 Ma. Deformation and recrystallization in more easterly units may have been coeval or begun as early as Triassic time. 58 refs., 14 figs., 4 tabs.

  2. Volcanic history and 40Ar/39Ar and 14C geochronology of Terceira Island, Azores, Portugal

    Science.gov (United States)

    Calvert, A.T.; Moore, R.B.; McGeehin, J.P.; Rodrigues da Silva, A.M.

    2006-01-01

    Seven new 40Ar/39Ar and 23 new radiocarbon ages of eruptive units, in support of new geologic mapping, improve the known chronology of Middle to Late Pleistocene and Holocene volcanic activity on the island of Terceira, Azores and define an east-to-west progression in stratovolcano growth. The argon ages indicate that Cinco Picos Volcano, the oldest on Terceira, completed its main subaerial cone building activity by about 370-380??ka. Collapse of the upper part of the stratovolcanic edifice to form a 7 ?? 9??km caldera occurred some time after 370??ka. Postcaldera eruptions of basalt from cinder cones on and near the caldera floor and trachytic pyroclastic flow and pumice fall deposits from younger volcanoes west of Cinco Picos have refilled much of the caldera. The southern portion of Guilherme Moniz Volcano, in the central part of the island, began erupting prior to 270??ka and produced trachyte domes, flows, and minor pyroclastic deposits until at least 111??ka. The northern part of Guilherme Moniz Caldera is less well exposed than the southern part, but reflects a similar age range. The northwest portion of the caldera was formed sometime after 44??ka. Several well-studied ignimbrites that blanket much of the island likely erupted from Guilherme Moniz Volcano. The Pico Alto Volcanic Center, a tightly spaced cluster of trachyte domes and short flows, is a younger part of Guilherme Moniz Volcano. Stratigraphic studies and our new radiocarbon ages suggest that most of the Pico Alto eruptions occurred during the period from about 9000 to 1000??years BP. Santa Barbara Volcano is the youngest stratovolcano on Terceira, began erupting prior to 29??ka, and has been active historically. ?? 2006.

  3. Transpressional tectonics and Carboniferous magmatism in the Limousin, Massif Central, France:structural and 40Ar/39Ar investigations.

    OpenAIRE

    Gébelin, Aude; Brunel, Maurice; Monié, Patrick; Faure, Michel; Arnaud, Nicolas

    2007-01-01

    New structural, microstructural, and 40Ar/39Ar data from the NW Massif Central (France) provide additional constraints on the timing and tectonic setting of late Variscan granite magmatism. Previous studies had emphasized the role of late orogenic extension in the emplacement of granite plutons in the Limousin region. In contrast, the new data set is consistent with syntectonic emplacement of magma in a dextral simple shear active from 350 to 300 Ma in a transpressional regime. As an alternat...

  4. Detailed Ar-40/Ar-39 dating of geologic events associated with the Mantos Blancos copper deposit, northern Chile

    OpenAIRE

    Oliveros, V.; Feraud, G.; L. Aguirre; Ramirez, L.; Fornari, Michel; Palacios, C.; Parada, M.

    2008-01-01

    The Ar-40/Ar-39 geochronological method was applied to date magmatic and hydrothermal alteration events in the Mantos Blancos mining district in the Coastal Cordillera of northern Chile, allowing the distinction of two separate mineralization events. The Late Jurassic Mantos Blancos orebody, hosted in Jurassic volcanic rocks, is a magmatic-hydrothermal breccia-style Cu deposit. Two superimposed mineralization events have been recently proposed. The first event is accompanied by a phyllic hydr...

  5. A Late Mesoproterozoic 40Ar/39Ar age for a melt breccia from the Keurusselkä impact structure, Finland

    Science.gov (United States)

    Schmieder, Martin; Jourdan, Fred; Moilanen, Jarmo; Buchner, Elmar; Öhman, Teemu

    2016-02-01

    Field investigations in the eroded central uplift of the ≤30 km Keurusselkä impact structure, Finland, revealed a thin, dark melt vein that intersects the autochthonous shatter cone-bearing target rocks near the homestead of Kirkkoranta, close to the center of the impact structure. The petrographic analysis of quartz in this melt breccia and the wall rock granite indicate weak shock metamorphic overprint not exceeding ~8-10 GPa. The mode of occurrence and composition of the melt breccia suggest its formation as some kind of pseudotachylitic breccia. 40Ar/39Ar dating of dark and clast-poor whole-rock chips yielded five concordant Late Mesoproterozoic miniplateau ages and one plateau age of 1151 ± 10 Ma [± 11 Ma] (2σ; MSWD = 0.11; P = 0.98), considered here as the statistically most robust age for the rock. The new 40Ar/39Ar age is incompatible with ~1.88 Ga Svecofennian tectonism and magmatism in south-central Finland and probably reflects the Keurusselkä impact, followed by impact-induced hydrothermal chloritization of the crater basement. In keeping with the crosscutting relationships in the outcrop and the possible influence of postimpact alteration, the Late Mesoproterozoic 40Ar/39Ar age of ~1150 Ma should be treated as a minimum age for the impact. The new 40Ar/39Ar results are consistent with paleomagnetic results that suggested a similar age for Keurusselkä, which is shown to be one of the oldest impact structures currently known in Europe and worldwide.

  6. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps

    Indian Academy of Sciences (India)

    Kanchan Pande; S K Pattanayak; K V Subbarao; P Navaneethakrishnan; T R Venkatesan

    2004-12-01

    We report here a 40Ar-39Ar age of 66.0 ± 0.9Ma (2 ) for a reversely magnetised tholeiitic lava flow from the Bhimashankar Formation (Fm.), Giravali Ghat, western Deccan province, India. This age is consistent with the view that the 1.8–2km thick bottom part of the exposed basalt flow sequence in the Western Ghats was extruded very close to 67.4 Ma.

  7. Dicty_cDB: FC-AR20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR20 (Link to dictyBase) - G03232 DDB0186972 Contig-U15983-1 FC-AR...20P (Link to Original site) FC-AR20F 321 FC-AR20Z 550 FC-AR20P 871 - - Show FC-AR20 Library FC (Link to librar....0 %: cytoplasmic 24.0 %: nuclear 8.0 %: vesicles of secretory system 4.0 %: cytoskeletal 4.0 %: mitochondri...ontig Contig-U15983-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...20Q.Seq.d/ Representative seq. ID FC-AR20P (Link to Original site) Representative DNA sequence >FC-AR20 (FC-AR

  8. DESAJUSTE EDUCATIVO POR REGIONES EN COLOMBIA: ¿COMPETENCIA POR SALARIOS O POR PUESTOS DE TRABAJO?

    Directory of Open Access Journals (Sweden)

    Maribel Castillo Caicedo

    2007-06-01

    Full Text Available Este trabajo aporta una perspectiva del fenómeno de la sobreeducación, entendida como un desajuste por exceso, entre el nivel educativo alcanzado por el individuo y el exigido por el puesto de trabajo en el cual se desempeña; esto se debe a que existe una demanda laboral estrecha de puestos de trabajo para personas calificadas en Colombia. Se analizan las contribuciones empíricas existentes y el debate sobre las mismas; se examinan las teorías que permiten explicar la existencia de un desajuste educativo y se realiza una revisión de la literatura internacional y nacional sobre el tema. Adicionalmente, se plantean una serie de hipótesis para desarrollar un esquema que permita determinar el comportamiento del individuo en el fenómeno de la sobreeducación.

  9. 40Ar/39Ar dating of alkaline and tholeiitic magmatism of Saudi Arabia related to the early Red Sea Rifting

    International Nuclear Information System (INIS)

    40Ar/39Ar plateau-ages at 27-28 Ma obtained on feeder dykes and one lava flow of the alkaline massif of Harrat Hadan are in agreement with the assumed age partly deduced from the conventional K/Ar data of the early activity of other alkaline volcanic massifs from Saudi Arabia. This magmatic activity is spatially distributed over a large area, along the western edge of the Arabian plate, and their N-S to NW-SE volcano-tectonic directions are similar to those of the future Red Sea Rift. Preliminary results obtained on tholeiitic lava flows, dykes and plutons gave 17 plateau-ages which, combined with 6 ages deduced from more disturbed age-spectra, display a main histogram peak from 24 to 21 Ma, much narrower than that obtained with conventional K/Ar ages on the same formations. Therefore, a strong tholeiitic activity affected a narrow linear area following the actual eastern Red Sea coast, over nearly 1700 km, during a brief period of time, and without showing any apparent migration. The main volcano-tectonic features of the future Red Sea are strongly outlined during this event. Such brief magmatic episodes related to continental rifts have also been documented by precise 40Ar/39Ar analyses on the British Tertiary Igneous Province, the Deccan traps and the eastern Central Atlantic. (orig.)

  10. Evaluation of the Immunity Activity of Glycyrrhizin in AR Mice

    Directory of Open Access Journals (Sweden)

    Ai-Guo Zhou

    2012-01-01

    Full Text Available In this study, we evaluated effect of glycyrrhizin on immunity function in allergic rhinitis (AR mice. The AR mice model were induced by dripping ovalbumin in physiological saline (2 mg mL−1, 10 μL into the bilateral nasal cavities using a micropipette. After the AR model was induced, mice were randomly divided into six groups: the normal control, model, lycopene 20 mg kg−1 (as positive control drug group, and glycyrrhizin 10, 20, 30 mg kg−1 groups. After the sensitization day 14, lycopene (20 mg/kg BW and glycyrrhizin (10, 20 and 30 mg/kg BW were given orally for 20 days once a day. Mice in the normal control and model groups were given saline orally once a day for 20 days. Results showed that glycyrrhizin treatment could dose-dependently significantly reduce blood immunoglobulin E (IgE, interleukin-4 (IL-4, interleukin-5 (IL-5, interleukin-6 (IL-6, nitrous oxide (NO, tumor necrosis factor-alpha (TNF-α levels and nitrous oxide synthase (NOS activity and enhance blood immunoglobulin A (IgA, immunoglobulin G (IgG, immunoglobulin M (IgM, interleukin-2 (IL-2 and interleukin-12 (IL-12 levels in AR mice. Furthermore, glycyrrhizin treatment could dose-dependently significantly enhance acetylcholinesterase (AchE activity and reduce substance P (SP level in peripheral blood and nasal mucosa of AR mice. We conclude that glycyrrhizin can improve immunity function in AR mice, suggesting a potential drug for the prevention and therapy of AR.

  11. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    Institute of Scientific and Technical Information of China (English)

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  12. Acoustic Resonance Spectroscopy (ARS) Munition Classification System enhancements. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Vela, O.A.; Huggard, J.C.

    1997-09-18

    Acoustic Resonance Spectroscopy (ARS) is a non-destructive evaluation technology developed at the Los Alamos National Laboratory (LANL). This technology has resulted in three generations of instrumentation, funded by the Defense Special Weapons Agency (DSWA), specifically designed for field identification of chemical weapon (CW) munitions. Each generation of ARS instrumentation was developed with a specific user in mind. The ARS1OO was built for use by the U.N. Inspection Teams going into Iraq immediately after the Persian Gulf War. The ARS200 was built for use in the US-Russia Bilateral Chemical Weapons Treaty (the primary users for this system are the US Onsite Inspection Agency (OSIA) and their Russian counterparts). The ARS300 was built with the requirements of the Organization for the Prohibition of Chemical Weapons (OPCW) in mind. Each successive system is an improved version of the previous system based on learning the weaknesses of each and, coincidentally, on the fact that more time was available to do a requirements analysis and the necessary engineering development. The ARS300 is at a level of development that warrants transferring the technology to a commercial vendor. Since LANL will supply the computer software to the selected vendor, it is possible for LANL to continue to improve the decision algorithms, add features where necessary, and adjust the user interface before the final transfer occurs. This paper describes the current system, ARS system enhancements, and software enhancements. Appendices contain the Operations Manual (software Version 3.01), and two earlier reports on enhancements.

  13. Mass spectrometric measurements in inductively coupled CF4/Ar plasmas

    International Nuclear Information System (INIS)

    Positive ion fluxes, mean ion energies and ion energy distribution functions in low pressure CF4/Ar plasmas have been measured. The experiments were conducted in a Gaseous Electronics Conference cell using an inductively coupled plasma device powered by a 13.56 MHz radiofrequency (rf) power source. The measurements were made at 200 and 300 W of input rf power and at 10, 20, 30 and 50 mTorr gas pressures for three gas mixtures: (i) 20% CF4 : 80% Ar, (ii) 50% CF4 : 50% Ar and (iii) 80% CF4 : 20% Ar. A Langmuir probe was also used to measure plasma parameters such as ne, ni+ and electron energy distribution functions (EEDF) which were subsequently used to reconcile the mass spectrometer data. CF3+ is the most dominant fluorocarbon ion product of the plasma, followed by CF2+ and CF+. Ar+ is also detected in significant amounts with its relative flux increasing with the increase in Ar content in the gas mixture. Significant amounts of etch products, SiFx+/COF+x (x = 0-3), of the quartz window were also detected. The fluorocarbon ions are produced by direct electron impact and by ion-molecule reactions between Ar+ and CF4 as well as between CF3+ and CF4. However, the concentrations of CF2+ and CF+ are much larger than that which can be possibly produced from these two processes. The available cross-section data suggest that the direct electron impact ionization of the fragment neutrals and negative ion production by electron attachment may be responsible for the increase in the concentrations of the minor ions. F- densities, estimated by using the measured EEDF and positive ion flux data and the available cross-section data, agree well with the published experimental data

  14. Diseño de un vehículo de tres ruedas controlado por microcontroladores

    OpenAIRE

    Andrés Palacios, Marcos

    2015-01-01

    Este proyecto consiste en diseñar el sistema electrónico para el control de un vehículo de tres ruedas mediante microcontroladores tipo PIC; el control sobre dicho sistema será ejercido por el usuario mediante señales bluetooth enviadas por un dispositivo Android. El vehículo además contará con una pantalla LCD por la que presentará información sobre la dirección y velocidad de movimiento del sistema. Para la alimentación del vehículo se usarán 6 pilas AA de 1.6 V destinadas a los motores y u...

