WorldWideScience

Sample records for aquecimento por ar

  1. Utilização de desperdícios (latas de refrigerante) na captação de Energia Solar para o aquecimento de ar

    OpenAIRE

    Galvão, Constança

    2013-01-01

    Esta dissertação tem o intuito de apresentar um protótipo construído por Jorge Lourenço, em Olhão, Algarve, permitindo desta forma promover pistas para a criação de um novo produto vocacionado para o aproveitamento de Energia Solar Térmica para o aquecimento de ar. Assim, será analisado um painel solar que produz Energia Solar Térmica construído com latas de refrigerante e alguns materiais básicos de construção. Além de apresentar uma forma simples de se construir um Painel Solar Térmic...

  2. Desenvolvimento e construção de fornalha para biomassa com sistema de aquecimento direto e indireto do ar = Development and construction of a furnace for biomass with system of direct and indirect air heating

    Directory of Open Access Journals (Sweden)

    Fernanda Augusta de Oliveira Melo

    2010-07-01

    Full Text Available Uma fornalha, com opção para aquecimento direto e indireto de ar, foiprojetada e construída para utilizar, como combustível complementar à lenha, biomassa particulada, resíduo agroindustrial abundante e desperdiçado em boa parte. No intuito de verificar o funcionamento da fornalha, na opção de aquecimento direto e indireto, foram realizados três testes preliminares utilizando somente lenha como combustível. Nestes testes, avaliaram-se as temperaturas do ar ambiente, do ar aquecido na saída da fornalha e depois do ventilador, fluxo de ar, poder calorífico inferior e eficiência térmica. Com os dados obtidos nos testes, nas opções de aquecimento direto e indireto de ar, a fornalha mostrou-se flexível na opção de aquecimento, de fácil construção e operação, não exigindo mão-de-obra qualificada.A furnace, with a system for direct and indirect air heating, was projected and constructed to use biomass, particulate biomass, abundant and largely wasted agroindustrial refuse, as complementary fuel to firewood. With the objective of verifying furnace operation, in the option of direct and indirect heating, three preliminaries tests were conducted using only firewood as fuel. In these tests, the following variables were monitored: room air temperature, heated air temperature at the exit of the furnace and after the fan; room air relative humidity; warm air flow; lower calorific power and thermal efficiency of the furnace. In the tests the results showed, for both direct and indirect air heating, the furnace was shown to be flexible in the heating option, of easy construction and operation, not requiring skilled labor.

  3. PEDOLOGIA BRASILEIRA NA ANTÁRTICA: A PESQUISA DE SOLOS AFETADOS POR PERMAFROST NO CENÁRIO DO AQUECIMENTO GLOBAL

    Directory of Open Access Journals (Sweden)

    Thiago Torres Costa Pereira

    2015-09-01

    Full Text Available A Antártica representa um ambiente peculiar para formação de solos e estudo de muitos de seus processos, sendo que alguns dos quais possuem características atípicas. Solos afetados por permafrost são encontrados nas regiões árticas e subárticas, em altas montanhas e nas regiões livres de gelo da Antártica, e abrangem cerca de 13 % da cobertura terrestre. Atualmente, é inegável a influência do permafrost sobre os recursos hídricos, propriedades do solo, e desenvolvimento de vegetação. Além destes, uma série de questões estão relacionadas às mudanças no balanço de carbono, em reflexo à degradação do permafrost pelo aumento de temperatura. As quatro maiores regiões da Criosferano mundo são: Antártica, Oceano Ártico, as neves extrapolares e os ambientes montanhosos bastante frios. Mudanças na Criosferaem resposta ao aquecimento global são prováveis de serem observadas inicialmente em zonas de transição, em torno das extremidades de geleiras e camadas de gelo, e em áreas de permafrost, ambientes que em contrapartida, influenciam, mesmo que indiretamente, todas as superfícies da Terra. O debate sobre a possibilidade da ocorrência de aumento da temperatura global causado pelos gases do efeito estufa despertou atenção de pesquisadores sobre o estado de equilíbrio das grandes massas de gelo e permafrost presentes na Antártica. Outros fatores importantes envolvem as interações que influenciam diretamente as relações tróficas e rotas de transferência de matéria e energia entre o oceano e as áreas costeiras na Antártica. Nestes locais, existe grande aporte de materiais orgânicos depositados por aves, com destaque para os pinguins, sendo a incorporação destes materiais orgânicos à matriz mineral do solo a principal influência na caracterização dos solos ornitogênicos. Diante destes fatos, foram iniciados em 2002 os estudos pedológicos pelo então Projeto Criossolos, atual NúcleoTerrantar. Os

  4. Estudo comparativo de sistemas em aquecimento

    OpenAIRE

    Castro, Inês Marques Costa Borges de

    2013-01-01

    O presente estudo pretende avaliar o desempenho energético e rentabilidade do uso de equipamento de climatização para o aquecimento ambiente de uma casa sénior, através de sistemas tradicionais de produção de água aquecida, como a caldeira e a tradicional bomba de calor, e um sistema apoiado num equipamento de produção solar térmico. Perante uma determinada arquitectura, foram calculados os caudais de ar novo, de forma a garantir a qualidade do ar interior, cumprindo os requisitos da actua...

  5. Software didático para modelagem do padrão de aquecimento dos tecidos irradiados por ultra-som fisioterapêutico Didactic software for modeling heating patterns in tissues irradiated by therapeutic ultrasound

    Directory of Open Access Journals (Sweden)

    LE Maggi

    2008-06-01

    Full Text Available INTRODUÇÃO: O ultra-som é um recurso bastante utilizado em Fisioterapia. Entretanto, a aplicação inadequada pode promover aquecimento insuficiente ou causar danos aos tecidos biológicos. Por isso, é importante que se conheçam os parâmetros ótimos para atingir a temperatura adequada, dentro dos limites seguros. A geração de calor é função dos parâmetros do equipamento e das propriedades físicas dos tecidos. Este trabalho apresentou um software que simula a variação da energia e da temperatura nos tecidos ao longo do tempo, permitindo ao usuário visualizar o padrão de aquecimento nos tecidos em função dos parâmetros. MATERIAIS E MÉTODOS: O software foi implementado com base na equação biotérmica, supondo quatro camadas (pele, gordura, músculo e osso, das quais o usuário pode alterar espessura e propriedades acústicas e térmicas. Pode-se também escolher intensidade, freqüência e tempo de aplicação. São apresentados gráficos com o percentual de energia absorvida ao longo da profundidade e a respectiva variação de temperatura por cada milímetro de tecido. RESULTADOS: Foram realizadas simulações exemplificando situações de interesse para a terapia, variando tempo de aplicação, espessura e freqüência do ultra-som. Podem ser observadas as diferenças do padrão de aquecimento, em especial nas fronteiras das interfaces. CONCLUSÕES: O software permitiu o estudo do aquecimento de tecidos biológicos por ultra-som e pode ser usado tanto para fins didáticos como para planejamento de doses de aquecimento, para ondas contínuas. Numa próxima etapa, pretende-se adequá-lo para estimar qual dose deve ser regulada no aparelho, para manter a temperatura desejada pelo tempo escolhido. Software disponível em: http://www.peb.ufrj.br/lus.htm.INTRODUCTION: Ultrasound is a resource commonly used in Physical Therapy. However, its inadequate application may produce insufficient heating or cause damage to biological

  6. Estudo do crescimento de nanofitas de céria dopada com gadolínio por sistema de aquecimento por micro-ondas

    Directory of Open Access Journals (Sweden)

    R. F. Gonçalves

    2013-09-01

    Full Text Available O óxido de cério (céria tem atraído atenção devido às suas importantes aplicações, como em células a combustível de óxido sólido, catalisadores de gases de exaustão de automóveis, catalisadores para a obtenção de hidrogênio, bloqueadores de raios ultravioleta, biomateriais, entre outros. Controlar os métodos de síntese da céria é de grande importância para explicar ou prever essas propriedades. Desta forma, o objetivo deste trabalho foi estudar o crescimento de nanofitas de óxido de cério em um sistema hidrotérmico assistido por micro-ondas, no qual 8 min foram obtidas nanofitas com comprimentos próximos a 330 nm, em 130 ºC e pressão de 3 atm. Os resultados colaboram para pesquisas em reformadores para obtenção de etanol e/ou anodos de células combustíveis de óxido sólido.

  7. Cinética de sinterização para sistemas à base de SnO2 por taxa de aquecimento constante Sintering kinetics for SnO2-based systems by constant heating rate

    Directory of Open Access Journals (Sweden)

    S. M. Tebcheran

    2003-04-01

    Full Text Available Cerâmicas densas de óxido de estanho são muito promissoras para aplicações tecnológicas como varistores e cadinhos de fusão de vidros corrosivos. Vários aditivos em pequenas concentrações podem ser usados como promotores de densificação desta cerâmica. No presente trabalho foram estudadas as cinéticas de sinterização do óxido de estanho, considerando o efeito de atmosfera de sinterização e da concentração de MnO2. Sistemas de SnO2-MnO2 foram preparados pelo método dos precursores poliméricos e os pós obtidos foram caracterizados por medidas de área de superfície específica (BET e por difração de raios X. Pós de SnO2 com concentrações variadas de MnO2 foram compactados de forma cilíndrica e sinterizados em dilatômetro com taxa de aquecimento constante e atmosferas controladas. Amostras sinterizadas foram caracterizadas por microscopia eletrônica de varredura. A influência da atmosfera (argônio, ar ou CO2 como também das concentrações de MnO2 na cinética de sinterização foram determinadas. Os dados cinéticos da retração linear foram analisados pelos modelos cinéticos para a fase inicial de sinterização (Woolfrey e Bannister como também para a sinterização global (Su e Johnson permitindo determinar a energia de ativação aparente. De acordo com a determinação da curva mestre de sinterização, a energia de ativação aparente de todo o processo de sinterização foi determinada bem como sua dependência com a atmosfera e concentrações de manganês. Baseado nestes valores e no expoente n, pode-se determinar, pela equação clássica de crescimento de grão, que o mecanismo de sinterização mais provável é de difusão por contorno de grão com redistribuição superficial controlando a cinética de sinterização.Dense tin oxide based ceramics are very promising for technological applications such as varistors and crucibles for melting very corrosive glasses. Several additives have been used

  8. Efeito da taxa de aquecimento na reversão da martensita induzida por deformação em um aço inoxidável austenítico do tipo ABNT 304 Influence of heating rate on the reversion of strain-induced martensite in AISI 304 austenitic stainless steel

    Directory of Open Access Journals (Sweden)

    Tiago Felipe de Abreu Santos

    2009-03-01

    Full Text Available Ensaios de tração foram realizados em corpos-de-prova de aço inoxidável austenítico, nas temperaturas de -50 e -10ºC e quantidades de deformação de 3 a 12%, com a finalidade de se obterem diferentes quantidades de fases martensíticas dos tipos e e a'. As martensitas induzidas por deformação foram caracterizadas quanto a sua morfologia, distribuição e quantidade por meio de análises metalográficas, dilatometria, e medidas com um detector de ferrita. As temperaturas de transformações reversas, ε→γ e α'→γ, foram determinadas por ensaios dilatométricos. A reversão das martensitas e e α' foi observada nas faixas de temperaturas de 50-200ºC e 500-800ºC, respectivamente. A taxa de aquecimento praticamente não influencia as temperaturas de reversão de ε→γ. A reversão da martensita α', ao contrário, mostrou-se dependente da taxa de aquecimento.Austenitic stainless steels specimens were deformed by tension from 0.03 to 0.12 of true strain at -50ºC and -10ºC, in order to obtain different volumetric fractions of e and α' strain induced martensites. The morphology, distribution and volumetric fractions of the strain induced martensites were characterized by metallography and dilatometry analysis and quantified by ferrite detector measurements. The reverse transformation temperatures of ε→γ and α'→γwere detected by dilatometry tests. The e and α' martensites reversion was observed in the temperature range of 50-200ºC and 500-800ºC, respectively. The heating rate did not influence the reversing of ε→α' temperatures but did affect the α'→γtransformation temperatures.

  9. Efeitos do resfriamento e aquecimento articular no desempenho funcional do ombro

    OpenAIRE

    Dayane de Oliveira Estevam; Marcelo Lima de Oliveira; Marcelo Lourenço da Silva; Leonardo César Carvalho; Daniel Ferreira Moreira Lobato

    2015-01-01

    INTRODUÇÃO: Um dos recursos mais utilizados na reabilitação de lesões musculoesqueléticas é a termoterapia por subtração de calor (crioterapia), enquanto a termoterapia por adição de calor é considerada o procedimento mais antigo de reabilitação física. Entretanto, há poucas evidências que tenham investigado os efeitos desses recursos sobre o desempenho de membros superiores. OBJETIVO: Comparar o efeito do resfriamento e do aquecimento articular sobre o desempenho funcional do membro superior...

  10. Controle de temperatura em intervenção cirúrgica abdominal convencional: comparação entre os métodos de aquecimento por condução e condução associada à convecção Control de temperatura en intervención quirúrgica abdominal convencional: comparación entre los métodos de calentamiento por conducción y conducción asociada a la convección Temperature control in conventional abdominal surgery: comparison between conductive and the association of conductive and convective warming

    Directory of Open Access Journals (Sweden)

    Marcelo Lacava Pagnocca

    2009-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Hipotermia intra-operatória é complicação frequente, favorecida por operação abdominal. A eficácia da associação dos métodos de aquecimento por condução e convecção na prevenção de hipotermia e seus efeitos no período de recuperação pós-operatória foram os objetivos deste estudo. MÉTODO: Quarenta e três pacientes de ambos os sexos de 18 a 88 anos de idade, submetidos à laparotomia xifopúbica sob anestesia geral e monitorização da temperatura esofágica, foram distribuídos de modo aleatório em dois grupos de aquecimento: COND (n = 24, com colchão de circulação de água a 37°C no dorso e COND + CONV (n = 19, com a mesma condição associada à manta de ar aquecido a 42°C sobre o tórax e membros superiores. Analisados peso, sexo, idade, duração da operação e anestesia, temperaturas na indução anestésica (Mi, horas consecutiva (M1, M2, final da operação (Mfo e anestesia (Mfa, entrada (Me-REC e saída (Ms-REC da recuperação pós-anestésica (SRPA, além das incidências de tremores e queixas de frio no pós-operatório. RESULTADOS: Os grupos foram semelhantes em todas as variáveis analisadas, exceto nas temperaturas em M2, M3, M4, Mfo e Mfa. O grupo COND reduziu a temperatura a partir da segunda hora da indução anestésica, mas o grupo COND + CONV só na quarta hora. Em COND, observou-se hipotermia na entrada e saída da SRPA. CONCLUSÕES: Associar métodos de aquecimento retardou a instalação e diminui a intensidade da hipotermia intra-operatória, mas não reduziu a incidência das queixas de frio e tremores.JUSTIFICATIVA Y OBJETIVOS: La Hipotermia intraoperatoria es una complicación frecuente, favorecida por la operación abdominal. La eficacia de la asociación de los métodos de calentamiento por conducción y convección en la prevención de hipotermia y sus efectos en el período de recuperación postoperatoria, fueron los objetivos de este estudio. M

  11. Desempenho produtivo e bioeconômico de frangos de corte criados em diferentes sistemas de aquecimento

    Directory of Open Access Journals (Sweden)

    Abreu Paulo Giovanni de

    2000-01-01

    Full Text Available RESUMO - Este experimento foi realizado em duas fases para estudar o efeito de diferentes sistemas de aquecimento em piso sobre os desempenhos produtivo e bioeconômico de frangos de corte. Um total de 500 pintos de um dia, 50% macho e 50% fêmea, em cada círculo de proteção, foi distribuído em um delineamento experimental em blocos casualizados, com sete tratamentos e quatro blocos. Os sistemas de aquecimento testados foram: placa de fibra de vidro sem cobertura de lona plástica; placa de fibra de vidro com cobertura de lona plástica; resistência embutida no piso sem cobertura de lona plástica; resistência embutida no piso com cobertura de lona plástica; placa de argamassa armada sem cobertura de lona plástica; placa de argamassa armada com cobertura de lona plástica; e campânula a gás. O aquecimento foi mantido por 21 dias, iniciando com a temperatura de 35ºC na primeira semana, com redução de 3ºC por semana. Peso vivo, ganho de peso, consumo de ração, conversão alimentar e mortalidade foram avaliados. Os consumos de energia elétrica e de gás foram registrados durante todo o período de aquecimento, para comparação de custos. O sistema de aquecimento placa de argamassa com cobertura de lona plástica foi o mais indicado, pois propiciou boas condições térmicas e maior margem bruta no final do período de criação.

  12. Efeitos do aquecimento e do alongamento na resposta neuromuscular dos isquiotibiais

    Directory of Open Access Journals (Sweden)

    João Felipe de Souza Nogueira

    2014-07-01

    Full Text Available INTRODUÇÃO: A preparação para a atividade esportiva frequentemente envolve aquecimento e/ou alongamento, no intuito de prevenir lesões e/ou melhorar o desempenho. No entanto, a maneira como essas práticas podem interferir nos mecanismos neuromusculares de controle articular não é clara. OBJETIVO: Analisar o efeito imediato do alongamento e do aquecimento, isolados ou associados, no tempo de latência muscular (TLM e na amplitude de ativação dos isquiotibiais, após perturbações repentinas da articulação do joelho. MÉTODOS: Sessenta voluntários do sexo feminino (média de idade de 22,3 ± 1,7 anos e IMC 21,4 ± 1,3 kg/cm2 foram divididas aleatoriamente em quatro grupos: (1 controle, (2 aquecimento, (3 alongamento, (4 aquecimento + alongamento. A atividade elétrica dos isquiotibiais foi captada por eletromiografia de superfície durante uma perturbação súbita do joelho. Um eletrogoniômetro detectou o início da variação angular, enquanto os eletrodos captaram o início e a amplitude da atividade muscular antes e após as intervenções. Como procedimento estatístico utilizou-se ANOVA two-way e post-hoc de Tukey, considerando-se como nível de significância p < 0,05. RESULTADOS: O TLM do bíceps femoral e do semitendíneo foi reduzido nos grupos 3 (p = 0,048 e 0,027, respectivamente e 4 (p = 0,026 e 0,039, respectivamente. Não houve alteração significativa da amplitude de ativação muscular nos grupos avaliados. CONCLUSÕES: Os dados do presente estudo sugerem que, embora não tenham sido observadas alterações na amplitude eletromiográfica, o alongamento passivo e estático, utilizado de forma isolada ou associado ao aquecimento, promoveu uma redução do TLM dos isquiotibiais. Essa redução pode vir a ser um fator de proteção de lesões musculares e articulares, após uma perturbação súbita, como as que ocorrem na prática desportiva.