  15. Resistance of mice immunized with killed culture trypomastigotes against infection by insect-derived trypomastigotes of Trypanosoma cruzi Resistência de camundongos imunizados com tripomastigotas de cultura mortos contra infecção por tripomastigotas de Trypanosoma cruzi provenientes do inseto

    Directory of Open Access Journals (Sweden)

    N. Yoshida

    1984-12-01

    Full Text Available Mice immunized with heat or merthiolate-killed culture trypomastigotes of the non-virulent G strain were resistant to the challenge by insect-derived trypomastigotes of the CL strain of Trypanosoma cruzi. No parasitemia was detected, by direct microscopic examination of blood samples, in 90% of immunized mice while all control animals developed a high parasitemia. Trypsinization before heat-inactivation, or fixation with paraformaldehyde, apparently reduced the immunogenicity of the G strain trypomastigotes. Mice immunized with trypomastigotes treated by either of these procedures were not protected against infection by virulent T. cruzi. Analysis of the 13I-labeled surface proteins of G strain trypomastigotes inactivated by the various methods suggests that these components are involved in eliciting protective immunity against T. cruzi infection.Camundongos imunizados com tripomastigotas de cultura da cepa G, mortos pelo calor ou mertiolato, mostraram-se resistentes à infecção por tripomastigotas da cepa CL de T. cruzi provenientes do inseto vetor. Em 90% dos camundongos imunizados não foi detectado parasitemia patente ao exame microscópico enquanto todos os animais controle desen volveram alta parasitemia. Tripsinizaçao seguida de aquecimento, ou fixação com para formal deido, aparentemente reduziram a imunogenicidade de tripomastigotas da cepa G, visto que camundongos imunizados com tripomastigotas tratados por qualquer destes métodos não foram protegidos contra infecção por T. cruzi. A análise de proteínas de superficie de tripomastigotas da cepa G. inativados por diferentos métodos, marcados com 131,I, sugere que esses componentes de superfície estão envolvidos na indução da imunidade protetora contra T. cruzi. Camundongos imunizados com tripomastigotas de cultura da cepa G. mortos pelo calor ou mertiolato. mostraram se resistentes à in fecção por tripomastigotas da cepa CL de T. cruzi provenientes do inseto vetor. Em

  16. Petrografía y edad 40Ar/39Ar de leucogranitos peraluminosos al oeste de Valcheta: Macizo Nordpatagónico (Río Negro

    Directory of Open Access Journals (Sweden)

    Martín R. Gozalvez

    2009-04-01

    Full Text Available Entre la localidad rionegrina de Valcheta y la Estación Muster del ex ferrocarril Gral. Roca se localizan numerosos afloramientos de leucogranitos que en conjunto forman un cuerpo plutónico de bordes rectos y geometría elipsoidal, aquí denominado plutón Valcheta. El intrusivo mencionado forma parte del basamento ígneo-metamórfico del sector oriental del macizo nordpatagónico. El plutón Valcheta es un cuerpo leucogranítico, peraluminoso (A/CNK >1,1, de grano medio, levemente deformado en los bordes, compuesto por una facies leucogranítica con muscovita-biotita-granate y otra con muscovita-biotita. Las zonas de contacto con los esquistos de la Formación Nahuel Niyeu están cubiertas y en su interior presenta xenolitos de gneises y anfibolitas inyectados por material leucocrático. El estudio radimétrico 40Ar/39Ar en muscovita del plutón Valcheta resultó en una edad de 470 ± 1,8 Ma. Estos datos permiten descartar la correlación de rocas leucogranitcas aflorantes al noroeste de Valcheta con el Granito Flores de edad jurásica. El plutón Valcheta presenta diferencias macroscópicas, petrográficas, microestructurales y composicionales con los intrusivos ordovícicos del Complejo Plutónico Punta Sierra, aflorante sobre la costa atlántica rionegrina. En consecuencia, la extensión del magmatismo ordovícico del este del Macizo Nordpatagónico hasta las inmediaciones de Valcheta debe ser revisada. La morfología, mineralogía, rasgos microestructurales y geoquímica del plutón Valcheta se comparan favorablemente con los leucogranitos del Complejo Mina Gonzalito que forman los plutones Tapera y María Teresa. El pico metamórfico de dicho complejo, según dataciones U-Pb en circones, es del Ordovícico medio (472 ± 5 Ma. El plutón Valcheta es composicionalmente semejante a leucogranitos post-colisionales tipo S formados en una corteza engrosada.

  17. (phoenicopterus roseus por intoxicación aguda por plomo

    Directory of Open Access Journals (Sweden)

    D Romero

    2007-01-01

    Full Text Available La presencia de plomo en el medio ambiente es un hecho indiscutible. Ello es objeto de gran interés sanitario pues repercute tanto en la salud de los animales como en la del ser humano. El plumbismo es una intoxicación que puede afectar a cualquier especie animal. En el ámbito de la fauna silvestre se asocia principalmente a la actividad cinegética en los humedales y a la ingestión de plomo metálico por parte de las aves que frecuentan estos ecosistemas. En España cada año mueren decenas de miles de aves acuáticas como consecuencia de la ingesta de perdigones de plomo. En los individuos capturados enfermos se pueden observar signos clínicos, mientras que a partir de muestras de cadáveres se obtienen datos sobre niveles tisulares de plomo. Sin embargo la evaluación de lesiones anatomopatológicas en animales de vida silvestre es difícil de realizar por la dificultad de encontrar animales recién muertos o afectados de un cuadro agudo mortal. La reproducción de esta patología en animales de experimentación se suele realizar en cisnes, palomas o patos, pero no en flamencos, por lo que no es usual disponer de datos histológicos en esta especie. En este trabajo presentamos la clínica, analítica y estudio microscópico de diferentes tejidos de un flamenco común (Phoenicopterus roseus muerto por plumbismo.

  18. Por mar, terra e ar: Dakar, Natal e as conexões transatlânticas (1880-1940)

    OpenAIRE

    Teixeira, Rubenilson B.

    2014-01-01

    Natal, capitale de l’état du Rio Grande Norte, Brésil, et Dakar, capitale du Sénégal, situées respectivement dans des points extrêmes de l’Amérique du Sud et de l’Afrique Occidentale, se trouvent dans la distance la plus courte entre les deux continents, séparés par l’Atlantique. Historiquement, ces sites urbains ont été stratégiques depuis les grandes navigations, et sont restés importants aux temps du développement moderne des voies de communications survenues avec la Révolution Industriell...

  19. Isochronic K-Ar age and helium isotopes of hyperbasite dike, Mossel peninsula, New Frisland (Spitsbergen)

    International Nuclear Information System (INIS)

    The age of a series of ultrabasic rocks and minerals, forming a hyperbasite dike in Mossel peninsula, Spitsbergen, was estimated by the isochronous K-Ar method using 40Ar/36Ar-40K/36Ar coordinates. The age of three peridotite samples and one olivine sample is found to be 1870±52 Ma

  20. Potential and opportunities for 40Ar-39Ar geochronology and thermochronology research in India. PD-3-4

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. For slowly cooled rocks, the K-Ar system yields ages that generally reflect the time elapsed since cooling below the closure temperature for argon of the mineral being analyzed and therefore becomes an extremely powerful tool for thermochronologic studies of orogenic systems. In recent years application of laser microprobe heating has enhanced the capabilities of this technique. Conventional 40Ar-39Ar step-heating experiments are designed to determine the bulk closure ages of aggregates of minerals like hornblende, muscovite, and biotite. The use of multidomain diffusion (MDD) modeling of K-feldspar developed by Lovera et al.,1989, has today become a very powerful tool for thermochronologic studies which provide constraints on the unroofing history of orogenic belts. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in polydeformed specimens

  1. Daño a los hepatocitos por lectina inhibible por D-Galactosa/N-Acetil D-Galactosamina de Entamoeba Histolytica

    OpenAIRE

    Judith Pacheco Yépez; Adrián Rondán Zárate; Mineko Shibayama; Víctor Tsutsumi; Rafael Campos Rodríguez

    2006-01-01

    La lectina de Entamoeba Histolytica se ha involucrado de manera importante en la patogenia de la amibiasis y se cree que participa en la adherencia de los trofozoítos a las células blanco. Además, se describe que la lectina puede dañar directamente a las células blanco. Por otro lado, el papel de los anticuerpos en la inmunidad protectora es controversial. En el presente estudio nosotros analizamos si la lectina se une a la superficie de los hepatocitos y los daña directamente;...

  2. Se los por se lo

    Directory of Open Access Journals (Sweden)

    José Luis Rivarola

    1985-12-01

    Full Text Available El sistema de la conjugación "objetiva" plantea interesantesproblemas que fueron tratados en parte por K. Heger (1966 en suestudio comparativo del francés y del español. De la comparaciónse desprende, por ejemplo, que en español hay un cierto número deambigüedades que no permiten establecer un "paradigma tan completo y unívoco" como en el caso del francés. Dentro de estas ambigüedades se encuentran las que propicia el gramema se: "El morfema [gramema] se funciona no sólo como pronombre reflexivo, sinotambién como variante combinatoria del pronombre personal complemento indirecto de la tercera persona.

  3. Distribución de genes de resistencia a arsénico en bacterias aisladas de sedimentos con concentraciones variables del metaloide Distribution of arsenic-resistant genes in bacteria from sediments with different concentrations of arsenic

    Directory of Open Access Journals (Sweden)

    Carolina Mellado

    2011-01-01

    Full Text Available El arsénico es un elemento tóxico, ampliamente distribuido en ambientes terrestres y acuáticos. La biotransformación bacteriana juega un importante rol en el ciclo biogeoquímico de este metaloide, interviniendo en la movilidad, distribución y biodisponibilidad de las distintas especies de arsénico en el ambiente. El objetivo de este trabajo fue relacionar la presencia de los genes arsCBA en bacterias aisladas desde zonas con distintas concentraciones de arsénico presente en los sedimentos de diferentes sectores del río Camarones (Región Arica y Parinacota. Se aislaron 34 cepas bacterianas arseniato-resistentes, a las cuales se les determinó los niveles de tolerancia a As(V y As(III; la actividad reductora de arseniato, mediante la técnica semi-cuantitativa con AgNO3 y la detección de genes ars, por PCR. El 100% de las cepas fueron tolerantes a As(V y As(III y presentaron el gen arsC, siendo capaces de reducir As(V a As(III. El gen arsB se detectó en el 86% de las cepas presentes en los sedimentos con mayor concentración de arsénico (Illapata y 71% el arsA; mientras que en las cepas provenientes de sedimentos con menores concentraciones, los genes arsB y arsA se detectaron en el 80% y 40%, para las cepas provenientes de Esquiña y el 50% y 25% para las de Desembocadura. De acuerdo a los resultados se puede concluir que, la frecuencia de detección de genes arsCBA está directamente relacionada con la concentración de arsénico presente en los diferentes sedimentos analizados.Arsenic is a toxic element, widely distributed in terrestrial and aquatic environments. Microbial biotransformation processes play a key role in the biogeochemical cycle of arsenic and can be involved in the mobility, distribution and bioavailability of the arsenic species in the environment. The objective of this study was to relate the presence of the arsCBA genes of arsenate-reducing bacteria isolated from sediments coming from different sectors of the

  4. Interference of heating on the antimicrobial activity and chemical composition of Origanum vulgare L. (Lamiaceae essential oil Interferência do aquecimento sobre a atividade antimicrobiana e composição química do óleo essencial de Origanum vulgare L. (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Evandro Leite de Souza

    2008-06-01

    (Candida albicans, C. krusei, C. tropicalis, Bacillus cereus, Escherichia coli, Staphylococcus aureus, Yersinia enterocolitica, Salmonella enterica e Serratia marcencens mostrando amplos halos de inibição do crescimento microbiano (30a42mm. O aquecimento do óleo essencial de O. vulgare não mostrou interferência (p < 0.05 sobre sua propriedade antimicrobiana, sendo observado o desenvolvimento de halos de inibição do crescimento microbiano com diâmetros similares ou aproximados quando ensaiadas a alíquota do óleo essencial mantido em temperatura ambiente e as alíquotas submetidas a diferentes temperaturas de aquecimento. Os valores de CIM encontrados para o óleo essencial de O. vulgare oscilaram entre 10 a 40 µL.mL-1 (20 µL.mL-1 para a maioria das amostras, entretanto nenhuma diferença significativa (p < 0.05 foi notada para os valores de CIM encontrados para as alíquotas do óleo essencial exposto a diferentes temperaturas. Ademais, o aquecimento não interferiu significativamente (p < 0.05 sobre a composição química do óleo essencial. A análise da composição do óleo essencial mostrou a presença de monoterpenos, compostos terpênicos e sesquiterpenos, de modo que carvacrol (68,06 a 70,27% e p-cimeno (12,85 a 154,81% foram os compostos encontrados em maiores concentrações no óleo essencial. Estes resultados mostram a estabilidade térmica do óleo essencial de O. vulgare e suporta seu possível uso concomitante com altas temperaturas em sistemas de conservação de alimentos.

  5. Sepsis neonatal por Estreptococos Pyogenes

    Directory of Open Access Journals (Sweden)

    Gilberto Rodríguez-Herrera

    2009-09-01

    Full Text Available Se presenta el caso de un paciente masculino, recién nacido a término adecuado para la edad gestacional, quien nace por parto vaginal, con el antecedente de fiebre en la madre durante el periodo de postparto inmediato. Los padres consultan a los 2 días de vida pues le notan dificultad respiratoria, hipoactividad y rechazo a la leche materna. El paciente se interna y se aborda como una sepsis. Durante su estancia en el servicio de neonatología del Hospital Nacional de Niños asocia fallo respiratorio que amerita ventilación mecánica asistida por varios días en diferentes ocasiones, derrame pleural exudativo, convulsiones de origen hipóxico isquémico. Con reporte de hemocultivos positivos por Estreptococos pyogenes. El Estreptococos pyogenes o estreptococo β-hemolνtico del grupo A, fue un problema en los comienzos del siglo pasado, siendo frecuente en las infecciones puerperales y del reciιn nacido. En la actualidad es un germen sumamente raro en los procesos de sepsis neonatal.2 La gravedad de la enfermedad causada por este microorganismo en el periodo neonatal varνa desde una onfalitis crónica de bajo grado a una septicemia, una meningitis fulminante y la muerte.1 El presente artículo pretende hacer un resumen del paciente, con su evolución clínica, radiológica y además ejemplificar todas las complicaciones que tuvimos con este germen tan poco frecuente en la actualidad en sepsis neonatal.

  6. Miasis cutanea por cordylobia anthropophaga

    Directory of Open Access Journals (Sweden)

    Alkorta Gurrutxaga Miriam

    2001-01-01

    Full Text Available El incremento progresivo en el número de personas que viajan a países tropicales ha hecho que las enfermedades importadas adquieran una relevancia cada vez mayor. Las miasis (o infestaciones por larvas de moscas cutáneas se encuentran entre este tipo de enfermedades siendo especialmente frecuentes en países tropicales. A propósito de la observación de un caso de miasis cutánea masiva por Cordylobia antropophaga, que ocurrió en una mujer de 34 años de edad al volver de un viaje a Senegal, se ha efectuado una revisión de los casos de miasis cutáneas forunculoides importadas publicados en España, así como de la biología, patología, tratamiento y prevención de la miasis humana por Cordylobia anthropophaga. El caso referido, se caracterizó por la infestación con un número inusualmente elevado de larvas, no sospechándose su etiología hasta la fase final de la enfermedad. La emergencia continuada de larvas (se recogieron 91 generó en la paciente un estado de ansiedad importante. Finalmente, la eliminación de las larvas provocó una rápida mejoría de la paciente. Aunque los casos de miasis cutánea no tienen la gravedad de otras enfermedades importadas, su conocimiento es necesario desde el punto de vista preventivo, diagnóstico y terapeútico. Es importante proceder a la identificación morfológica de las larvas diferenciándolas de otro tipo de miasis con implicaciones terapéuticas diferentes.

  7. Influência das temperaturas de síntese e de queima na sinterização de cerâmicas de titanato de bário obtido por via hidrotérmica

    Directory of Open Access Journals (Sweden)

    Antônio Alves Mendes Filho

    2002-04-01

    Full Text Available Pós finos de titanato de bário, na composição BaTiO3, foram produzidos por síntese hidrotérmica entre 140°C e 220°C, com tempos variando entre 4 e 20h, com o enchimento crítico das autoclaves. Foram empregadas, na mistura, proporções Ba/Ti de 1,02 e 2,00. Desses pós foram produzidas peças cerâmicas sinterizadas a 1180°C, 1250°C e 1320°C com patamares de 2,5h e taxa de aquecimento de 1°C/min. As densidades das pastilhas cerâmicas de titanato de bário foram determinadas e correlacionadas à temperatura de sinterização. As microestruturas das peças sinterizadas foram observadas por microscopia eletrônica de varredura.Fine barium titanium oxide powders were produced by the hydrothermal process in temperatures between 140 and 220°C, and times between 4 and 20 hours, for the critical filling of the autoclaves, and Ba/Ti ratios in the mixture of 1.02 and 2.00. The powders were pressed and sintered at 1180, 1250 and 1320°C for 2,5h and a heating rate of 1°C/min. The densities of the sintered bodies were measured and related to the sintering conditions. Microstructures of the ceramic samples were examined by SEM.

  8. High-resolution Auger spectroscopy on 79 MeV Ar5+, 89 MeV Ar6+, and 136 MeV Ar7+ ions after excitation by helium

    International Nuclear Information System (INIS)

    In this thesis the atomic structure of highly excited Ar6+ and Ar7+ ions was studied. For this 79 MeV Ar5+, 89 MeV Ar6+, and 136 MeV Ar7+ ions of a heavy ion accelerator were excited by a He gas target to autoionizing states and the Auger electrons emitted in the decay were measured in highly-resolving state. The spectra were taken under an observational angle of zero degree relative to the beam axis in order to minimize the kinematical broadening of the Auger lines. (orig./HSI)

  9. Fission-fragment nuclear lasing of Ar/He/-Xe

    Science.gov (United States)

    De Young, R. J.; Shiu, Y. J.; Williams, M. D.

    1980-01-01

    Nuclear-pumped lasing of Ar-Xe and He-Xe has been demonstrated using (U-235)F6 fission-fragment excitation. Fission fragments were created by absorption of thermal neutrons in a combination of gaseous (U-235)F6 and laser-tube wall coatings formed from UF6 chemical reaction products. At a pressure of 600 torr Ar-(3%)Xe, lasing occurred at 2.65 microns in Xe. Up to 3 torr of gaseous (U-235)F6 was added to 600 torr Ar-Xe before serious laser quenching occurred. With 3 torr of (U-235)F6 added, 38% of the energy deposition came from gaseous UF6 and the remainder from the uranium wall coating. The neutron flux at lasing threshold was found to be 4 x 10 to the 15th n/sq cm sec.

  10. Modelling Ar II spectral emission from the ASTRAL helicon plasma

    Science.gov (United States)

    Munoz Burgos, Jorge; Boivin, Robert; Loch, Stuart; Kamar, Ola; Ballance, Connor; Pindzola, Mitch

    2008-11-01

    We describe our spectral modeling of ArII emission from the ASTRAL helicon plasma at Auburn University. Collisional-radiative theory is used to model the emitted spectrum, with account being taken for the density and temperature variation along the line of sight. This study has two main aims. Firstly to test the atomic data used in the model and secondly to identify spectral line ratios in the 200 nm - 1000 nm range that could be used as temperature diagnostics. Using the temperature at which Ar II emission starts to be seen we have been able to test recent ionization and recombination data. Using selected spectral lines we were then able to test the importance of the continuum-coupling effects included in the most recent Ar+ electron impact excitation data. Selected spectral line ratios have been identified that show a strong temperature variation and have potential as a temperature diagnostic.

  11. Factor Structure of CIWA-Ar in Alcohol Withdrawal.

    Science.gov (United States)

    Bakhla, Ajay Kumar; Khess, Christoday R J; Verma, Vijay; Hembram, Mahesh; Praharaj, Samir Kumar; Soren, Subhas

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance), and the third had two items (10.04% variance). Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors. PMID:24826372

  12. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Directory of Open Access Journals (Sweden)

    Ajay Kumar Bakhla

    2014-01-01

    Full Text Available Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance, second factor also had four items (24.25% variance, and the third had two items (10.04% variance. Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors.

  13. Influencia de las mezclas de gases Ar-He y Ar-He-O2 en la soldabilidad de la aleación de aluminio AA5083-O usando Proceso GMAW-P automatizado

    Directory of Open Access Journals (Sweden)

    Enrique Esteban Niebles Nuñez

    2014-09-01

    Full Text Available La problemática en las empresas fabricantes de estructuras y construcciones soldadas en aluminio se centra en la disminución de las propiedades mecánicas de las uniones soldadas influenciada por el aporte térmico en las regiones de soldadura; así como, en los efectos de las discontinuidades y defectos, los altos costos de reparación de soldaduras y la baja productividad. El objetivo de este trabajo es evaluar la influencia de las mezclas de gases 80Ar20He (MG1, 60Ar40He (MG2, 80Ar19He1O2 (MG3, 60Ar39He1O2 (MG4, sobre la soldabilidad de la aleación de aluminio AA5083-O utilizando un material de aporte ER5183 y el proceso GMAW-P automatizado. La metodología incluyó una fase de parametrización de soldaduras, la caracterización del metal base y las regiones de soldadura. El análisis de resultados se llevó a cabo en términos de la evolución microestructural en las regiones de soldadura y evaluación de las propiedades como dureza, resistencia y elongación, así como la evaluación de discontinuidades y defectos de la unión, costos y velocidad de soldadura. Los resultados muestran que las mezclas de gas que contienen O2 favorecen significativamente la soldabilidad de la aleación en estudio.

  14. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Science.gov (United States)

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  15. 40Ar/39Ar laser probe evidence concerning the age and associated hazards of the Lake Nyos Maar, Cameroon

    Science.gov (United States)

    Dalrymple, G.B.; Lockwood, J.P.

    1990-01-01

    The waters of Lake Nyos are impounded by a fragile natural dam composed of pyroclastic rocks ejected during the formation of the lake crater (maar). Lateral erosion of this dam has reduced its width from over 500 m to only 45 m. Published whole-rock K-Ar ages of about 100 ka on juvenile basalt from the dam suggests that erosion has been slow and that the dam poses no imminent threat. New apparent 40Ar/39Ar ages of 1.4 to 232 Ma on xenocrystic K-feldspar contained in the basalt show that the xenocrysts, whose source is the 528-Ma crystalline basement, are carriers of inherited radiogenic 40Ar and would cause the whole-rock K-Ar ages to be too old. The best estimate for the age of the maar is provided by a 14C age of 400 ?? 100 yr BP on charcoal from the base of the dam. This young age indicates that the dam is eroding at a relatively rapid rate; its failure, perhaps within a few decades, would result in a major flood and imperil thousands of people living downstream in Cameroon and eastern Nigeria. ?? 1990 Kluwer Academic Publishers.

  16. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    International Nuclear Information System (INIS)

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  17. A DNA polymerase mutation that suppresses the segregation bias of an ARS plasmid in Saccharomyces cerevisiae.

    OpenAIRE

    Houtteman, S W; Elder, R T

    1993-01-01

    Yeast autonomously replicating sequence (ARS) plasmids exhibit an unusual segregation pattern during mitosis. While the nucleus divides equally into mother and daughter cells, all copies of the ARS plasmid will often remain in the mother cell. A screen was designed to isolate mutations that suppress this segregation bias. A plasmid with a weak ARS (wARS) that displayed an extremely high segregation bias was constructed. When cells were grown under selection for the wARS plasmid, the resulting...

  18. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Science.gov (United States)

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  19. Two-proton emission in the decay of 31Ar

    International Nuclear Information System (INIS)

    Several beta-delayed two-proton branches were observed in the decay of 31Ar, the most intense ones proceeding through the isobaric analogue state (IAS) in 31Cl. The mechanism of the two-proton emission is studied via the energy and angular distributions of the two protons. Simultaneous emission of the two protons fits the present data well, sequential decays might also describe them. Independent of the decay mechanism, a spin of 5/2 for the IAS is suggested. An improved limit on the direct two-proton emission from the ground state of 31Ar is presented. (orig.)

  20. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  1. Axenfeld-Rieger syndrome (ARS): A review and case report.

    LENUS (Irish Health Repository)

    Waldron, Jennie M

    2011-08-29

    Axenfeld-Rieger syndrome (ARS) is a rare, autosomal dominant condition characterized by ocular, craniofacial, dental, and periumbilical abnormalities. Relatively little information exists on this syndrome within the dental literature despite the fact that midface hypoplasia and maxillary hypodontia are classical presenting features of this syndrome. This is a case report of a 7-year-old Caucasian female with ARS who presented with significant ocular and dental anomalies. She was also found to have osteopenia. Her dental condition is described, her immediate treatment is shown, and her long-term treatment needs are discussed.

  2. Effects of Ar+ ion implantation on tribological behaviour of UHMWPE

    International Nuclear Information System (INIS)

    Ultra-high molecular weight polyethylene (UHMWPE) was implanted with Ar+. The modified surfaces were characterized by OM, AFM and NTM and FT-IR. And, tribological behaviour of UHMWPE was evaluated using a tribometer. The results show that alterations in surface colour, morphology and microstructure of UHMWPE were induced by Ar+ implantation, and the mechanical properties in terms of microhardness and elastic modulus were improved. The wear properties of modified UHMWPE were enhanced significantly, both in dry friction and under deionized water lubrication. The degree of property improvement increased with the implantation dose, with increasing friction coefficient, though. (authors)

  3. Development of a low-level Ar-37 calibration standard

    CERN Document Server

    Williams, R M; Bowyer, T W; Day, A R; Fuller, E S; Haas, D A; Hayes, J C; Hoppe, E W; Humble, P H; Keillor, M E; LaFerriere, B D; Mace, E K; McIntyre, J I; Miley, H S; Myers, A W; Orrell, J L; Overman, C T; Panisko, M E; Seifert, A

    2016-01-01

    Argon-37 is an environmental signature of an underground nuclear explosion. Producing and quantifying low-level Ar-37 standards is an important step in the development of sensitive field measurement instruments. This paper describes progress at Pacific Northwest National Laboratory in developing a process to generate and quantify low-level Ar-37 standards, which can be used to calibrate sensitive field systems at activities consistent with soil background levels. This paper presents a discussion of the measurement analysis, along with assumptions and uncertainty estimates.

  4. Arándano rojo I (Vaccinium macrocarpon Ait.)

    OpenAIRE

    Garrido Conejero, M. Victoria; Pérez-Urria Carril, Elena

    2014-01-01

    El arándano rojo o arándano rojo americano (Vaccinium macrocarpon Ait.) es una fruta muy consumida y apreciada que ha ganado popularidad con los años debido en parte a su contenido en compuestos beneficiosos para la salud humana. En el trabajo se consideran aspectos botánicos, composición nutricional y contenido en compuestos fitoquímicos, datos históricos y culturales e información sobre el cultivo de esta especie vegetal y sus variedades. También se considera su importancia económica y algu...