  13. ANÁLISE DO DESEMPENHO TÉRMICO DE UM SISTEMA DE AQUECIMENTO SOLAR DE BAIXO CUSTO NA CIDADE DE MOSSORÓ (RN)

    OpenAIRE

    Fabiana Karla de Oliveira Martins Varella; Maria Izabel da Silva Guerra

    2014-01-01

    O presente trabalho estuda a possibilidade de instalação e utilização de um Sistema de Aquecimento Solar de Água Não Convencional e de Baixo Custo (SASncbc) na cidade de Mossoró/RN. Para isso, foi analisado o desempenho térmico de cada elemento que compõe o sistema de aquecimento solar separadamente, a fim de analisar o comportamento que os mesmos apresentaram na cidade em estudo. O SASncbc é composto por um coletor solar plano e um reservatório térmico, e o funcionamento desse sistema é real...

  14. Toxicidad y teratogénesis por arsénico en aguas en el pez cebra (Danio rerio)

    OpenAIRE

    F Prieto García; OA Báez Ramírez; W Scout; JC Gaytán Oyarzún; A Zúñiga Estrada

    2007-01-01

    El objetivo del trabajo fue estudiar los daños teratogénicos y la inducción de micronúcleos en células branquiales de peces cebra (Danio rerio) por presencia de arsénico en las aguas. Fueron mantenidos en aguas bicarbonatadas cálcicas magnésicas de un pozo de referencia y del pozo Zimapán 5, del Municipio Zimapán, Estado de Hidalgo, México. Este último, con un contenido de arsénico que varía de 0,395-0,630 mg/L. Para el estudio de genotoxicidad se evaluaron durante 180 dí...

  15. Toxicidad y teratogénesis por arsénico en aguas en el pez cebra (Danio rerio)

    OpenAIRE

    F Prieto García; OA Báez Ramírez; W Scout; JC Gaytán Oyarzún; A Zúñiga Estrada

    2007-01-01

    El objetivo del trabajo fue estudiar los daños teratogénicos y la inducción de micronúcleos en células branquiales de peces cebra (Danio rerio) por presencia de arsénico en las aguas. Fueron mantenidos en aguas bicarbonatadas cálcicas magnésicas de un pozo de referencia y del pozo “Zimapán 5”, del Municipio Zimapán, Estado de Hidalgo, México. Este último, con un contenido de arsénico que varía de 0,395-0,630 mg/L. Para el estudio de genotoxicidad se evaluaron durante 180 días en 3 tratamiento...

  16. Enseñar probabilidad en primaria y secundaria? ¿Para qué y por qué?

    OpenAIRE

    Jímenez, Liliana; Jimenez, Rafael

    2005-01-01

    Este trabajo va dirigido a maestros y profesores de matemática. En él se exponen algunas reflexiones sobre la necesidad de abordar, en nuestros días, los conceptos de incertidumbre y probabilidad en la educación primaria y secundaria. Además se proponen algunos modelos de ejercicios que los introducen, con algunos comentarios didácticos para orientar el proceso. Por otra parte, se trata de provocar más discusión acerca de la importancia de enseñar el tema de probabilidad a nivel tanto de secu...

  17. Efeitos do resfriamento e aquecimento articular no desempenho funcional do ombro

    Directory of Open Access Journals (Sweden)

    Dayane de Oliveira Estevam

    2015-06-01

    Full Text Available INTRODUÇÃO: Um dos recursos mais utilizados na reabilitação de lesões musculoesqueléticas é a termoterapia por subtração de calor (crioterapia, enquanto a termoterapia por adição de calor é considerada o procedimento mais antigo de reabilitação física. Entretanto, há poucas evidências que tenham investigado os efeitos desses recursos sobre o desempenho de membros superiores. OBJETIVO: Comparar o efeito do resfriamento e do aquecimento articular sobre o desempenho funcional do membro superior. MÉTODOS: Trinta e quatro voluntários (22,23 ± 2,17 anos; 22,39 ± 2,53 kg/m2, de ambos os sexos, foram divididos aleatoriamente em um dos três grupos: 1 grupo crioterapia GCR (n=10: submetidos ao resfriamento articular por compressas frias; 2 grupo termoterapia - GTE (n=10: submetidos ao aquecimento articular por ondas curtas e 3 grupo controle - GCO (n=14, não submetidos a qualquer intervenção. Os voluntários foram avaliados, pré e pós-intervenção, quanto ao desempenho funcional de membros superiores por meio dos testes de estabilidade da extremidade superior em cadeia cinética fechada (TEESCCF e das condições de equilíbrio em apoio bimanual sobre o baropodômetro. Ainda, os voluntários foram avaliados quanto ao desempenho funcional virtual por meio do jogo Mario Kart (Nintendo Wii (r . RESULTADOS: Houve melhora significativa nos valores pós-intervenção no TEESCCF para o GCR (p0,05. Entretanto, na condição de olhos fechados, houve piora de desempenho para GTE (p=0,04 e melhora de desempenho para o GCO (p=0,02. Não houve alteração significativa no desempenho funcional virtual para os três grupos (p>0,05. CONCLUSÃO: Embora não tenha favorecido o desempenho funcional em todos os testes reais e virtuais utilizados, o resfriamento articular foi mais efetivo que o aquecimento articular para manter o desempenho muscular do membro superior, especialmente nas condições de equilíbrio sobre membros superiores na condi

  18. Por que Melipona scutellaris (Hymenoptera, Apidae forrageia sob alta umidade relativa do ar?

    Directory of Open Access Journals (Sweden)

    Marília D. e Silva

    2011-06-01

    Full Text Available Há evidências de que a temperatura do ar e a umidade relativa afetam a atividade de voo de espécies de abelhas sociais Meliponini. Em particular, as espécies grandes do gênero Melipona Illiger, 1806 responderiam de maneira mais estreita à variação na umidade relativa. Neste estudo defende-se o argumento de que a umidade relativa seja uma variável de confusão. Nesta linha de argumentação, também foi analisado o papel da coleta de pólen sobre o ritmo diário de forrageio. A robusta Melipona scutellaris (Latreille, 1811 foi usada como modelo e a atividade diária de voo e de forrageio de pólen foi medida em 12 colônias (4 colônias/hábitat, em três tipos de hábitats, que variam principalmente quanto à pluviosidade, na área de distribuição natural desta espécie (Floresta Pluvial, Floresta Sazonal e Transição Floresta Tropical-Cerrados. A maioria da atividade de voo acontece durante a manhã. A atividade de forrageio das colônias foi mais elevada nas primeiras horas do alvorecer, quando a umidade relativa também era alta, frequentemente associada a picos de coleta de pólen. A atividade de voo decresceu abruptamente durante as temperaturas altas ao redor do meio dia. A relação da atividade de voo com a umidade relativa foi altamente significativa e linear, contrastando com a relação significativa e unimodal com a temperatura. Na relação com o forrageio de M. scutellaris, a umidade relativa se configura como uma variável contingente, em hábitats tropicais úmidos, considerando os padrões diários de variação do microclima e de forrageio de pólen. Este último padrão também sustenta a hipótese de partição temporal de fontes florais de pólen.

  19. Riesgos de los residuos de minería: intoxicación intencional en vacuno por arsénico inorgánico

    Directory of Open Access Journals (Sweden)

    F Soler Rodríguez

    2012-01-01

    Full Text Available Las intoxicaciones por arsénico en los animales domésticos han sido una de las principales causas de intoxicación, especialmente en el ganado vacuno, aunque han ido disminuyendo desde la prohibición de muchos de sus compuestos y actualmente son anecdóticas. En este trabajo se presenta un caso de intoxicación intencional en ganado vacuno ocurrido en una explotación de Barruecopardo (Salamanca. Siete vacas nodrizas se vieron afectadas, muriendo cuatro de ellas, con un cuadro caracterizado por apatía, postración, pérdida de apetito, intensas diarreas, normotermia y disnea. En la necropsia se observaron fenómenos congestivos y equimosis en corazón y aparato digestivo, y úlceras perforantes en la pared del abomaso. Ante la sospecha de una posible intoxicación por arsénico, se analizaron muestras de hígado y riñón encontrando unos niveles de 13,57 y 8,65 mg/kg respectivamente, que confirmaron el diagnóstico clínico inicial. Un polvo grisáceo, insoluble en agua, que contenía arsénico en una proporción del 65,24 % (652,4 x 103 mg/kg había sido depositado intencionadamente en el suelo donde se colocaba el alimento para el ganado. En el mismo cercado se produjo la muerte de 15 ovejas con un cuadro clínico similar. Este artículo resulta especialmente interesante debido a la ausencia de casos intencionados confirmados de intoxicación por arsénico en rumiantes. Se incide en la importancia del peligro de los residuos abandonados de minería cuando el arsénico es uno de los subproductos comerciales obtenidos.