  5. Adsorption of Ar on a nonuniform MgO surface

    Science.gov (United States)

    Hinman, D. C.; Halsey, G. D.

    1976-01-01

    Data are presented for the adsorption of Ar and N2 on a strongly heterogeneous MgO surface at 84 K and for Ar at a range of temperatures between 130 and 250 K. The high-temperature data are analyzed according to a model which separates the contributions to the potential into bulk and surface terms, providing a method for the determination of the surface area from parameters characteristic of the bulk material. A solid-gas energy parameter and parameters indicating the strength of the impurity sites are also evaluated.

  6. Multiphoton Double Ionization of Ar and Ne Close to Threshold

    International Nuclear Information System (INIS)

    In kinematically complete studies we explore double ionization (DI) of Ne and Ar in the threshold regime (I>3x1013 W/cm2) for 800 nm, 45 fs pulses. The basic differences are found in the two-electron momentum distributions - 'correlation' (CO) for Ne and 'anticorrelation' (ACO) for Ar - that can be partially explained theoretically within a 3D classical model including tunneling. Transverse electron momentum spectra provide insight into 'Coulomb focusing' and point to correlated nonclassical dynamics. Finally, DI threshold intensities, CO as well as ACO regimes are predicted for both targets.

  7. Web authentic and similar texts detection using AR digital signature

    OpenAIRE

    Πούλος, Μάριος; Σκιαδόπουλος, Σπύρος; Μπώκος, Γιώργος Δ.

    2010-01-01

    In this paper, we propose a new identification technique based on an AR model with a complexity of size O(n) times in web form, with the aim of creating a unique serial number for texts and to detect authentic or similar texts. For the implementation of this purpose, we used an Autoregressive Model (AR) 15 th order, and for the identification procedure, we employed the cross-correlation algorithm. Empirical investigation showed that the proposed method may be used as an accurate method for id...

  8. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  9. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    OpenAIRE

    Ajay Kumar Bakhla; Khess, Christoday R.J.; Vijay Verma; Mahesh Hembram; Samir Kumar Praharaj; Subhas Soren

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance...

  10. Agujeros negros vistos por fuera y por dentro

    OpenAIRE

    Janssen, Bert

    2015-01-01

    La Relatividad General es la teoría moderna de la gravedad, que corrige los problemas que surgen con la gravedad descrita por Newton. Explicaremos porque la gravedad newtoniana es incompatible con la Relatividad Especial y cual es la solución que propone Einstein: la gravedad como una manifestación del espacio curvo. Hablaremos brevemente de los fenómenos que surgen de la Relatividad General, como los agujeros negros, las ondas gravitacionales y la cosmología.

  11. Characterization of the ars Gene Cluster from Extremely Arsenic-Resistant Microbacterium sp. Strain A33▿ †

    Science.gov (United States)

    Achour-Rokbani, Asma; Cordi, Audrey; Poupin, Pascal; Bauda, Pascale; Billard, Patrick

    2010-01-01

    The arsenic resistance gene cluster of Microbacterium sp. A33 contains a novel pair of genes (arsTX) encoding a thioredoxin system that are cotranscribed with an unusual arsRC2 fusion gene, ACR3, and arsC1 in an operon divergent from arsC3. The whole ars gene cluster is required to complement an Escherichia coli ars mutant. ArsRC2 negatively regulates the expression of the pentacistronic operon. ArsC1 and ArsC3 are related to thioredoxin-dependent arsenate reductases; however, ArsC3 lacks the two distal catalytic cysteine residues of this class of enzymes. PMID:19966021

  12. Desajuste educativo por regiones en Colombia: ¿competencia por salarios o por puestos de trabajo?

    Directory of Open Access Journals (Sweden)

    Castillo Caicedo Maribel

    2007-08-01

    Full Text Available Este trabajo aporta una perspectiva del fenómeno de la sobreeducación,
    entendida como un desajuste por exceso, entre el nivel educativo alcanzado
    por el individuo y el exigido por el puesto de trabajo en el cual se
    desempeña; esto se debe a que existe una demanda laboral estrecha de
    puestos de trabajo para personas calificadas en Colombia. Se analizan las
    contribuciones empíricas existentes y el debate sobre las mismas; se
    examinan las teorías que permiten explicar la existencia de un desajuste
    educativo y se realiza una revisión de la literatura internacional y
    nacional sobre el tema. Adicionalmente, se plantean una serie de hipótesis
    para desarrollar un esquema que permita determinar el comportamiento
    del individuo en el fenómeno de la sobreeducación.

  13. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    Institute of Scientific and Technical Information of China (English)

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  14. Late Cretaceous remagnetization of Proterozoic mafic dikes, southern Highland Mountains, southwestern Montana: A paleomagnetic and 40Ar/39Ar study

    Science.gov (United States)

    Harlan, S.S.; Geissman, J.W.; Snee, L.W.; Reynolds, R.L.

    1996-01-01

    Paleomagnetic results from Early Proterozoic metabasite sills and Middle Proterozoic diabase dikes from the southern Highland Mountains of southwestern Montana give well-defined, dual-polarity magnetizations that are statistically identical to those from a small Late Cretaceous pluton that cuts the dikes. The concordance of paleomagnetic directions from rocks of three widely separated ages indicates that the Proterozoic rocks were remagnetized, probably during Late Cretaceous time. Paleomagnetic, rock magnetic, and petrographic observations from the metabasite and diabase samples indicate that remanence is carried primarily by low-Ti magnetite. Combining virtual geomagnetic poles from metabasite sills, diabase dikes, and the Late Cretaceous pluton, we obtain a paleomagnetic pole at 85.5??N, 310.7??E (K = 19.9, A95 = 9.1??, N = 14 sites) that is similar to a reference pole from the 74 Ma Adel Mountain Volcanics of western Montana. Biotite and hornblende 40Ar/39Ar isotopic dates from host basement geneiss and a hornblende from a remagnetized metabasite sill yield ages of ca. 1800 Ma; these dates probably record cooling of the southern Highland Mountains following high-grade metamorphism at 1.9-1.8 Ga. The gneiss and metabasite age spectra show virtually no evidence of disturbance, indicating that the basement rocks were never heated to temperatures sufficient to cause even partial resetting of their argon systems. Thus, the overprint magnetization of the Highland Mountains rocks is not a thermoremanent magnetization acquired during conductive cooling of nearby Late Cretaceous plutons. Remagnetization of the metabasite sills and diabase dikes was probably caused by localized thermochemical and thermoviscous effects during circulation of Late Cretaceous hydrothermal fluids related to epithermal mineralization. The absence of significant disturbance to the 40Ar/39Ar age spectrum from the remagnetized metabasite hornblende indicates that some secondary magnetizations may

  15. Thermal History of the Felsite Unit, Geysers Geothermal Field, From Thermal Modeling of 40Ar/39Ar Incremental Heating Data

    Energy Technology Data Exchange (ETDEWEB)

    T. M. Harrison (U of California); G. B. Dalrymple (Oregon State U); J. B. Hulen (U of Utah); M. A. Lanphere; M. Grove; O. M. Lovera

    1999-08-19

    An Ar-40/Ar-39 and U-Pb study was performed of the Geysers plutonic complex of the Geysers Geothermal Field in California. Sixty-nine ion microprobe spot analyses of zircons from four granite samples from the plutonic complex that underlies the Geysers geothermal field yielded Pb-207/Pb-206 vs. U-238/Pb-206 concordia ages ranging from 1.13 {+-} 0.04 Ma to 1.25 {+-} 0.04 Ma. The U-Pb ages coincide closely with Ar-40/Ar-39 age spectrum plateau and ''terminal'' ages from coexisting K-feldspars and with the eruption ages of overlying volcanic rocks. The data indicate that the granite crystallized at 1.18 Ma and had cooled below 350 C by {approximately}0.9-1.0 Ma. Interpretation of the feldspar Ar-40/Ar-39 age data using multi-diffusion domain theory indicates that post-emplacement rapid cooling was succeeded either by slower cooling from 350-300 C between 1.0 and 0.4 Ma or transitory reheating to 300-350 C at about 0.4-0.6 Ma. Heat flow calculations constrained with K-feldspar thermal histories and the pre sent elevated regional heal flow anomaly demonstrate that appreciable heat input from sources external to the known Geysers plutonic complex is required to maintain the geothermal system. This requirement is satisfied by either a large, underlying, convecting magma chamber (now solidified) emplaced at 1.2 Ma or episodic intrusion of smaller bodies from 1.2-0.6 Ma.

  16. Medida de parámetres termoeléctricos en un sistema constituido por dispositivos PELTIER SEEBECK.

    OpenAIRE

    Arroyo Giner, Juan José

    2013-01-01

    El objetivo de este trabajo es diseñar un sistema de medida que obtenga ciertos parámetros termoeléctricos de un sistema constituido por un dispositivo Seebeck-Peltier. Para llevar a cabo las adquisiciones se utiliza como interfaz un módulo Arduino con sensores adheridos a los disipadores del sistema termoeléctrico y demás dispositivos auxiliares con el fin de adquirir la señal, por consiguiente estos datos se procesarán a través del programa Labview donde monitorizaremos los parámetros de...

  17. Gestión de recursos humanos por competencias en los proyectos de software

    Directory of Open Access Journals (Sweden)

    Jorge Soler

    2011-10-01

    Full Text Available Este trabajo tiene como objetivo contribuir a la implementación, en la industria de software, de la gestión de recursos humanos basado en el enfoque por competencias. Para ello, se realiza y fundamenta una propuesta de roles invariantes que participan tanto en proyectos de desarrollo como de implantación de software, y de competencias tanto técnicas como genéricas requeridas para desempeñar los roles propuestos. En el trabajo se fundamenta el uso del método Delphi y las variaciones requeridas, como vía para validar la propuesta de roles y competencias, y para identificar la importancia de cada competencia en el desempeño de cada rol. Además, se propone un procedimiento para determinar el índice de competencia de una persona para desempeñar un rol asignado en el proyecto.

  18. AR-40 AR-39 Age of an Impact-Melt Lithology in DHOFAR 961

    Science.gov (United States)

    Frasl, B.; Cohen, B. A.; Li, Z.-H.; Jolliff, B.; Korotev, R.; Zeigler, R.

    2016-01-01

    , although they note that further age dating of all the stones is required to test this hypothesis. We received a split of Dhofar 961 from R. Zeigler consisting of a large clast of IM Lithology B, with some light-colored, friable matrix clinging to the external margins of the impact-melt clast. This lithology was not present in the samples investigated by Joy et al. and thus does not have corresponding U-Pb ages on it. We created multiple subsplits of both the IM and matrix lithologies, each weighing several tens of micrograms. We conducted Ar-40 Ar-39 dating of this candidate SPA material by high-resolution step heating and comparing it with the regolith that surrounds it.

  19. 39Ar/40Ar dating of the trans-Himalayan calc-alkaline magmatism of southern Tibet

    International Nuclear Information System (INIS)

    The results are reported of an 39Ar-40Ar age determination investigation which show that the earlier basic plutons of the southern edge of the trans-Himalayan belt have ages of 90-110 Myr (Albian to Cenomanian), whereas the lavas of the upper unconformable series are clearly younger (60 Myr, Palaeocene). Comparing the present results with those obtained from the Ladakh and Kohistan magmatic belts further west it is concluded that a subduction zone has been active during the Cretaceous between India and Asia. (U.K.)

  20. ^(40)Ar/^(39)Ar constraints on the age and thermal history of the Urucum Neoproterozoic banded iron-formation, Brazil

    OpenAIRE

    Piacentini, Thiago; Vasconcelos, Paulo M.; Farley, Kenneth A.

    2013-01-01

    Urucum is one of the youngest banded iron-formations (BIFs) yet its exact age remains uncertain. ^(40)Ar/^(39)Ar geochronology on late-diagenetic to early metamorphic cryptomelane from the Urucum sequence reveals a minimum depositional age of 587 ± 7 Ma. Metamorphic braunite age spectra yield flat segments defining apparent ages of 547 ± 3 Ma to 513 ± 4 Ma, interpreted as recrystallization or cooling ages. Metamorphic muscovite grains from a meta-arkose interbedded with the BIF yield reproduc...

  1. Pneumonia por Legionella após uso de Infliximabe em paciente com Artrite Reumatoide

    Directory of Open Access Journals (Sweden)

    Karina de Souza Giassi

    2014-10-01

    Full Text Available Os antagonistas do fator de necrose tumoral (anti-TNF têm sido utilizados com sucesso em várias doenças inflamatórias crônicas, como artrite reumatoide (AR, mas alguns estudos observaram a ocorrência de infecções por patógenos intracelulares em pacientes medicados com anti-TNF. Relatamos um caso de paciente mulher com diagnóstico prévio de AR durante 16 anos e que estava sendo medicada com várias drogas antirreumáticas modificadoras de doença (DARMDs, tendo como resultado o insucesso terapêutico, sendo em seguida tratada com infliximab. Depois de transcorridos 15 dias da segunda dose, a paciente foi acome- tida por dor torácica ventilatório-dependente, tosse seca e dispneia. Foi hospitalizada, e o diagnóstico de pneumonia por Legionella pneumophila foi confirmado pela presença do antí- geno de Legionella na urina. TNF é uma citocina inflamatória que também promove inibição do crescimento bacteriano de patógenos intracelulares, e sua inibição parece aumentar a sensibilidade a essas infecções em alguns pacientes.

  2. A Vida por Outros Lados

    Directory of Open Access Journals (Sweden)

    Maria Berenice da Costa Machado

    2003-06-01

    Full Text Available Diálogo entre a imagem e o slogan do anúncio publicitário “A vida por todos os lados”, do jornal Zero Hora (ZH, com as características da Modernidade e da Pós-modernidade. A intenção é a refletir sobre a complexidade da comunicação institucional deste diário e sua ligação com as tendências contemporâneas.

  3. Once mil metros por segundo

    OpenAIRE

    2012-01-01

    Esta exposición es una ventana hacia el mundo de la Ciencia Ficción. Los sueños de escritores extraordinarios, personajes, lugares, máquinas y robots que cada día están más cerca de nuestra cotidianidad gracias a los avances de la ciencia y la tecnología hacen parte de la muestra itinerante por las sedes de la Universidad Nacional. El visitante puede recorrer los diferentes géneros que constituyen este género literario, además de conocer sus principales representantes. Así mismo se explor...

  4. Miasis ocular por Oestrus ovis

    Directory of Open Access Journals (Sweden)

    María Beltrán F

    2006-01-01

    Full Text Available Se presentan tres casos de miasis ocular (dos adultos y un niñoprocedentes de zonas ganaderas de la provincia de Huaura,departamento de Lima,que acudieron al Hospital Regional de Huacho por presentar el ojo rojo,fotofobia, edema palpebral y sensación de cuerpo extraño;se extrajeron larvas adheridas al canto interno del ojo,las cuales se recibieron en el Instituto Nacional de Salud y fueron identificadas como Oestrus ovis .

  5. Por la puerta del fondo

    OpenAIRE

    Tossi, Lucía

    2002-01-01

    Como aconteciera en el pasado, las mujeres de estos siglos participaban de diversas actividades científicas y técnicas, en las cuales la tradicional habilidad manual, destreza, sentido de la observación, inteligencia, imaginación y capacidad de trabajo, de los que siempre dieron pruebas, fueron ampliamente aprovechados. No obstante, salvo contadas excepciones, sólo pudieron entrar en la fortaleza del saber por la puerta del fondo. Algunas de esas mujeres, pertenecientes a las clases nobles y ...

  6. Sepsis neonatal por Estreptococos Pyogenes

    OpenAIRE

    Gilberto Rodríguez-Herrera; Cinthya Ramírez-Navarro

    2009-01-01

    Se presenta el caso de un paciente masculino, recién nacido a término adecuado para la edad gestacional, quien nace por parto vaginal, con el antecedente de fiebre en la madre durante el periodo de postparto inmediato. Los padres consultan a los 2 días de vida pues le notan dificultad respiratoria, hipoactividad y rechazo a la leche materna. El paciente se interna y se aborda como una sepsis. Durante su estancia en el servicio de neonatología del Hospital Nacional de Niños asocia fallo respir...

  7. Tensor Effect on Proton Bubble Structure of ~(46)Ar

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    We have calculated the proton density distribution of 46Ar for different pairing interactions with the Skyrme interactions SLy5 and SLy5+Tw (Tw is the tensor force, which was obtained by the G-matrix calculations and added perturbatively into the SLy5 interaction

  8. Pulsed electric field (PEF)research at USDA, ARS, ERRC

    Science.gov (United States)

    This article summarizes the effects of pulsed electric fields on the microbiological safety and quality aspects of various liquid food matrices, obtained at USDA, ARS, Eastern Regional Research Center under CRIS Project No. 1935-41420-013-00D, Processing Intervention Technologies for Enhancing the S...

  9. Magnetic Energy and Helicity Budgets in NOAA AR 11158

    CERN Document Server

    Tziotziou, Kostas; Liu, Yang

    2013-01-01

    In previous works we introduced a nonlinear force-free method that self-consistently calculates the instantaneous budgets of free magnetic energy and relative magnetic helicity in solar active regions (ARs). Calculation is expedient and practical, using only a single vector magnetogram per computation. We apply this method to a timeseries of 600 high-cadence vector magnetograms of the eruptive NOAA AR 11158 acquired by the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory over a five-day observing interval. Besides testing our method extensively, we use it to interpret the dynamical evolution in the AR, including eruptions. We find that the AR builds large budgets of both free magnetic energy and relative magnetic helicity, sufficient to power many more eruptions than the ones it gave within the interval of interest. For each of these major eruptions, we find eruption-related decreases and subsequent free-energy and helicity budgets that are consistent with the observed eruption (flare a...

  10. Atom trap trace analysis of {sup 39}Ar

    Energy Technology Data Exchange (ETDEWEB)

    Welte, Joachim

    2011-12-14

    Detection of {sup 39}Ar in natural water samples can be employed for radiometric dating on a timescale of 50 to 1000 years before present. This experimental work comprises the setup of an atomic beam and trap apparatus that captures and detects {sup 39}Ar atoms by the laser-cooling technique ''Atom Trap Trace Analysis''. With this approach, the limitations of low-level counting, regarding sample size and measurement time, could be overcome. In the course of this work, the hyperfine structure spectrum of the cooling transition 1s{sub 5}-2p{sub 9} has been experimentally determined. A high intensity, optically collimated beam of slow metastable argon atoms has been set up and fluorescence detection of individual {sup 39}Ar atoms in a magneto-optical trap is realized. {sup 39}Ar count rates of 1 atom in about 4 hours have been achieved for atmospheric argon. Recent improvements further suggest that even higher count rates of 1 atom/hour are within reach.

  11. Expansion of the USDA ARS Aerial Application spray atomization models

    Science.gov (United States)

    An effort is underway to update the USDA ARS aerial spray nozzle models using new droplet sizing instrumen-tation and measurement techniques. As part of this effort, the applicable maximum airspeed is being increased from 72 to 80 m/s to provide guidance to applicators when using new high speed air...

  12. USDA-ARS and EMBRAPA Scientists Build Bridges With Strawberries

    Science.gov (United States)

    At the '3rd Simposio Nacional do Morango'and '2nd Encontro de Pequenas Frutas e Frutas Nativas do Mercosul' at Pelotas, Rio Grande Do Sul, Brazil, held 7 - 10 November 2006, I was invited to describe strawberry breeding in the United States and also my own USDA-ARS strawberry breeding program at Bel...

  13. Important authorship clarification for arXiv:1010.2709

    OpenAIRE

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  14. Spectroscopy Study of Ar + CO2 Plasmas in ASTRAL.

    Science.gov (United States)

    Munoz, Jorge; Boivin, Robert; Kamar, Ola; Loch, Stuart; Ballance, Connor

    2006-10-01

    A spectroscopy study of the ASTRAL (Auburn Steady sTate Research fAciLity) helicon plasma source running Ar + CO2 gas mix is presented. ASTRAL produces Ar plasmas: ne = 10^10 to 10^13 cm-3, Te = 2 to 10 eV and Ti = 0.03 to 0.5 eV. A series of 7 large coils produce an axial magnetic field up to 1.3 kGauss. A fractional helix antenna is used to introduce rf power up to 2 kWatt. A spectrometer which features a 0.33 m Criss-Cross monochromator and a CCD camera is used for this study. Very different plasmas are produced following the relative importance of CO2 in the gas mixture. At low CO2 concentration, the plasmas are similar to those obtained with pure Ar with weak CO2, CO2^+, CO and CO^+ bands. The usual blue plasma core associated with intense Ar II transitions is observed with however a significant white glow coming from the outer plasma regions. At higher CO2 concentration, the plasma becomes essentially molecular and can be described as an intense white plasma column. Molecular dissociative processes associated with the production of strong C and O atomic lines are observed under specific plasma conditions. The atomic spectral lines are compared with ADAS modeling results. This study indicates the possible advantages of using a helicon source to control the CO2 plasma chemistry for industrial applications.

  15. Quantum vibrational dynamics of the Ar2ICl cluster

    Science.gov (United States)

    Valdés, Álvaro; Prosmiti, Rita

    2016-03-01

    Quantum mechanical multiconfiguration time-dependent Hartree (MCTDH) calculations are presented for the Ar2ICl cluster. The Hamiltonian operator is expressed in satellite coordinates, with its potential term being represented as a sum of the three-body ArICl ab initio parameterized interactions plus the Ar-Ar ones. The potential surface shows different type of low-lying minima (global and local), that influence the vibrational dynamics of the system. The vibrational ground state properties and specific vibrationally excited states are obtained from improved relaxation MCTDH calculations employing a large number of basis set functions, especially for the angular part, to achieve convergence. By analyzing the spatial density distributions of the vibrational states we are able to characterize the corresponding states to different isomers, such as tetrahedral, linear, bending type ones. The binding energy of each isomer is also computed, and they contribute to evaluate their relative stability, as well as the importance of the underlying multiple minima of the potential surface.

  16. Ars Fennica - isikliku ja poliitilise vahel / Janar Ala

    Index Scriptorium Estoniae

    Ala, Janar, 1979-

    2009-01-01

    2008. aasta Ars Fennica kunstiauhinna kandidaatide tööde näitus Kumu Kunstimuuseumis kuni 26. aprillini. Läti kunstniku Katrina Neiburga, soomlaste Seppo Renvalli, Maria Dunckeri ja Tea Mäkipää ning Mark Raidpere näitusel eksponeeritud töödest

  17. Immune epitope database analysis resource (IEDB-AR)

    DEFF Research Database (Denmark)

    Zhang, Qing; Wang, Peng; Kim, Yohan;

    2008-01-01

    We present a new release of the immune epitope database analysis resource (IEDB-AR, http://tools.immuneepitope.org), a repository of web-based tools for the prediction and analysis of immune epitopes. New functionalities have been added to most of the previously implemented tools, and a total of...

  18. Precision lifetime measurements of Ar II 4p doublet levels

    International Nuclear Information System (INIS)

    The lifetimes of the Ar II 4p doublet fine-structure levels 4p 2D05/2, 4p' 2F05/2 and 4p' 2F07/2 were measured by beam-dye laser spectroscopy. The experimental uncertainty was reduced to below 1%. (orig.)

  19. Global properties of the white dwarf pulsar AR Scorpii

    CERN Document Server

    Franzon, B

    2016-01-01

    In view of the new recent observation and measurement of the fast-rotating and highly-magnetized white dwarf AR Sco \\cite{Marsh:2016uhc}, we determine bounds for its radius, magnetic fields, moment of inertia and gravitational wave (GW) emission by using observations of the luminosity, as well the rotation frequency $\

  20. K-Ar geochronology of the southwestern Brooks Range, Alaska

    International Nuclear Information System (INIS)

    The southern Brooks Range schist belt is characterized by metasediments with subordinate metabasites and metafelsites. Blueschists occur within the schist belt from the Chandalar Quadrangle westward to the Baird Mountains Quadrangle. We report 76 new 40K-40Ar mineral ages from 47 metamorphic and igneous rocks in the southwestern Brooks Range. The pattern of radiometric ages provide evidence that the schist belt has, at least in part, undergone a Late Precambrian blueschist facies metamorphism. Silurian to Devonian carbonates and Middle Devonian felsic volcanics were later deposited on this Precambrian basement. Subsequent deformations produced the present pattern of isoclinal, recumbent folds, resulting in the interlayering of rocks of markedly different ages and lithologies. The entire schist terrane was metamorphosed to greenchist facies in Mesozoic time, probably as a result of Jurassic-Cretaceous northward overthrusting of oceanic crust and upper mantle, resulting in the resetting of most K-Ar mica ages to the mid-Cretaceous. A series of apparent 40K-40Ar ages intermediate between Late Precambrian and mid-Cretaceous are interpreted as indicating varying amounts of partial argon loss from older rocks during the Mesozoic metamorphism. Some glaucophanes contain excess radiogenic 40Ar. (auth)

  1. Nano-hardness estimation by means of Ar+ ion etching

    International Nuclear Information System (INIS)

    When the coatings are in nano-scale, the mechanical properties cannot be easily estimated by means of the conventional methods due to: tip shape, instrument resolution, roughness, and substrate effect. In this paper, we proposed a semi-empirical method to evaluate the mechanical properties of thin films based on the sputtering rate induced by bombardment of Ar+ ion. The Ar+ ion bombardment was induced by ion gun implemented in Auger electron spectroscopy (AES). This procedure has been applied on a series of coatings with different structure (carbon films) and a series of coating with a different density (ZnO thin films). The coatings were deposited on Silicon substrates by RF sputtering plasma. The results show that, as predicted by Insepov et al., there is a correlation between hardness and sputtering rate. Using reference materials and a simple power law equation the estimation of the nano-hardness using an Ar+ beam is possible. - Highlights: • ZnO film and Carbon films were grown on silicon using PVD. • The growth temperature was room temperature. • The hardness of the coatings was estimated by means of nanoindentation. • Evaluation of resistance of materials to the mechanical damage induced by an Ar+ ion gun (AES). • The hardness have been studied and a power law with the erosion rate has been found

  2. The ARS Culture Collection and Developments in Biotechnology

    Science.gov (United States)

    The ARS Culture Collection (NRRL) has played a prominent role in the development of biotechnology since its founding in 1940 when the Northern Regional Research Laboratory opened. Early discoveries included selection of production strains for penicillin, dextran blood extender, xanthan gum and the v...

  3. 75 FR 12163 - Class E Airspace; Mountain View, AR

    Science.gov (United States)

    2010-03-15

    ...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p. 389... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Mountain View, AR AGENCY:...

  4. Strong-field nonsequential double ionization of Ar and Ne

    International Nuclear Information System (INIS)

    We investigate the nonsequential double ionization (NSDI) of Ar and Ne based on quantitative rescattering theory (QRS). According to QRS theory, each elementary NSDI process can be calculated by multiplying the returning electron wave packet with appropriate differential electron-ion scattering cross sections. We include (e, 2e) and electron-impact excitation cross sections of Ar+ to obtain the correlated electron momentum spectra for the NSDI of Ar by few-cycle pulses to check the dependence of NSDI on the carrier-envelope phase. The results are compared to the ion momentum spectra from the recent experiment of Johnson et al. [Phys. Rev. A 83, 013412 (2011)]. Calculations have also been performed for Ar at another intensity to illustrate the intensity dependence of NSDI and to compare with the earlier data of Feuerstein et al. [Phys. Rev. Lett. 87, 043003 (2001)] and for Ne to illustrate the target dependence. We also address the presence of resonant capture processes in electron-ion collisions in the NSDI spectra.