  20. Uso de controlador PID como tecnologia eficiente em sistema de aquecimento de creche suína

    Directory of Open Access Journals (Sweden)

    Juliana de S. G. Barros

    2015-05-01

    Full Text Available O uso racional de energia elétrica em creches suínas pode ser viabilizado sem afetar o desempenho produtivo dos animais visando à sustentabilidade do setor razão por que o objetivo deste trabalho foi avaliar a eficiência de duas tecnologias de controle de temperatura em sistema de aquecimento resistivo em creche suína, no uso de energia elétrica e no ganho de peso dos leitões. Os sistemas avaliados foram: resistências elétricas suspensas com controle PID (proporcional, integral e derivativo e resistências elétricas suspensas com termostato. O experimento foi realizado durante o período de inverno, entre maio e setembro de 2013. Os critérios de comparação foram: consumo de energia elétrica (kWh, consumo específico (kWh kg-1, custo específico (R$ kg-1, indicador de eficiência elétrica no aquecimento, ganho de peso (kg e ganho de peso diário (kg d-1. O sistema de aquecimento com controlador PID, apesar de apresentar maior consumo médio, foi mais eficiente quanto ao uso de energia elétrica para produzir 1 kg de peso vivo (2,88 kWh kg-1, quanto ao custo específico (0,75 R$ kg-1 e quanto ao ganho de peso dos leitões (7,3 kg em comparação com o sistema com termostato (3,98 kWh kg-1, 1,03 R$ kg-1 e 5,2 kg, respectivamente.

  1. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  2. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    OpenAIRE

    Francisco Prieto García; María de Los Ángeles Lechuga Vargas; María Aurora Méndez Marzo; Enrique Barrado Esteban; Juan Carlos Ggaytán Oyarzún

    2006-01-01

    Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS), mediante generador de hidruros (GH). En este estudio se utilizó el Vicia faba como un bioensayo para evaluar...

  3. Daños tóxicos en tejidos vegetales, producidos por aguas contaminadas con arsénico en Zimapán, Hidalgo, México Danos tóxicos em tecidos vegetais, produzidos por águas contaminadas com arsênio em Zimapán, Hidalgo, México

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    2006-03-01

    Full Text Available Según estudios realizados en el periodo de 1992-1998 en las aguas de los pozos, norias y manantiales, del municipio de Zimapán, Estado de Hidalgo, México, se corroboró que existía un incremento en el contenido de arsénico rebasando los límites máximos permisibles por la Norma Oficial Mexicana. La determinación de arsénico en las muestras de aguas se realizó por absorción atómica (AAS, mediante generador de hidruros (GH. En este estudio se utilizó el Vicia faba como un bioensayo para evaluar el daño genotóxico con la prueba de inducción de micronúcleos por exposición al agua de Zimapán, contaminada con As en células de raíces. Se utilizó como ensayo de control un agua de pozo de similares características del municipio de Pachuca, pero con contenidos de As por debajo de los límites de detección. Los resultados mostraron que el agua de esta región presenta altas concentraciones de arsénico y que puede provocar efectos genotóxicos que se manifiestan por la inducción de micronúcleos en las células meristemáticas de raíces de tejidos vegetales sensible.Estudos feitos no período de 1992-1998 nas águas dos poços da municipalidade de Zimapán, estado do Hidalgo, México, demostram o aumento na concentração de arsênio ultrapassando os limites máximos permissíveis pela norma oficial mexicana. A determinação de arsênio nas amostras de água foi feita por absorção atômica (AA, por meio do gerador de hidruros (GH. Neste estudo, o Vicia faba foi usado como bioensaio para avaliar os danos genotóxicos com o teste da indução dos micronúcleos pela exposição à água de Zimapán, contaminada com arsênio em células de raízes. Como controle, foi usada uma água com similares características, do município de Pachuca, mas com índices abaixo dos limites de detecção. Os resultados mostraram que a água desta região apresenta altas concentrações de arsênico e que os efeitos genotóxicos manifestam-se pela

  4. Secagem de café cereja descascado por ar quente e microondas Drying pulped coffee cherry beans by means of hot air ond microwaves

    Directory of Open Access Journals (Sweden)

    M.L. Cunha

    2003-12-01

    Full Text Available Este trabalho objetivou estudar a viabilidade de produzir café cereja descascado seco pela aplicação de microondas para assistir a secagem convencional a ar quente, a fim de reduzir o tempo de processo, com o aumento do rendimento industrial e da qualidade do produto perante os métodos tradicionais de secagem. Dois ciclos de secagem foram testados: a processo em secador rotativo convencional a ar quente, com umidade do produto reduzida de 45-50 a 11-13% b.u.; b processo subdividido em uma primeira etapa de pré-secagem convencional a ar quente de 45-50 a 30% b.u., seguida de etapa de secagem final por ar quente e microondas, com redução de 30 a 11-13% b.u. de umidade do produto. O tempo global do primeiro para o segundo ciclo de secagem foi reduzido de 15 a 37,5 para pouco mais de 10 horas, respectivamente. A qualidade sensorial do produto foi avaliada pela "prova da xícara", complementada por análises de microscopia eletrônica de varredura (MEV, com resultados satisfatórios. Um estudo preliminar dos aspectos econômicos envolvidos na ampliação de escala para uma linha industrial de processamento de café com a inclusão de um sistema a microondas foi também delineado.This research concerns a process development study focussing the application of microwaves to pulped coffee cherries production, in order to reduce the drying time and increase the industrial yield and product quality when compared to conventional drying processes. Two drying cycles were tested: a a hot air drying process using a conventional batch rotary dryer from 45-50 to 11-13% w.b. product moisture; b a two stage process, whereby the product was pre dried with hot air from 45-50 to 30% w.b., followed by a final microwave and hot air drying stage, to reduce product moisture from 30 to 11-13% w.b. The overall drying time was reduced from 15 to 37.5 hours to about 10 hours, respectively. The sensory quality of the product was evaluated by the "cup test", complemented

  5. Por Quê Dançar Na Escola Em Uma Época De Crise?

    Directory of Open Access Journals (Sweden)

    Débora Barreto

    2009-12-01

    Full Text Available De um modo geral, na maioria das academias, a dança tem sido ensinada de forma a se dicotomizar corpo e mente, valorizando apenas a técnica e a alta performance (as "ninfas" e "sílfides" virtuosas e estimulando a "ego-ação" do dançarino. No entanto, com base em autores como TAYLOR, BABIN, FREIRE e outros, pode-se pensar o ensino da dança como um "diálogo de corpos", no qual corpo e mente, conhecimento intuitivo e racional, sejam integrados, respeitando-se, assim, a liberdade de cada indivíduo de refletir criticamente sabre o significado da arte de dançar.

  6. Contaminación por Arsénico en Acuíferos de Catalunya (España)

    OpenAIRE

    Ventura Houle, René

    2015-01-01

    El arsénico (As) es una de las 10 sustancias químicas que la Organización Mundial de la Salud (OMS) considera más preocupantes para la salud pública y además es uno de los elementos más tóxicos que pueden ser encontrados en el medio ambiente, es carcinogénico, genera alteraciones en el sistema digestivo e inmunológico, entre otras afecciones. Debido a los procesos naturales de interacción en la geoquímica de las aguas subterráneas, estas son proclives a presentar concentraciones de As de...

  7. PLATA Y CASTAÑAR (VILLAVERDE, MADRID. UN EJEMPLO DE INTERVENCIONES EN EL BORDE DE LA CIUDAD. URBANISMO POR Y PARA EL REALOJO

    Directory of Open Access Journals (Sweden)

    Antonio J. Palacios García

    2009-01-01

    Full Text Available En las ciudades españolas todavía persisten un buen número de áreas que presentan una serie de carencias urbanísticas, sociales, económicas, ambientales u otras. Es lo que se conoce como barrios desfavorecidos urbanos. Para esta aportación se analiza el caso de una zona del sur metropolitano madrileño como es la de Plata y Castañar. En dicho barrio vamos a tratar de desentrañar el proceso de sustitución y creación de la edificación existente, los problemas acontecidos durante el desarrollo de la intervención, sus dificultades y las herramientas empleadas. Un área donde se ha intervenido frente al desfavorecimiento de forma sectorial, sobre un único elemento, el espacio construido. Aún a costa de la persistencia en el tiempo de otras graves carencias (fundamentalmente de tipo social. Una forma de intervenir muy criticada por cuanto supone la agrupación en un mismo territorio de una población desfavorecida.

  8. Sistema de aquecimento solar das piscinas da C. M. de Penacova e respectivas I. S.

    OpenAIRE

    Oliveira, Mário Jorge Simões

    2014-01-01

    Apesar dos sucessivos programas de apoio que têm vindo a ser disponibilizados para a instalação de sistemas de aquecimento solar, muitas piscinas municipais aquecidas não possuem este tipo de aproveitamento de energia solar. Assim sendo, verificam-se elevados custos de exploração, resultantes, em grande parte, de exagerados consumos de energia. Estes gastos podem ser minimizados com a adoção de diversas medidas de redução energética, nomeadamente a inclusão de um sistema de aquecimento solar,...