  5. Near-contact Binaries IZ Monocerotis and AR Draconis

    Science.gov (United States)

    Yang, Yuan-Gui; Dai, Hai-Feng; Zhou, Zheng; Li, Qun

    2016-05-01

    We present multi-color photometric observations for two neglected near-contact binaries, IZ Mon (P=0\\_\\_AMP\\_\\_fd;77980) and AR Dra (P=0\\_\\_AMP\\_\\_fd;67584). By the aid of the updated W-D analysis code, the photometric solutions were deduced from the multi-color light curves (LCs). IZ Mon is a semi-detached binary with a mass ratio of q=0.388(+/- 0.002), while AR Dra is a detached star with a mass ratio of q=0.652(+/- 0.002). The asymmetric LCs of IZ Mon were modeled by a hot spot on the secondary’s surface, which may be attributed to mass transfer from the primary. Based on all collected eclipse times for two systems, we constructed their timing residual curves. The orbital period for IZ Mon may be continuously decreasing at a rate of {dP}/{dt}=-2.06(+/- 0.04) {days} {{yr}}-1, which may result from mass and angular momentum loss from the central system. For AR Dra, there exists a cyclic variation with a period of {P}3=104.9(+/- 2.9) {yr} due to light-time orbit effect via the presence of the third body, whose mass is more than 0.28(+/- 0.02) {M}⊙ . Finally, two near-contact binaries, IZ Mon and AR Dra, will evolve into contact binaries.

  6. Tirgošanās ar ietekmi

    OpenAIRE

    Skujiņa, Līva

    2016-01-01

    Bakalaura darba tēma ir „Tirgošanās ar ietekmi”. Par tirgošanos ar ietekmi Latvijā ir noteikta kriminālatbildība jau vairāk nekā desmit gadus, lai arī tiesu prakse attiecībā uz šo noziedzīgo nodarījumu nav izveidojusies. Bakalaura darba mērķis ir veikt Krimināllikuma 326.1 pantā ietvertā noziedzīgā nodarījuma sastāva teorētisko analīzi un izpētīt kvalifikācijas problēmjautājumus. Lai sasniegtu mērķi, autore aplūkoja tirgošanās ar ietekmi jēdzienu un tiesisko regulējumu Latvijas Republikā. Ti...

  7. He-, Ne-, and Ar-phosgene intermolecular potential energy surfaces

    DEFF Research Database (Denmark)

    Munteanu, Cristian R.; Henriksen, Christian; Felker, Peter M.; Fernández, Berta

    2013-01-01

    Using the CCSD(T) model, we evaluated the intermolecular potential energy surfaces of the He-, Ne-, and Ar-phosgene complexes. We considered a representative number of intermolecular geometries for which we calculated the corresponding interaction energies with the augmented (He complex) and doub...

  8. 75 FR 12162 - Class E Airspace; Manila, AR

    Science.gov (United States)

    2010-03-15

    ... Regulatory Policies and Procedures (44 FR 11034; February 26, 1979); and (3) does not warrant preparation of... read as follows: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Manila, AR AGENCY: Federal...

  9. Big data computing: Building a vision for ARS information management

    Science.gov (United States)

    Improvements are needed within the ARS to increase scientific capacity and keep pace with new developments in computer technologies that support data acquisition and analysis. Enhancements in computing power and IT infrastructure are needed to provide scientists better access to high performance com...

  10. K-Ar ages of the Hattholmen anorthosite, northern Sweden

    International Nuclear Information System (INIS)

    Hornblendite together with anorthositic and pegmatitic dikes forms the bedrock of islet of Hattholmen (20 km south of the town of Umeaa, Sweden). These rocks have been analyses chemically. The K-Ar age of the anorthositic and pegmatite dikes is 1676 24 Ma and 1663 24Ma. (author)

  11. Impacto do aquecimento global no cultivo do feijão-caupi, no Estado da Paraíba Impact of global warming on the cowpea cultivation in the State of Paraíba

    Directory of Open Access Journals (Sweden)

    João H. B. da C. Campos

    2010-04-01

    Full Text Available No presente estudo se avaliam os impactos da mudança do clima com base nos relatórios do Painel Intergovernamental em Mudanças do Clima (IPCC, no zoneamento agrícola de riscos climáticos para a cultura do feijão-caupi (Vigna unguiculata L. Walp cultivado em sistema de sequeiro, no Estado da Paraíba. Utilizou-se o modelo do balanço hídrico associado a técnicas de geoprocessamento, e se objetivou a identificação das regiões do Estado em que a cultura do feijão-caupi sofrerá restrições em face das mudanças climáticas. As variáveis consideradas no modelo foram precipitação pluvial, coeficientes de cultura, evapotranspiração potencial e duração das fases fenológicas da cultura. Adotou-se, como limite para o índice de satisfação da necessidade de água para a cultura (ISNA, o valor de 0,50. A data foi considerada adequada para a semeadura quando a simulação do balanço hídrico apresentou resultados de ISNA com frequência mínima de 80%, superior ao valor do critério adotado. Tendo em vista um aumento de temperatura do ar de 3 e 6 oC, como sugerido pelo IPCC, o cultivo do feijão-caupi sofrerá uma redução significativa nas áreas atualmente favoráveis ao seu cultivo no Estado da Paraíba.This study evaluates the impacts of climate change, based on the reports of the IPCC, on the agricultural zoning of climatic risk of the rainfed cowpea (Vigna unguiculata L. Walp crop grown in the Paraíba state. The water balance model combined with GIS techniques was used for identifying areas in the state where the cowpea crop will suffer yield restrictions due to climate changes. Model input variables were: rainfall, crop coefficients, potential evapotranspiration and duration of the crop cycle. The limit value of 0.5 was adopted for the water requirement satisfaction index (WRSI. The date acceptable for seeding was that when the water balance simulation presented, for at least 80% minimum frequency, WRSI value greater than

  12. Petrografía y edad 40Ar/39Ar de leucogranitos peraluminosos al oeste de Valcheta: Macizo Nordpatagónico (Río Negro Petrography and 40Ar/39Ar age of peraluminous leucogranites west of Valcheta, Northpatagonian Massif (Río Negro

    Directory of Open Access Journals (Sweden)

    Martín R. Gozalvez

    2009-04-01

    Full Text Available Entre la localidad rionegrina de Valcheta y la Estación Muster del ex ferrocarril Gral. Roca se localizan numerosos afloramientos de leucogranitos que en conjunto forman un cuerpo plutónico de bordes rectos y geometría elipsoidal, aquí denominado plutón Valcheta. El intrusivo mencionado forma parte del basamento ígneo-metamórfico del sector oriental del macizo nordpatagónico. El plutón Valcheta es un cuerpo leucogranítico, peraluminoso (A/CNK >1,1, de grano medio, levemente deformado en los bordes, compuesto por una facies leucogranítica con muscovita-biotita-granate y otra con muscovita-biotita. Las zonas de contacto con los esquistos de la Formación Nahuel Niyeu están cubiertas y en su interior presenta xenolitos de gneises y anfibolitas inyectados por material leucocrático. El estudio radimétrico 40Ar/39Ar en muscovita del plutón Valcheta resultó en una edad de 470 ± 1,8 Ma. Estos datos permiten descartar la correlación de rocas leucogranitcas aflorantes al noroeste de Valcheta con el Granito Flores de edad jurásica. El plutón Valcheta presenta diferencias macroscópicas, petrográficas, microestructurales y composicionales con los intrusivos ordovícicos del Complejo Plutónico Punta Sierra, aflorante sobre la costa atlántica rionegrina. En consecuencia, la extensión del magmatismo ordovícico del este del Macizo Nordpatagónico hasta las inmediaciones de Valcheta debe ser revisada. La morfología, mineralogía, rasgos microestructurales y geoquímica del plutón Valcheta se comparan favorablemente con los leucogranitos del Complejo Mina Gonzalito que forman los plutones Tapera y María Teresa. El pico metamórfico de dicho complejo, según dataciones U-Pb en circones, es del Ordovícico medio (472 ± 5 Ma. El plutón Valcheta es composicionalmente semejante a leucogranitos post-colisionales tipo S formados en una corteza engrosada.NE trending leucogranites of the Valcheta pluton crop out west of Valcheta, between the

  13. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    where potassium-bearing phenocrysts may contain relatively small amounts of radiogenic 40Ar. In 2005, the Quaternary Dating Laboratory, Roskilde University, installed a Nu-Instruments multi-collector Noblesse noble gas mass spectrometer, which is configured with a Faraday detector and three ion......The recent availability of commercial high-resolution, multi-collector, noble gas mass spectrometers equipped with ion-counting electron multipliers provides new opportunities for improved precision in 40Ar/39Ar dating. This is particularly true for single crystal dating of Quaternary aged samples...... for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii...

  14. Precision angle-resolved autoionization resonances in Ar and Ne

    Energy Technology Data Exchange (ETDEWEB)

    Berrah, N.; Langer, B.; Gorczyca, T.W. [Western Michigan Univ., Kalamazoo, MI (United States)] [and others

    1997-04-01

    Theoretical work has shown that the electron angular distribution and the shape of the autoionization resonances are crucial to the understanding of certain types of electron-electron correlation. Autoionization resonances in Ne (Ar) result from the decay of the excited discrete state Ne{sup *} 2s2p{sup 6} np (Ar{sup *} 3s3p{sup 6} np) into the continuum state Ne{sup +} 2s{sup 2}2p{sup 5} + e{sup {minus}} (ks,kd) (Ar{sup +} 3s{sup 2}3p{sup 5} + e{sup {minus}} (ks,kd)). Since the continuum can also be reached by direct photoionization, both paths add coherently, giving rise to interferences that produce the characteristic Beutler-Fano line shape. In this work, the authors report on quantitative angle-resolved electron spectrometry studies of (a) the Ne 2s{sup 2}2p{sup 6} {r_arrow} 2s2p{sup 6} np (n=3-5) autoionizing resonances and the 2s{sup 2}2p{sup 6} {r_arrow} 2p{sup 4}3s3p doubly excited resonance, (b) the Ar 3s{sup 2}3p{sup 6} {r_arrow} 3s3p{sup 6} np (n=4-9) autoionization resonances and extended R-matrix calculations of the angular-distribution parameters for both Ne and Ar measurements. Their results are compared with previous theoretical work by Taylor.

  15. Experimental study on AR fiberglass connectors for bridges made of composite materials

    Directory of Open Access Journals (Sweden)

    Tolosana, N.

    2006-06-01

    Full Text Available One highly relevant aspect in composite material bridgedesing is the study of the shear connectors to be used.Composite material bridges most commonly comprise acomposite deck resting on steel or reinforced concrete girders.This article analyzes the connectors most frequentlyused in such bridges.It also reviews the connectors used in the King StormwaterChannel Bridge, whose fibreglass deck is supported bygirders made of concrete-filled carbon fibre girders.The paper advances proposals for several types of connectorsand discusses the results of push-out test run ona number of prototypes with different geometries.The results are analyzed to identify the optimum model forthe “Autovia del Cantabrico” Overpass, with its 46-m span,carbon fibre girders and AR glass shear connectors.Un aspecto relevante dentro del proyecto de un puenterealizado en materiales compuestos es el estudio de losconectores. El caso mas frecuente de puente en materialescompuestos es aquel que presenta un tablero de materialescompuestos soportado por vigas metalicas o de hormigonarmado. En este trabajo se analizaran los tipos deconectores mas utilizados en este tipo de puentesSe analizaran tambien los conectores utilizados en elKing Stormwater Channel Bridge, donde ademas deltablero en fibra de vidrio, se fabricaron las vigas en fibrasde carbono rellenas de hormigon.En este articulo se propondran varios tipos de conectoresy se presentaran los resultados experimentales correspondientesal ensayo de “push-out” de varios prototipos condiferentes geometrias.Tras evaluar los resultados, se determinara el mas idoneopara su implantacion en el Paso Superior de la Autovia delCantabrico, de 46 metros de luz y que presenta las vigasen fibra de carbono y los conectores de vidrio AR.

  16. toxicidad neuroendocrina inducida por cadmio

    Directory of Open Access Journals (Sweden)

    A Romero

    2008-01-01

    Full Text Available El cadmio es un agente químico tóxico importante debido a su creciente nivel en el medio ambiente como resultado de prácticas industriales y agrícolas. Como perturbador endocrino, el cadmio modifica la secreción de hormonas hipofisarias. Los efectos indirectos del cadmio provocan la generación de especies reactivas de oxígeno y reducen la actividad de las proteínas implicadas en las defensas antioxidantes. La melatonina es conocida como un potente antioxidante, scavenger de radicales libres y quelante de metales sintetizada en la glándula pineal. De esta manera, las acciones antioxidantes de esta indolamina protegen frente a la peroxidación lipídica y el daño oxidativo de los radicales y de sus productos tóxicos. Los trabajos recopilados en esta revisión ponen de manifiesto la capacidad antioxidante de la melatonina y, por lo tanto, su posible papel protector frente a la toxicidad del cadmio en lo que se refiere al estrés oxidativo y peroxidación lipídica inducidos por la exposición a este metal.