  9. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    Directory of Open Access Journals (Sweden)

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  10. Aquecimento global: efeitos no crescimento, no desenvolvimento e na produtividade de batata Global warming: effects on growth, development, and yield of potato

    Directory of Open Access Journals (Sweden)

    Joelma Dutra Fagundes

    2010-06-01

    Full Text Available A concentração atmosférica dos gases do efeito estufa, principalmente o CO2, tem aumentado nas últimas décadas devido às atividades antrópicas. A concentração de CO2 aumentou de aproximadamente 280 partes por milhão por volume (ppmv no período pré-industrial para a atual concentração de 380 ppmv. Há registros que, durante o século XX, houve um aumento da temperatura média da superfície global de 0,6±(0,2°C, e projeções indicam um provável aumento de 1,1 a 6,4°C na temperatura média global até o final do século XXI, dependendo da região do planeta. O aumento da concentração de CO2 e da temperatura afeta diretamente processos fisiológicos, como fotossíntese e respiração das plantas, o que poderá alterar o desempenho das culturas, incluindo a batata. O objetivo desta revisão foi reunir informações da literatura sobre os possíveis efeitos do aumento na concentração de CO2 e da temperatura do ar no crescimento, no desenvolvimento e na produtividade da cultura de batata. O aumento do CO2, seguido de aumento na temperatura do ar, de maneira geral, resultará em menor crescimento, redução na duração do ciclo de desenvolvimento, menor produtividade e aumento da incidência de doenças da batata. Como estratégia para minimizar os efeitos de um possível aquecimento global sobre essa cultura, sugere-se que sejam desenvolvidas cultivares tolerantes a altas temperaturas, adaptadas as épocas de plantio em cada local, alteradas as práticas de manejo da cultura e até expandidas as áreas de cultivo para regiões mais frias.The concentration of atmospheric greenhouse gases, mainly the CO2, has increased in the last decades due to anthropogenic activities. The atmospheric CO2 concentration has increased from about 280 parts per million per volume (ppmv in the pre-industrial period to the currently 380ppmv concentration. There are reports that during the XX century global average temperature increased 0.6±(0.2

  11. Comportamento de três hortaliças de fruto submetidas ao aquecimento intermitente durante a frigoconservação Behavior of three vegetable fruits submitted to intermittent warming during cold storage

    Directory of Open Access Journals (Sweden)

    R.A. KLUGE

    1998-01-01

    Full Text Available Efeitos do aquecimento intermitente foram estudados em berinjelas, pimentões e quiabos refrigerados. Berinjelas `Piracicaba F-100' foram continuamente refrigeradas por 21 dias ou aquecidas a cada 3, 4, 5 ou 6 dias. Pimentões `Maiata' foram continuamente refrigerados por 28 dias ou aquecidos a cada 5, 6, 7 ou 8 dias. Quiabos `Santa Cruz-47' foram continuamente refrigerados por 8 dias, ou aquecidos aos 2, 3, 4 ou 5 dias. O armazenamento foi realizado à 5ºC e 90-95% UR. O aquecimento foi realizado por 24 horas à 24-25ºC e 70-75% UR (condições ambientais. O aquecimento intermitente reduziu os sintomas de injúrias pelo frio, mas provocou elevadas perdas de massa em muitos tratamentos, causando murchamento e reduzindo a comerciabilidade dos frutos após a refrigeração, principalmente em quiabos e pimentões.Effects of intermittent warming were evaluated for cold stored eggplant, pepper and okra fruits. Eggplant fruits cv. Piracicaba F-100 were continuously cold stored for 21 days or submitted to warming each 3, 4, 5 or 6 days. Pepper fruits cv. Maiata were continuously cold stored for 28 days or submitted to warming each 5, 6, 7 or 8 days. Okra pods cv. Santa Cruz-47 were continuously cold stored for 8 days or submitted to warming after 2, 3, 4 or 5 days. The cold storage temperature was 5ºC and 90-95% RH. The warming temperature was 24-25ºC and 70-75% RH (room temperature, for 24 hs. The intermittent warming reduced chilling injury in fruits, however, caused high mass loss and shriveling in most treatments. This reduced fruit marketability, mainly in okra and pepper fruits.

  12. Dimensões psicológicas do aquecimento global conforme a visão de adolescentes brasileiros

    Directory of Open Access Journals (Sweden)

    Hellen Chrystianne Lucio Barros

    2013-06-01

    Full Text Available Evidências científicas sugerem o envolvimento das ações humanas nas mudanças climáticas globais (MCGs - seja como intensificadoras, mitigadoras ou adaptadoras diante dos seus efeitos - situação que evidencia a relevância de se investigar os aspectos psicológicos envolvidos no tema. O objetivo deste estudo foi investigar a visão de adolescentes sobre o aquecimento global (AG, que é uma parte importante das MCGs. Participaram 323 estudantes do Ensino Fundamental e Médio, sendo 202 garotas e 121 rapazes, com idades entre 12 e 19 anos, e média de 15 anos, que responderam a um questionário, contendo uma pergunta aberta sobre AG. Evidenciou-se que o conhecimento do assunto é superficial; os estudantes o percebem como um problema ambiental genérico, e o confundem com outros problemas, como a poluição. A cadeia interdependente de fenômenos relacionados às MCGs, como os gases do efeito estufa, foi mencionada por raríssimos participantes, assim como as implicações locais do problema.

  13. Aviary heating: control of air temperature heated by a set biomass gasifier-combustor in a co-current flow, using a frequency inverter; Aquecimento de aviarios: controle da temperatura do ar aquecido por um conjunto gaseificador-combustor de biomassa de fluxo concorrente, utilizando um inversor de frequencia

    Energy Technology Data Exchange (ETDEWEB)

    Santos, William Rosario dos [Universidade Presidente Antonio Carlos (UNIPAC), Ponte Nova, MG (Brazil); Silva, Jadir Nogueira; Oliveira Filho, Delly; Martins, Marcio Aredes; Oliveira, Jofran Luiz de [Universidade Federal de Vicosa (UFV), MG (Brazil)], Emails: jadir@ufv.br, delly@ufv.br, aredes@ufv.br, jofran.oliveira@ufv.br

    2009-07-01

    One of the problems with using the gasifier for heating purposes in poultry facilities is the waste of energy during the day, once the equipment does not have control of the thermal and power generated. During this period, the difference in temperature between the air and the standard for the birds inside the building is lower than when compared with the nocturnal period. During the day, the temperature inside the poultry house is controlled by curtains, which occurs without diminishing the biomass burning. Another way to control the temperature is the shutdown of the system, which requires the constant attention of the operator. In this way, there is a potential for energy savings if the thermal power could be controlled according to the demand, which can be represented by the temperature gradient. The purpose of this study was to control the temperature of exhaustion air from a set combustor-gasifier (down draft), based on the model developed by Martin et al. (2006), through the control of speed of the fan engine and also controlling the flow contributions of primary and secondary air in the combustor. The experiment was carried out in the Energy and Pre-processing of Agricultural Products areas, at the Department of Agricultural Engineering - Federal University of Vicosa. (author)

  14. Há risco de êmbolos durante a infusão com o uso de aquecedores com linhas de aquecimento de sangue e líquidos?

    Directory of Open Access Journals (Sweden)

    Yüksel Erkin

    2013-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Os aquecedores de sangue e de líquidos que aquecem em linha são amplamente usados por causa do baixo custo, do uso prático e porque não dependem de equipamentos. Nosso objetivo foi investigar a formação de bolhas em dois aquecedores tipo linha com duas formas de aquecimento diferentes. MATERIAIS E MÉTODOS: Dois grupos foram designados às marcas de aquecedores de sangue e líquidos: S-line e Astoflo®. Com o uso de 10 conjuntos de soro para cada grupo (n = 20, 1.000 mL de solução NaCl a 9% foram infundidos a 350 mL.hora-1 durante uma hora na sala de operação. As seguintes temperaturas foram mensuradas: das partes proximal, intermediária e distal das linhas; do ambiente de ensaio; do líquido usado e do líquido ao atingir a cânula após o aquecimento. O tempo para a formação visível de bolhas foi registrado. Os achados foram estatisticamente comparados com o uso do teste-U de Mann-Whitney. RESULTADOS: Não houve diferença entre os grupos em relação às temperaturas proximal, intermediária e distal das partes das linhas; do ambiente do estudo; do líquido usado e do líquido ao atingir a cânula (p > 0,05. Bolhas foram observadas nos dois aquecedores e o tempo para a formação de bolhas foi semelhante nos dois grupos de estudo (p = 0,143. CONCLUSÕES: No cenário experimental, criamos condições semelhantes ao nosso ambiente clínico. Ambos os tipos de aquecedores forneceram níveis de aquecimento semelhantes e formaram bolhas visíveis. Considerando que uma pequena quantidade de êmbolos pode ser fatal em bebês e crianças, a formação de bolhas deve ser seriamente considerada em caso de êmbolos e estudos adicionais devem ser feitos para determinar a quantidade, as razões e os conteúdos da formação de bolhas.

  15. Impact of global warming on beef cattle production cost in Brazil Impacto do aquecimento global no custo de produção de carne bovina no Brasil

    Directory of Open Access Journals (Sweden)

    Irenilza de Alencar Nääs

    2010-02-01

    decréscimo da capacidade de pastagens (RP em função das mudanças no índice pluviométrico total, na temperatura do ar e na extensão da estação de seca; e (ii o desenvolvimento de um algoritmo para predição do decréscimo da produção em função de um modelo fuzzy de RP que resulte no impacto na produtividade bovina de corte e conseqüente aumento no custo de produção. Foram organizados os dados históricos de fatores ambientais dos municípios importante produção no Cerrado e um conjunto de funções Gaussianas fuzzy foi desenvolvido e três estimativas possíveis (otimista, média e negativa foram consideradas. O decréscimo na produtividade do gado foi estimado usando as perdas de produção devido ao acréscimo da temperatura bem como da vulnerabilidade da capacidade de pastagem. O estabelecimento dos limites para o cenário do acréscimo do custo de produção usou o número de unidade animal por área de pastagem, a adoção de suplemento de grãos e o cenário de produção futura; e o resultado da função de saída apontou para uma variação do acréscimo do custo de produção de 80% (otimista até 160% (pessimista. Sob o cenário otimista, o custo total da produção brasileira de carne bovina no Cerrado chega a US$ 2,88 kg-1, enquanto no cenário pessimista este custo pode atingir US$ 4,16 kg-1, o que pode comprometer a competitividade internacional do setor.

  16. Metodología para diseñar un producto alimenticio por medio de la identificación de los factores que influyen en la decisión de compra

    OpenAIRE

    Pedro Vargas Aguilar; Elba Cubero Castillo; Arie Lang Gutowski

    2014-01-01

    Se desarrolló una metodología para identificar los factores que influyen en la decisión de compra de un producto alimenticio con la cual la información obtenida se utiliza para diseñar y reproducir productos de alta gama de consumo. Inicialmente se definieron los parámetros que se evaluarán para establecer la metodología, y se estudió su efectividad en una salsa de tomate de corte popular. Por medio de encuestas, en los restaurantes de comida rápida se determinó la relación existente entre el...

  17. Treatment of Bothrops alternatus envenomation by Curcuma longa and Calendula officinalis extracts and ar-turmerone Tratamento local do envenenamento por Bothrops alternatus com extrato de Curcuma longa e Calendula officinalis e ar-turmerone

    Directory of Open Access Journals (Sweden)

    M.M. Melo

    2005-02-01

    Full Text Available It was investigated the efficiency of two extracts of plants and one fraction of their properties against the local effects of bothropic envenomation. Bothrops alternatus venom (1.25µg diluted in 100µl of sterile saline solution was inoculated (intradermally into the shaved dorsal back skin of 30 New Zealand rabbits. The animals were divided in six groups receiving the following treatments: group I: subcutaneous application of Curcuma longa extract (1.0ml; group II: topic treatment of Curcuma longa hydroalcoholic extract (1.0ml; group III: topic application of ar-turmerone in vaseline (1.0g; group IV: topic application of Curcuma longa methanolic extract (1.0ml; group V: topic application of Calendula officinalis ointment (1.0g; group VI: topic application of saline (1.0ml. These treatments were done at 30 minutes, and at 2, 4, 24 and 72 hours after venom inoculation. Intensity of local edema, hemorrhagic halo and necrosis were evaluated until 168h after that. Additionally, seven days after the Bothrops venom inoculation, blood was collected from heart with and without EDTA (10% for hemogram and biochemical parameters (total protein, blood urea nitrogen, creatinine, and fibrinogen and all the animals were anesthetized, sacrificed by ether inhalation and submitted to necropsy. Fragments of tissues were taken for histopathological evaluation. The most efficient treatment for inhibition of edema, necrosis and local hemorrhage after Bothrops alternatus venom was the topic application of ar-turmerone.Investigou-se a eficácia do extrato de plantas no tratamento local do envenenamento botrópico. Veneno de serpentes Bothrops alternatus (1,25µg diluído em 100µl de solução salina estéril foi inoculado (via intradérmica entre as escápulas de 30 coelhos. Os animais foram divididos em seis grupos (tratamentos: grupo I: tratamento subcutâneo com extrato de Curcuma longa; grupo II: tratamento tópico com extrato hidroalcoólico de Curcuma longa

  18. Behavior of Eucalyptus grandis and E. cloeziana seedlings grown in arsenic-contaminated soil Comportamento de mudas de E. grandis E. eucalyptus cloeziana cultivadas em solo contaminado por arsênio

    Directory of Open Access Journals (Sweden)

    Roseli Freire Melo

    2010-06-01

    Full Text Available Arsenic has been considered the most poisonous inorganic soil pollutant to living creatures. For this reason, the interest in phytoremediation species has been increasing in the last years. Particularly for the State of Minas Gerais, where areas of former mining activities are prone to the occurrence of acid drainage, the demand is great for suitable species to be used in the revegetation and "cleaning" of As-polluted areas. This study was carried out to evaluate the potential of seedlings of Eucalyptus grandis (Hill Maiden and E. cloeziana F. Muell, for phytoremediation of As-polluted soils. Soil samples were incubated for a period of 15 days with different As (Na2HAsO4 doses (0, 50, 100, 200, and 400 mg dm-3. After 30 days of exposure the basal leaves of E. cloeziana plants exhibited purple spots with interveinal chlorosis, followed by necrosis and death of the apical bud at the 400 mg dm-3 dose. Increasing As doses in the soil reduced root and shoot dry matter, plant height and diameter in both species, although the reduction was more pronounced in E. cloeziana plants. In both species, As concentrations were highest in the root system; the highest root concentration was found in E. cloeziana plants (305.7 mg kg-1 resulting from a dose of 400 mg dm-3. The highest As accumulation was observed in E. grandis plants, which was confirmed as a species with potential for As phytoextraction, tending to accumulate As in the root system and stem.O arsênio (As tem sido considerado o poluente inorgânico de solo mais tóxico para os seres vivos, razão pela qual o interesse por espécies indicadoras e fitorremediadoras tem aumentado nos últimos anos. Particularmente para o Estado de Minas Gerais, que apresenta áreas remanescentes de atividade mineradora sujeitas à ocorrência de drenagem ácida, existe grande demanda por espécies com potencial para serem utilizadas na revegetação e "limpeza" de substratos contaminados por esse metaloide. Este

  19. Eliminación de arsénico mediante flotación por adsorción coloidal utilizando flóculos de Fe(OH3 en un sistema de flotación por aire disuelto

    Directory of Open Access Journals (Sweden)

    Pavez, O.

    2009-04-01

    Full Text Available In the present work, the influence of Fe/As ratio on the As removal, from aqueous solutions, applying flotation by colloidal adsorption was studied. Ferric chloride was used as coagulant and dodecil sulfate as collector, and arsenic trioxide was utilized to preparing the solutions. The obtained results show that the highest arsenic removal was accomplished in the range of pH between 4 and 5,5, and the increasing of the initial concentration of Fe(III, increases the removal of arsenic from the solution. However, with the decreasing of the initial concentration of arsenic in the solution, it is required a larger Fe/As ratio for its removal. For solutions containing: 13,73, 1,71 and 0,105 mg/L of arsenic, it was shown that to remove around 95% of the dissolved arsenic, a Fe/As ratios of approximately 6/1, 18/1 and 800/1, respectively, are required.

    En el presente trabajo se estudió el efecto de la relación Fe/As sobre la eliminación de arsénico aplicando flotación por adsorción coloidal en aguas con distintos contenidos de arsénico. Como coagulante se utilizó cloruro férrico y dodecil sulfato de sodio como colector, y las soluciones fueron preparadas con trióxido de arsénico. Los resultados obtenidos muestran que el rango de pH 4-5,5 es el más adecuado para la eliminación de arsénico, aumentando el porcentaje de eliminación con el incremento de la concentración inicial de Fe(III en la solución. Por otra parte, a medida que disminuye la concentración inicial de arsénico en la solución se requiere una mayor proporción de Fe/As para su eliminación. Además, se mostró que para soluciones conteniendo 13,73 mg/l, 1,71 mg/l y 0,105 mg/l de As, se necesitan relaciones Fe/As de 6:1, 18:1 y 800:1 para lograr una eliminación de arsénico desde la solución del orden de 95 %.

  20. ¿Por qué enseñar a escribir usando técnicas de "Focus on Form"?

    Directory of Open Access Journals (Sweden)

    Rosa Mª Lucha Cuadros

    2006-05-01

    Full Text Available El estudio que aquí presentamos aborda los siguientes temas: 1. Indaga acerca de si una enseñanza intensiva centrada en la forma induce o no a obtener resultados más positivos en la adquisición, al menos en la memoria a corto plazo, de estructuras lingüísticas significativas; en nuestro caso estructuras para comparar y expresar ventajas e inconvenientes. 2. Permite postular la efectividad del uso de herramientas informáticas para evaluar la “calidad de información” (Díaz y Ruggia 2004 de producciones escritas. Las herramientas utilizadas han sido, por un lado, el analizador-etiquetador Connexor, y, por otro lado, el software Childes (MacWhinney 1987, formado por diferentes programas informáticos, que permite la cuantificación automática de la frecuencia de aparición de categorías sintácticas elegidas previamente. En la investigación participaron dos grupos de estudiantes del programa Erasmus de la Universitat Pompeu Fabra. El primer grupo recibió una enseñanza intensiva centrada en la forma tras la cual realizó una tarea de expresión escrita consistente en la redacción de un texto expositivo. El segundo grupo realizó la misma tarea de expresión escrita, pero sin la previa instrucción centrada en la forma. //// The present study analyses the effectiveness of instructed second language teaching through focus on form in a group of learners compared with a control group. Written production was elicited through a final task after refreshing grammar and lexis content in the experimental group while the control just did the final task. The final product of both students’ groups was analysed with semiautomatic processors (Childes and Connexor and the patterns resulting compared and evaluated separately. Data show that the experimental group, which underwent treatment, did perform more native-like than the control group.