  17. Hipoglucemia inducida por carcinoma adrenal

    Directory of Open Access Journals (Sweden)

    Jimena Soutelo

    2013-08-01

    Full Text Available El carcinoma suprarrenal es una neoplasia maligna infrecuente y de mal pronóstico. La presentación clínica más común es originada por la producción hormonal excesiva, mientras que el desarrollo de hipoglucemia sintomática es excepcional. Presentamos el caso de una mujer de 37 años que ingresó al hospital por síntomas de hipoglucemias graves, hipertensión arterial, hipopotasemia y amenorrea secundaria. En el laboratorio se halló hipoglucemia con insulina inhibida y niveles de andrógenos en rango tumoral. La tomografía computarizada (TC de abdomen y pelvis mostró voluminosa formación heterogénea de aspecto sólido sin plano de clivaje con respecto al parénquima hepático e intenso realce con contraste. Luego de la extirpación de la masa retroperitoneal, evolucionó con valores de glucemia y potasemia normales, estabilizó la presión arterial y recuperó los ciclos menstruales.

  18. Evaluación de dos técnicas analíticas para la especiación de arsénico en aguas superficiales del sur del Perú

    Directory of Open Access Journals (Sweden)

    Manuel Chávez

    2009-01-01

    Full Text Available El arsénico es altamente tóxico, la exposición crónica a este elemento causa diversos daños en la salud de las personas, en el Perú se han reportado niveles elevados, sobre todo en ríos de la costa sur. Objetivo. Evaluar dos técnicas analíticas de especiación de las dos formas de arsénico inorgánico en agua fluvial de Tacna, en el sur del Perú. Materiales y métodos. Se desarrolló un estudio comparativo entre la técnica de separación por resina de intercambio aniónico y la cromatografía iónica para la especiación del arsénico (V y arsénico (III en muestras de agua de cuatro ríos de la vertiente del Pacífico en dos distritos de la región Tacna. La cantidad de arsénico total se determinó con el sistema de inyección de flujo asistido con absorción atómica. Resultados. Se obtuvo un buen grado de separación en ambos procedimientos, sin embargo, la técnica de resinas de intercambio aniónico tiene un límite de detección inferior que la cromatografía iónica, 2,0 μg/L y 32 μg/L, respectivamente. En cuatro de las seis muestras se obtuvieron valores superiores a los recomendados por la Agencia de Protección Ambiental de los Estados Unidos, y en ellas se logró determinar las cantidades de arsénico (III y arsénico (V. Conclusiones. La técnica de separación por resina de intercambio aniónico tiene mayor sensibilidad de detección de arsénico que la cromatografía iónica y permite un alto grado de especiación del arsénico inórganico en muestras de agua fluvial.

  19. Alkali-activated slag mortars reinforced with ar glassfibre. Performance and properties

    Directory of Open Access Journals (Sweden)

    Amat, T.

    2006-09-01

    Full Text Available In light of the practical problem posed by the high drying shrinkage rate exhibited by alkali-activated slag (AAS,due to these materials exhibited a high drying shrinkage the present study analyzes the behaviour of alkali-activated slag mortars reinforced with alkali-resistant (AR glass fiber especially designed to reduce drying shrink aging cementitious systems. To this end, both alkali-activated slag and reference Portland cement mortars were prepared, with and without AR fiber (in dosages ranging from 0 to 1.1% by weight of the binder. These mortars were subjected to the following tests: drying shrinkage,mechanical strength after 2, 7 and 28 days, toughness,and high temperature. The microstructure of the materials was also studied by SEM/EDX techniques. At a percentage of 0.22%, AR fiber was found to induce a significant reduction (over 20% in drying shrinkage, without detracting from the fine resistance strength, of alkali activated slag mortar. Moreover, plain activated slag mortars recovered 20% of their initial mechanical strength after exposure to high temperatures, and ins specimens reinforced with glass fiber at a rate of 0.22%,recovery climbed to 50%.El principal problema tecnológico de los cementos de escoria activada alcalinamente (AAS es su elevada retracción al secado. Por ello, en el presente trabajo se estudia el comportamiento de morteros de escoria activada alcalinamente reforzados con fibras de vidrio alcali-resistentes (AR, especialmente diseñadas para reducir la retracción al secado en sistema cementantes. Para ello se prepararon morteros de escoria activada alcalinamente y de cemento Portland como material de referencia. El porcentaje de fibra AR en los morteros varió entre 0-1,1% en peso de ligante. Los morteros preparados fueron sometidos a los siguientes ensayos:retracción al secado, resistencias mecánicas a 2, 7 y 28 días,ensayos de tenacidad, resistencia al impacto y comportamiento resistente frente a altas

  20. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Energy Technology Data Exchange (ETDEWEB)

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  1. ISEA reversed event in the Cretaceous Normal Superchron (CNS):40Ar/39Ar dating and paleomagnetic results

    Institute of Scientific and Technical Information of China (English)

    SHI Ruiping; HE Huaiyu; ZHU Rixiang; PAN Yongxin

    2004-01-01

    In order to provide the age for the ISEA (one reversed event in the CNS) a combined rock magnetic, paleomagnetic and geochronologic study has been conducted on two Cretaceous andesitic basalt lava flows from Sanbaoying, Liaoning Province of northeastern China. Rock magnetic investigations show that pseudo-single domain (PSD) titanomagnetite with poor-Ti content is the dominant magnetic mineral in Sanbaoying lava flows. Detailed systematic thermal demagnetization allowed us to isolate two remanence components after removing a low temperature component at 100℃/150℃; an intermediate temperature component with normal polarity at 150℃/200℃-380℃/400℃ and the characteristic remanence component (ChRM) with reversed polarity above 400℃/450℃. 40Ar/39Ar dating results show that Sanbaoying rocks were erupted at 116.0±0.3 Ma. Combination of paleomagnetic results and 40Ar/39Ar dating indicates that the reversed event recorded in Sanbaoying lavas corresponds to the ISEA event in the CNS. Our age determination for ISEA reversed event provides chronological evidence to study the relevance between global geological events that occurred in the CNS and geodynamo processes.

  2. A detailed 40Ar/39Ar age study of an Abitibi dike from the Canadian Superior Province

    International Nuclear Information System (INIS)

    40Ar/39Ar step-heating analyses were performed on 11 felsic and mafic mineral separates from a 90m wide Precambrian Shield. Deuterically altered minerals from the dike interior define a primary age of 2150 +- 25 Ma. Updated ages, obtained from felsic separates within 30, and mafic within 1.5 m of the dike border, are evidence of a previously undetected Hudsonian (1.7-1.8 Ga) hydrothermal event in the area. It is possible to distinguish the deuteric from the later hydrothermal alteration by both dating and petrographic methods. The data from this study demonstrate the successful application of 40Ar/39Ar dating to early Proterozoic dikes which have suffered low grade metamorphism. The ages support a north to south sense of motion of the Track 5 apparent polar wander path (APWP). A monotonic decrease in apparent age of felsic spectra indicates reactor induced recoil effects which are correlated with the fine-grained saussurite in the feldspar. (auth)

  3. 40Ar/39Ar ages and tectonic setting of ophiolite from the Neyriz area, southeast Zagros range, Iran

    International Nuclear Information System (INIS)

    An ophiolite, considered to be an allochthonous fragment of Tethyan oceanic crust and mantle, crops out near Neyriz in the Zagros Range, Iran. 40Ar/39Ar ages ranging from 76.8+-23.8 Ma to 105+-23.3 Ma were measured on hornblende from five samples of plagiogranite and diabase from the ophiolite. The most precise ages are 85.9+-3.8 Ma for a diabase and 83.6+-8.4 Ma for a plagiogranite. The weighted mean age of hornblende from the five samples is 87.5+-7.2 Ma which indicates that the igneous part of the Neyriz ophiolite formed during the early part of the Late Cretaceous. Pargasite from amphibolite below peridotite of the Neyriz ophiolite has a 40Ar/39Ar age of 94.9+-7.6 Ma. The pargasite age agrees within analytical uncertainty with the ages measured on diabase and plagiogranite. Comparable ages have been measured on igneous rocks from the Samail ophiolite of Oman and on amphibolite below peridotite of the Samail ophiolite. (orig.)

  4. Infrared spectroscopy of ArOH: A direct probe of the Ar+OH X2Π potential energy surface

    International Nuclear Information System (INIS)

    An infrared-ultraviolet (IR-UV) double-resonance technique has been implemented to obtain the infrared spectrum of ArOH in the vicinity of the fundamental OH stretch at 2.8 μm. A rotationally resolved spectrum of the fundamental OH stretching band of ArOH is observed at 3567.85(1) cm-1 (origin). A combination band, involving both OH stretch and intermolecular bending excitation, is identified at 3577.00(1) cm-1 (origin). The intermolecular energy of the excited bending state provides a direct measure of the anisotropy of the Ar+OH X2Π interaction potential. The rotational structure of the combination band reveals a large splitting between parity components with the same total angular momentum in the excited bending state [0.69(1) cm-1 for J=(3/2)]. The experimentally derived parity splitting is compared with previous experimental and theoretical determinations of this parameter. The parity splitting associated with the excited bending state reflects the change in the intermolecular potential when the pπ orbital containing the unpaired electron of OH lies in or out of the ArOH plane. (c) 2000 American Institute of Physics

  5. Classification of the Apollo-11 mare basalts according to /Ar-39/-/Ar-40/ ages and petrological properties

    International Nuclear Information System (INIS)

    Previously unpublished (Ar-39)-(Ar-40) ages and exposure ages are presented for Apollo 11 whole rocks and mineral separates. The age data for the Apollo 11 mare basalts in general are discussed in relation to their textural and petrological properties. The oldest rocks (10003, 10029) belong to the low-K group and crystallized at 3.90 + or - 0.03 AE. Three other low-K groups are defined in relation to the petrological classification of Beaty and Albee (1978) and to information on the rock crystallization ages, exposure ages and normative quartz contents. These groups have ages of 3.84 + or - 0.04 AE (10062), 3.75 + or - 0.03 AE (10050) and 3.72 + or - 0.04 AE (10044, 10047, 10058). The best defined (Ar-39)-(Ar-40) age for the high-K basalts is 3.62 + or - 0.05 AE (for mineral separates from 10072). At least four distinct, fairly thin flows of low-K basalt are believed to have been erupted over a 200-my period, followed by either one or several, as yet indistinguishable, very thin flows of high-K basalt. It is not possible to decide whether the earliest dated of the mare basalt eruptions at Mare Tranquillitatis pre-dated, post-dated, or were contemporary with the Imbrian impact event

  6. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Science.gov (United States)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  7. Geochemistry and 40Ar/39Ar age of Early Carboniferous dolerite sills in the southern Baltic Sea

    Directory of Open Access Journals (Sweden)

    Gediminas Motuza

    2015-08-01

    Full Text Available The Early Carboniferous magmatic event in the southern Baltic Sea is manifested by dolerite intrusions. The presumable area in which the dolerite intrusions occur ranges from 30 to 60 km in east–west direction, and is about 100 km in north–south direction. The dolerites were sampled in well D1-1 and investigated by applying chemical analysis and 40Ar/39Ar step-heating dating. Dolerites are classified as alkali and sodic, characterized by high TiO2 (3.92, 3.99 wt% and P2O5 (1.67, 1.77 wt% and low MgO (4.89, 4.91 wt% concentrations, enriched in light rare earth elements, originated from an enriched mantle magma source and emplaced in a continental rift tectonic setting. The 351 ± 11 Ma 40Ar/39Ar plateau age for groundmass plagioclase indicates a considerable age gap with the 310–250 Ma magmatism in southern Scandinavia and northern Germany. The magmatic rocks in the Baltic Sedimentary Basin are coeval with alkaline intrusions of NE Poland. Both magmatic provinces lie in the northwestward prolongation of the Pripyat–Dnieper–Donetsk Rift (370–359 Ma and may constitute a later phase of magmatic activity of this propagating rift system.

  8. Origin of the Mile Tilek Tuff, South Andaman: evidence from 40Ar-39Ar chronology and geochemistry

    International Nuclear Information System (INIS)

    The Mile Tilek Tuff is one of several consolidated volcanic ash deposits in the Andaman and Nicobar Islands that has preserved evidence of a large-scale volcanic eruption in Southeast Asia. Assumed to be of Mio-Pliocene age (∼ 25-2 Ma), the tuff was thought to have been generated by the Andaman-Indonesia volcanic arc. Little was known about its source volcano because of absence of critical isotope data. To provide accurate age information and determine its source, we dated the tuff by 40Ar-39Ar method and measured its trace element contents and Sr-Nd isotopic ratios. The 40Ar-39Ar plateau age for the whole rock is 0.73 ± 0.16 (2σ) Ma, which suggests that the tuff got deposited much later than previously believed. Chemically, the tuff possesses typical characteristics of subduction zone magmatism. Its Sr-Nd isotopic compositions (87Sr/86Sr = 0.7073 and εNd ≤ 0.9) suggest substantial continental crustal contamination of its source magma, which points to a source volcano in Sumatra. Based on available age information on large-scale volcanic eruptions in Indonesia, we speculate that the Ranau volcano in south Sumatra could have been the source of the Mile Tilek Tuff. (author)

  9. Avaliação e aperfeiçoamento das especificações técnicas em dispositivos de lipoaspiração não invasiva por ultra-sons

    OpenAIRE

    Paulo, Joana Margarida Ribeiro

    2011-01-01

    Desde sempre a mulher tentou alcançar o corpo perfeito, recorrendo a variados tratamentos e tecnologias para atingir tal fim. Um dos problemas que mais despoletou esta procura é a Lipodistrofia Ginoide (LG), popularmente conhecida por celulite. Um dos tratamentos que tem por vista colmatar este problema é a lipoaspiração, que remonta à década de 80, mas actualmente a lipoaspiração não invasiva por ultra-sons (LNIUS) caracteriza-se por ser o tratamento que melhores resultados alcança, em termo...