  1. Microclima de abrigos escamoteadores para leitões submetidos a diferentes sistemas de aquecimento no período de inverno Microclimate of creep for piglets submitted to different systems of heating during the winter period

    Directory of Open Access Journals (Sweden)

    Héliton Pandorfi

    2005-03-01

    Full Text Available O objetivo desta pesquisa foi avaliar a eficiência dos diferentes sistemas de aquecimento em abrigos escamoteadores para leitões. Foi desenvolvida na sala da maternidade, com 80 animais entre o nascimento e o desmame, adotando-se 4 diferentes sistemas de aquecimento: piso térmico, lâmpada incandescente, resistência elétrica e lâmpada infravermelha. As variáveis ambientais foram registradas no ambiente externo, sala da maternidade e no interior de cada abrigo escamoteador avaliado, ao longo de 18 dias. Para avaliação zootécnica foram registrados ganho de peso diário (GPD e mortalidade. A análise técnico-econômica foi feita considerando-se o consumo de energia elétrica e o GPD dos animais. O delineamento experimental foi em blocos casualizados com 4 tratamentos e 18 blocos. Os sistemas de aquecimento apresentaram diferenças significativas para temperatura de bulbo seco umidade relativa do ar (UR, e para os índices de conforto, carga térmica radiante e entalpia, sendo que os tratamentos que se mostraram mais adequados, do ponto de vista térmico e técnico-econômico, foram lâmpada incandescente e resistência elétrica.The general objective of this research was to evaluate the efficiency of different systems of heating in creep for piglets. The experiment was conducted in a commercial swine production farm, located in Elias Fausto city, in the State of São Paulo. The research was developed in the farrowing house, with 80 animals between the birth and weanning, adopting 4 different heating systems: heat mat, standard heating lamp, electrical resistance and infrared lamp. The ambient variables were observed inside and outside the farrowing house and inside each studied creep, during 18 days. For animal production evaluation of daily weight gain and mortality were registered too. The techno-economic analysis was made considering the consumption of electric energy and the weight gained by animals. The statistical design of the

  2. Análise de um sistema de aquecimento de água para residências rurais, utilizando energia solar A water heating system analysis for rural residences, using solar energy

    Directory of Open Access Journals (Sweden)

    Luiz H. Basso

    2010-02-01

    Full Text Available A conscientização da importância do meio ambiente tem incentivado o estudo de novas fontes energéticas renováveis e menos poluentes. Dentre essas fontes, a energia solar destaca-se por ser perene e limpa. A utilização da energia solar em sistemas de aquecimento de água residencial rural pode colaborar com a economia de energia elétrica, base da matriz energética brasileira. Conhecer os fatores que influenciam na operação de um sistema de aquecimento de água por energia solar é importante na determinação de sua viabilidade técnica, visando a sua difusão em residências rurais. Para tanto, construiu-se um protótipo, no câmpus da Faculdade Assis Gurgacz, em Cascavel - PR, com características similares a um equipamento utilizado em residências para dois habitantes, para funcionar com circulação natural ou termossifão e sem auxílio de sistema de aquecimento complementar. O equipamento mostrou-se viável tecnicamente, alcançando a temperatura mínima para banho de 35 °C, sempre que a radiação solar foi superior a 3.500 Wh m-2, o que aconteceu para a maioria dos dias estudados.The awareness of the importance of the environment has stimulated the study of new renewed energy sources and less pollutant. Amongst these sources, solar energy stands alone for being perennial and clean. The use of solar energy in systems of agricultural residential water heating, can complement the economy of electric energy, base of the Brazilian energy matrix. Knowing the factors that influence the operation of a system of water heating by solar energy is important in determining their technical viabilities targeting their distribution in agricultural residences. To evaluate equipment of water heating for solar energy, a prototype was constructed in the campus of Assis Gurgacz College, in Cascavel,State of Paraná, Brazil, with similar characteristics to equipment used in residences for two inhabitants, to function with natural circulation or

  3. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  4. DIATERMIA POR ONDAS CURTAS: ANÁLISE DA TEMPERATURA CORPORAL SUPERFICIAL POR TERMOGRAFIA

    OpenAIRE

    Sergio Fernando Zavarize; Anderson Martelli; Samara Aparecida Machado; Estela Maria Correia Sant’Ana

    2014-01-01

    Introdução: Poucos estudos relacionam os efeitos da diatermia por ondas curtas (DOC) e a área de aquecimento promovido por sua aplicação. Objetivo: O objetivo do trabalho foi avaliar o comportamento da temperatura superficial corporal antes e após a aplicação de DOC por meio da termografia cutânea. Materiais e métodos: A análise da temperatura corporal no local da aplicação foi realizada através da captura da imagem por meio de câmera termográfica após quinze minutos de repouso do...

  5. Analysis of a solar water thermosyphon system; Analise do aquecimento solar de agua por sistema a termosifao

    Energy Technology Data Exchange (ETDEWEB)

    Cardenas, Abner Barzola

    1992-07-01

    A design methodology and to perform the simulation of flat plate solar collectors coupled with a water storage tank and operating by natural convection circulation is presented. For a given site the incident solar radiation on a tilted and previously oriented surface is determined from solar astronomy and the dally average of the monthly data of the horizontal total solar radiation. Huancayo situated in Peru (at 12.05 deg S, long. 76.18 deg W, altitude 3,312 m), is chosen as the site to be installed the solar water system, as a mean to improve the peasant's standard of life. An optimum tilt angle for a north oriented collector surface is obtained in order to have a maximum solar capture during the water. The theoretical methodology use here is based upon the ONG's paper (1976), and in attrition is considered the hot water drainage due to the dally consumption. For the sake of comparison, the calculated flowrate values are confronted with the experimental data obtained by FERNANDEZ, for a same site location (Rio de Janeiro) and are used identical dimensions for the water thermosyphon heater. Finally, the economic feasibility of the solar water system is demonstrated when it is compared with the usual immersion electric resistance boiler. For the Peruvian conditions the more adequate solar water system for a rural or domestic usage is a 1.4 m{sup 2} area solar collector (6 parallel, 15,875 mm copper tubes), 100 l capacity for the water storage tank, 33.5 mm for the connecting tubes, being of 300 mm. The height between the collector top and the bottom of the tank. (author)

  6. Sistema automatizado de aquecimento solar para controle de fitopatógenos da água de irrigação Automatic solar heating system for control of pathogens in irrigation water

    Directory of Open Access Journals (Sweden)

    Carlos A. da S. Braga

    2001-05-01

    Full Text Available O sistema automatizado de aquecimento solar, baseou-se em um processo misto de aquecimento da água em circuito fechado, através de coletores planos e dois princípios integrados de transmissão de calor, um por convecção natural e o outro por convecção forçada. A automatização foi realizada por monitores termostáticos diferenciais. Os testes normativos abrangeram as temperaturas programadas de 50, 55 e 60 ºC, que contemplam a faixa de temperatura letal para a maioria dos fitopatógenos. Os resultados indicaram rendimentos térmicos da ordem de 63, 55 e 52%, superiores, quando comparados aos rendimentos médios de 50, 47 e 45% dos sistemas convencionais. Os resultados experimentais mostraram que o sistema é eficiente para a eliminação de patógenos da água de irrigação, sendo promissor como uma opção de baixo custo para ser usado em viveiros, casas-de-vegetação e pequenas ou médias propriedades agrícolas.In the system proposed, which uses flat collectors, both natural and forced convection are responsible for the transfer of heat to the circulating water. The automation of the system is performed by thermostats, placed in different places, electrically connected to other components like valves and a water pump. Under identical test conditions and in the range of temperatures considered (50, 55 and 60 ºC, which includes the reference lethal temperature range for pathogens, the thermal efficiencies attained were 63, 55 and 52%, which compare favorably with those obtained in conventional systems, these being 50, 47 and 42% respectively, as reported. The results of the experimental trials show that the system described is a viable option to eliminate pathogens present in irrigation water, while its low cost makes it attractive for use in nurseries, greenhouses and on small farms.

  7. O currículo na e da enfermagem: por onde começar e recomeçar El currículo en la y de la enfermería: por donde comenzar y recomenzar Nursing curriculum: witch way to commence and to recommence

    Directory of Open Access Journals (Sweden)

    Dulce Maia Silva Vendrúscolo

    1996-01-01

    Full Text Available Este estudo apóia-se na premissa de que toda prática educacional se faz baseada em pressupostos de natureza filosófica e pedagógica, representando o currículo, a visão de mundo percebida pela escola e seus professores. A questão orientadora desta investigação assim se coloca: Qual a percepção do professor sobre as concepções curriculares norteadoras do currículo de graduação de enfermagem? Participaram da pesquisa 36 professores de 9 escolas paulistas de enfermagem que responderam à entrevista formulada a partir da técnica do Diferencial Semântico. As concepções-educacionais, tradicionalista, cognitiva, comportamentalista, de auto-realização e de reconstrução social, orientaram esta análise. Os resultados da pesquisa expressaram as preferências dos sujeitos para posturas educacionais de caráter humanístico e social, demonstrando haver, entretanto, a orientação ora para postura mais renovadoras, ora para mais tradicionais, caracterizando não haver uma concepção predominante na orientação do currículo. A realidade curricular da enfermagem demonstra a existência de um plurarismo de posturas filosóficas e pedagógicas na orientação do ensino de graduação, sendo estas opções, muitas vezes, resultantes das aspirações e dos ideais do próprio professor atribuídos ao processo educacional vigente na enfermagem.Este estudio se apoya en la premisa de que toda práctica educacional se hace fundamentada en presupuestos de naturaleza filosófica y pedagógica, representando el currículo, la visión de mundo percibida por la escuela e sus profesores. La orientación de esta investigación así se coloca: Cual es la percepción del profesor acerca de las concepciones curriculares norteadora del currículo de pre-grado de Enfermería? Parciparon de la investigación 36 profesores de 9 escuelas paulistas de Enfermería que respondieron a la entrevista formulada a partir de la técnica del Diferencial Sem

  8. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  9. Microbiological air quality of processing areas in a dairy plant as evaluated by the sedimentation technique and a one-stage air sampler Qualidade microbiológica do ar de ambientes de processamento em indústria de laticínios avaliada por amostrador de ar de um estágio e pela técnica da sedimentação