  10. Qualidade de maçãs 'Royal gala' submetidas ao dano mecânico por impacto e aplicação de 1-metilciclopropeno em dois sistemas comerciais de armazenamento

    OpenAIRE

    Marcos Vinicius Hendges; Cristiano André Steffens; Lucimara Rogéria Antoniolli; Cassandro Vidal Talamini do Amarante; Auri Brackmann

    2011-01-01

    O objetivo deste trabalho foi avaliar os efeitos do dano mecânico por impacto e da aplicação de 1-metilciclopropeno (1-MCP) sobre a qualidade de maçãs 'Royal Gala' mantidas em armazenamento refrigerado (AR) e em atmosfera controlada (AC). Os tratamentos avaliados foram dano mecânico (sem e com dano por impacto) combinado com a aplicação de 1-MCP (0 e 625 nL L-1). Os frutos foram armazenados durante quatro meses em armazenamento refrigerado (AR; 0 ºC ± 1 ºC e 92 ± 2 % de UR) (experimento 1) e ...

  11. 40Ar/39Ar impact ages and time-temperature argon diffusion history of the Bunburra Rockhole anomalous basaltic achondrite

    Science.gov (United States)

    Jourdan, Fred; Benedix, Gretchen; Eroglu, Ela.; Bland, Phil. A.; Bouvier, Audrey.

    2014-09-01

    The Bunburra Rockhole meteorite is a brecciated anomalous basaltic achondrite containing coarse-, medium- and fine-grained lithologies. Petrographic observations constrain the limited shock pressure to between ca. 10 GPa and 20 GPa. In this study, we carried out nine 40Ar/39Ar step-heating experiments on distinct single-grain fragments extracted from the coarse and fine lithologies. We obtained six plateau ages and three mini-plateau ages. These ages fall into two internally concordant populations with mean ages of 3640 ± 21 Ma (n = 7; P = 0.53) and 3544 ± 26 Ma (n = 2; P = 0.54), respectively. Based on these results, additional 40Ar/39Ar data of fusion crust fragments, argon diffusion modelling, and petrographic observations, we conclude that the principal components of the Bunburra Rockhole basaltic achondrite are from a melt rock formed at ∼3.64 Ga by a medium to large impact event. The data imply that this impact generated high enough energy to completely melt the basaltic target rock and reset the Ar systematics, but only partially reset the Pb-Pb age. We also conclude that a complete 40Ar∗ resetting of pyroxene and plagioclase at this time could not have been achieved at solid-state conditions. Comparison with a terrestrial analog (Lonar crater) shows that the time-temperature conditions required to melt basaltic target rocks upon impact are relatively easy to achieve. Ar data also suggest that a second medium-size impact event occurred on a neighbouring part of the same target rock at ∼3.54 Ga. Concordant low-temperature step ages of the nine aliquots suggest that, at ∼3.42 Ga, a third smaller impact excavated parts of the ∼3.64 Ga and ∼3.54 Ga melt rocks and brought the fragments together. The lack of significant impact activity after 3.5 Ga, as recorded by the Bunburra Rockhole suggests that (1) either the meteorite was ejected in a small secondary parent body where it resided untouched by large impacts, or (2) it was covered by a porous heat

  12. Mineralogy and Ar-39 - Ar-40 of an old pristine basalt: Thermal history of the HED parent body

    Science.gov (United States)

    Takeda, Hiroshi; Mori, Hiroshi; Bogard, Donald D.

    1994-01-01

    Previous investigations of mineral chemistry and Rb-Sr and Sm-Nd ages indicated that clast,84 from eucrite Yamato 75011 had preserved the pristine nature of its initial crystallization during an early stage of the HED parent body. Microscale mineralogy and Ar-39-Ar-40 ages of this clast, however, revealed local disturbance of microtextures and partially reset ages. This evidence suggests that, in addition to initial crystallization and rapid cooling, the Y75011,84 clast experienced shock deformation, reheating of short duration at higher temperature, and brecciation. These characteristics suggest two or more impact events. Fe-rich olivine filling fractures in pyroxene may have been introduced during the accompanying shock fracturing. The inferred Ar-39-Ar-40 degassing ages for Y75011 matrix and clast, 84 are 3.94 +/- 0.04 Ga and 3.98 +/- 0.03 Ga, respectively. The suggested degassing age for a clast from Y790020, believed to be paired with Y75011, is approximately 4.03 Ga, but could be younger. We consider it likely that all three samples experienced a common degassing event 3.95 +/- 0.05 Ga ago, but we cannot rule out two or more events spaced over a approximately 0.1 Ga interval. Higher temperature extractions of the two clast samples show significantly older apparent ages up to approximately 4.5 Ga and suggest that the time/temperature regime of this event was not sufficient to degas Ar totally. Most likely, the K-Ar ages were reset by thermal metamorphism associated with one or more impact events associated with shock fracturing, formation of Fe-rich olivine veins, and/or meteorite brecciation. The pyroxene annealing that commonly occurs in many eucrites is likely to be a much earlier process than the impact-produced textural changes and reset K-Ar ages observed in these meteorites. The existence of mineralogical and chronological evidence for metamorphism in an otherwise pristine eucrite suggests that the HED parent body experienced an extensive degree of

  13. I-Xe and 40Ar-39Ar dating of silicate from Weekeroo Station and Netschaevo IIE iron meteorites

    International Nuclear Information System (INIS)

    Silicate inclusions from two IIE iron meteorites were dated by the I-Xe and 40Ar-39Ar techniques. Weekeroo Station, a 'normal' IIE iron, shows no loss of radiogenic 40Ar at low temperature, and the well defined 40Ar-39Ar plateau yields an age of 4.54 +- 0.03 Byr. The xenon data define a good I-Xe correlation with an age of + 10.9 +- 0.5 Myr relative to Bjurbole. Despite its relatively young age, Weekeroo Station's (129Xe/132Xe)sub(trapped) ratio (= 0.84 +- 0.05) lies significantly below the solar value. Netschaevo silicate has a chondritic composition, unlike 'normal' IIE silicate which is more differentiated. Nevertheless Netschaevo gives a 40Ar-39Ar plateau-age of only 3.79 +- 0.03 Byr, with the xenon data failing to define an I-Xe isochron. Only irons from the IAB and IIE groups contain silicate inclusions, but these two groups differ in many other respects, mostly suggesting that IAB meteorites are more primitive. The I-Xe chronology supports this suggestion inasmuch as Weekeroo Station formed well after IAB silicates. The four silicate-bearing IIE irons which have now been dated can be subdivided into distinct pairs: Weekeroo Station and Colomera formed near the beginning of the solar system, while Netschaevo and Kodaikanal both formed only 3.8 Byr ago. A review of other properties of these meteorites generally supports this subdivision. This work underscores the complexity of the history of IIE meteorites; in particular, an adequate model must account for the formation of two IIE irons at 3.8 Byr without disturbing rare gases in Weekeroo Station. All formation models are quite speculative, but the one which seems best to fit the available evidence postulates two parent bodies: the 3.8 Byr old silicate formed on one parent body, all other IIE material resided in a separate body, and subsequent collision(s) mixed the young silicate with IIE metal. (author)

  14. Crater Retention Ages from (4) Vesta Matching Independent Ar-Ar Ages of HED Meteorites

    Science.gov (United States)

    Schmedemann, Nico; Kneissl, Thomas; Ivanov, Boris A.; Michael, Gregory G.; Neukum, Gerhard; Nathues, Andreas; Sierks, Holger; Wagner, Roland; Krohn, Katrin; Le Corre, Lucille; Reddy, Vishnu; Ruesch, Ottaviano; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

    2013-04-01

    .054/-0.087) Ga and 3.63 (+0.058/-0.096) Ga. We also find seismic (miniscule ejecta blanket from Rheasilvia) resurfacing events in the time frame of ~3.56 to ~3.59 Ga at several areas in the northern hemisphere, indicative for a major seismic activity probably connected to the Rheasilvia formation. An antipodal activity is also suggested by hydrocode modeling [9]. By summation of age probability curves of measurements we link to the Rheasilvia formation, we find 3.58 (+0.07/-0.12) Ga. Using a similar attempt we find 3.75 (+0.05/-0.21) Ga for the Veneneia formation. Both crater retention ages correspond within the error bars with prominent peaks of independent Ar-Ar ages of Vesta related HED meteorites [10]. Acknowledgement: This work has been supported by the German Space Agency (DLR) on behalf of the Federal Ministry of Economics and Technology, grants 50OW1101(NS,TK), 50QM1001 (GM) and 50OW1102 (OR,HH). References: [1] Russell et al. (2007): Advances in Space Research 40(2): pp193-201, 2007. [2] Neukum and Ivanov: In: Gehrels T (ed) "Hazards due to comets and asteroids". University of Arizona Press, Tucson, 359-416, 1994. [3] O'Brien and Greenberg (2005): Icarus 178(1): 179-212. [4] Nesvorny et al. (2009): Icarus 200(2): 698-701. [5] Ivanov (2001): Chronology and Evolution of Mars 96, 87-104, 2001. [6] Schmedemann et al. (2012): 43.LPSC, The Woodlands, #1659. [7] Morbidelli et al. (2003): Icarus 162, 328-336. [8] Marchi et al. (2012): Science 336, 690. [9] Bowling et al. (2012): 75th Annual Meeting of the Meteoritical Society, 2012, Cairns, Australia. Meteoritics and Planetary Science Supplement, id.5256. [10] Bogard, D. D. (2011): Chemie der Erde - Geochemistry, vol. 71, issue 3: 207-226.

  15. Un modelo de diálogo para diálogos orientados por la tarea

    OpenAIRE

    Zubizarreta Aizpuru, José Ramón

    1993-01-01

    En los sistemas de diálogo en lenguaje natural además de existir la necesidad de diseñar herramientas para la representación del conocimiento del dominio, existe también la obligación, de crear mecanismos que puedan contextualizar el enunciado generado por el locutor tratándolo en un nivel discursivo donde tanto las realizaciones precedentes como las expectativas generadas son tenidas en cuenta. Esta comunicación trata de proponer un mecanismo contextualizador de las intervenciones producidas...

  16. El enfoque por tareas: la pragmática llega a las aulas.

    OpenAIRE

    García Martínez, Gema María

    2012-01-01

    En este artículo se pretenden exponer las novedades del enfoque por tareas como evolución del método comunicativo y constructivista, analizar cómo se ha desarrollado a partir de los estudios pragmáticos y mostrar qué aplicaciones tiene en la enseñanza de segundas lenguas. Puesto que son mayores sus ventajas que sus inconvenientes, sería recomendable su inclusión en los planes de estudio dirigidos a enseñar lenguas.

  17. Gestión de recursos humanos por competencias en los proyectos de software

    OpenAIRE

    Jorge Soler; Margarita André; María G. Baldoquín

    2011-01-01

    Este trabajo tiene como objetivo contribuir a la implementación, en la industria de software, de la gestión de recursos humanos basado en el enfoque por competencias. Para ello, se realiza y fundamenta una propuesta de roles invariantes que participan tanto en proyectos de desarrollo como de implantación de software, y de competencias tanto técnicas como genéricas requeridas para desempeñar los roles propuestos. En el trabajo se fundamenta el uso del método Delphi y las variaciones requeridas...

  18. PROPUESTA INFORMÁTICA PARA SELECCIONAR PERSONAL POR COMPETENCIAS UTILIZANDO TÉCNICAS DE INTELIGENCIA ARTIFICIAL

    OpenAIRE

    Raúl Martínez Rodríguez; Alejandro Rosete Suárez; Yanet Arias Bravo

    2006-01-01

    La selección de personal por competencias es un tema muy reciente que esta cautivando a las empresas que quieren asegurarse de contar con el personal calificado y competente. Su objetivo es seleccionar al candidato más idóneo para desempeñar un cargo ocupacional específico, teniendo en cuenta su potencial y capacidad de adaptación; lo que precisa ser más coherentes y no simplistas en el trata...

  19. 40Ar/39Ar geochronology, paleomagnetism, and evolution of the Boring volcanic field, Oregon and Washington, USA

    Science.gov (United States)

    Fleck, Robert J.; Hagstrum, Jonathan T.; Calvert, Andrew T.; Evarts, Russell C.; Conrey, Richard M.

    2014-01-01

    The 40Ar/39Ar investigations of a large suite of fine-grained basaltic rocks of the Boring volcanic field (BVF), Oregon and Washington (USA), yielded two primary results. (1) Using age control from paleomagnetic polarity, stratigraphy, and available plateau ages, 40Ar/39Ar recoil model ages are defined that provide reliable age results in the absence of an age plateau, even in cases of significant Ar redistribution. (2) Grouping of eruptive ages either by period of activity or by composition defines a broadly northward progression of BVF volcanism during latest Pliocene and Pleistocene time that reflects rates consistent with regional plate movements. Based on the frequency distribution of measured ages, periods of greatest volcanic activity within the BVF occurred 2.7–2.2 Ma, 1.7–0.5 Ma, and 350–50 ka. Grouped by eruptive episode, geographic distributions of samples define a series of northeast-southwest–trending strips whose centers migrate from south-southeast to north-northwest at an average rate of 9.3 ± 1.6 mm/yr. Volcanic activity in the western part of the BVF migrated more rapidly than that to the east, causing trends of eruptive episodes to progress in an irregular, clockwise sense. The K2O and CaO values of dated samples exhibit well-defined temporal trends, decreasing and increasing, respectively, with age of eruption. Divided into two groups by K2O, the centers of these two distributions define a northward migration rate similar to that determined from eruptive age groups. This age and compositional migration rate of Boring volcanism is similar to the clockwise rotation rate of the Oregon Coast Range with respect to North America, and might reflect localized extension on the trailing edge of that rotating crustal block.

  20. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.