    Directory of Open Access Journals (Sweden)

    Valéria Costa Salustiano

    2003-07-01

    Full Text Available The microbiological air quality at processing areas in a dairy plant was evaluated by using a one-stage air sampler, based on Andersen principles (impaction technique and by culture settling plate technique, also known as sedimentation technique. Among these areas, milk reception, packaging, and pasteurization rooms were included. Rooms where cheese, yogurt, butter and "doce de leite"(Latin American typical treat made of concentrated milk and sugar are made were also evaluated. For all processing areas, the numbers of mesophilic aerobic bacteria and yeast and molds recovered by air sampler were higher than 90 CFU·m-3 - the maximum value recommended by American Public Health Association (APHA. In four of the six processing areas, the microbial numbers were higher than APHA's standard (30 CFU.cm-2.week-1 according to culture settling plate technique. The results showed a difference (pFoi avaliada a microbiota do ar dos ambientes de recepção, embalagem e pasteurização de leite, produção de queijos, de iogurte e de doce de leite e manteiga em uma indústria de laticínios pelas técnicas de sedimentação e de impressão em ágar utilizando um amostrador de ar de um estágio baseado no princípio de Andersen. As contagens de microrganismos mesófilos aeróbios e de fungos filamentosos e leveduras pela técnica impressão em ágar ultrapassaram 90UFC·m-3 de ar, valor máximo recomendado pela APHA. Pela técnica de sedimentação, as contagens microbianas do ar de quatro ambientes também ultrapassaram 30UFC·cm-2·semana-1, conforme recomendação da APHA. Os ambientes diferiram (p<0,05 apenas para os números de Staphylococcus aureus. (<1,0 a 4,3 UFC.m-3. As contagens microbianas por impressão em ágar foram de 2 a 10 vezes maiores que as obtidas por sedimentação, evidenciando a maior capacidade da impressão em ágar em determinar microrganismos do ar, inclusive patógenos. Quanto à distribuição da microbiota do ar, houve a predomin

  10. Arsenic phytoextraction and hyperaccumulation by fern species Fitoextração e hiperacumulação de arsênio por espécies de samambaias

    Directory of Open Access Journals (Sweden)

    Maria Isidoria Silva Gonzaga

    2006-02-01

    Full Text Available Arsenic (As is an ubiquitous trace metalloid found in all environmental media. Its presence at elevated concentrations in soils derives from both anthropogenic and natural inputs. Arsenic is a toxic and carcinogenic element, which has caused severe environmental and health problem worldwide. Technologies currently available for the remediation of arsenic-contaminated sites are expensive, environmentally disruptive, and potentially hazardous to workers. Phytoextraction, a strategy of phytoremediation, uses plants to clean up contaminated soils and has been successfully applied to arsenic contaminated soils. It has the advantage of being cost-effective and environmentally friendly. A major step towards the development of phytoextraction of arsenic-impacted soils is the discovery of the arsenic hyper accumulation in ferns, first in Pteris vittata, which presented an extraordinary capacity to accumulate 2.3% arsenic in its biomass. Another fern, Pityrogramma calomelanos was found to exhibit the same hyperaccumulating characteristics. After that, screening experiments have revealed that the Pteris genus is really unique in that many species have the potential to be used in phytoextraction of arsenic. In general, these plants seem to have both constitutive and adaptive mechanisms for accumulating or tolerating high arsenic concentration. In the past few years, much work has been done to understand and improve the hyperaccumulating capability of these amazing plants. In particular, the field of molecular biology seems to hold the key for the future of the phytoremediation.O arsênio e um metalóide traço encontrado basicamente em todos os ambientes. Elevadas concentrações de arsênio no solo podem acontecer naturalmente devido ao intemperismo de rochas ricas em arsênio, como também de atividades antropogênicas. O arsênio é um elemento tóxico e cancerígeno. Em muitas partes do mundo, a contaminação pelo arsênio tem causado problemas

  11. Tropical agriculture and global warming: impacts and mitigation options Agricultura tropical e aquecimento global: impactos e opções de mitigação

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo P. Cerri

    2007-02-01

    Full Text Available The intensive land use invariably has several negative effects on the environment and crop production if conservative practices are not adopted. Reduction in soil organic matter (SOM quantity means gas emission (mainly CO2, CH4, N2O to the atmosphere and increased global warming. Soil sustainability is also affected, since remaining SOM quality changes. Alterations can be verified, for example, by soil desegregation and changes in structure. The consequences are erosion, reduction in nutrient availability for the plants and lower water retention capacity. These and other factors reflect negatively on crop productivity and sustainability of the soil-plant-atmosphere system. Conversely, adoption of "best management practices", such as conservation tillage, can partly reverse the process - they are aimed at increasing the input of organic matter to the soil and/or decreasing the rates at which soil organic matter decomposes.O uso intensivo da terra invariavelmente causa efeitos negativos ao ambiente e produção agrícola se práticas conservativas não forem adotadas. Redução na quantidade de matéria orgânica do solo significa emissão de gases (principalmente CO2, CH4, N2O para a atmosfera e aumento do aquecimento global. A sustentabilidade do solo é também afetada, uma vez que a qualidade da matéria orgânica remanescente muda. Alterações podem ser verificadas, por exemplo, pela desagregação do solo e mudança na sua estrutura. As consequências são erosão, redução na disponibilidade de nutrientes para as plantas e baixa capacidade de retenção de água no solo. Estes e outros fatores refletem negativamente na produtivade das culturas e sustentabilidade do sistema solo-planta-atmosfera. Ao contrário, a adoção de boas práticas de manejo, tal como o sistema plantio direto, pode parcialmente reverter o processo, uma vez que objetiva o aumento das entradas de material orgânico no solo e/ou diminuição das taxas de decomposi

  12. Global warming and climate changes in the view of adults living in cities of São Paulo State AQUECIMENTO GLOBAL E MUDANÇAS CLIMÁTICAS NA VISÃO DE ADULTOS RESIDENTES EM CIDADES PAULISTAS

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Tavares

    2011-10-01

    Full Text Available ABSTRACT This study was conducted through interviews in mid-2009, in the cities of São Bernardo do Campo, Santo Antonio de Posse, Pederneiras and Tapiratiba, located in São Paulo State, Brazil. The aim was to evaluate if the population had information about the global warming and climate changes. In case of an affirmative answer, the main sources of information that they had access were identified and also their personal views on this controversial subject today. Regarding the climate changes and its causes and consequences, it was found that people acquire more information through television and internet, which is worrying, given that the facts disclosed by the television networks and the worldwide computers network, are often alarmist and lacking scientific foundation. Keywords: Global Warming. Climate Changes. State Policy on Climate Changes. Media. Mitigation Measures.RESUMO Este trabalho, por meio de entrevistas realizadas em meados de 2009, nas cidades de São Bernardo do Campo, Santo Antonio de Posse, Pederneiras e Tapiratiba, localizadas no Estado de São Paulo, Brasil. O objetivo foi avaliar se a população tinha informações a respeito do aquecimento global e mudanças climáticas. Em caso de uma resposta afirmativa, procurou-se conhecer as principais fontes de informação a que teve acesso e suas posições pessoais diante de um assunto polêmico na atualidade. Verificou-se que sobre mudanças climáticas, suas causas e conseqüências, as pessoas ainda adquirem mais informações na televisão e na internet, o que é preocupante, haja vista que os fatos divulgados pelas redes televisivas e pela rede mundial de computadores são, muitas vezes, alarmistas e desprovidos de fundamentos científicos. Palavras-chave: Aquecimento Global. Mudanças Climáticas. Política Estadual de Mudanças Climáticas. Mídia. Medidas Mitigadoras.

  13. Levantamento das distribuições de temperatura em leito de arroz com casca durante o tratamento térmico por micro-ondas

    Directory of Open Access Journals (Sweden)

    Michele Nehemy Berteli

    2014-12-01

    Full Text Available Durante o aquecimento dielétrico, a distribuição do campo elétrico dentro de uma cavidade ocorre a partir de uma propagação multimodal, ocasionada por inúmeras reflexões das micro-ondas provenientes das paredes metálicas da cavidade. Essas reflexões múltiplas geram regiões de maior e menor intensidade de campo elétrico no espaço e, por consequência, um aquecimento não uniforme no produto. O objetivo deste estudo foi o levantamento dos valores de temperaturas obtidos durante o tratamento térmico por micro-ondas em um leito de arroz em casca úmido posicionado em um porta-amostra, dentro de uma cavidade que apresenta uma geometria prismática de seção sextavada. A cavidade foi desenhada para, operando em frequência de 5,8 GHz e potência máxima de 700 W, minimizar a heterogeneidade de distribuição das intensidades do campo elétrico, gerando um aquecimento mais uniforme do produto. Verificou-se que as diferenças de temperatura registradas pelos sensores no leito de arroz foram de 3,2 °C a 12,5 °C durante os tratamentos térmicos estudados. Não foi observado um comportamento padrão que indicasse uma região de maior aquecimento em relação à altura e direção radial do leito de arroz durante os tratamentos térmicos por micro-ondas

  14. Mecanismos anatômicos e fisiológicos de plantas de aguapé para a tolerância à contaminação por Arsênio Anatomical and physiological mechanisms of water hyacinth plants to Arsenic contamination tolerance

    Directory of Open Access Journals (Sweden)

    F.J. Pereira

    2011-06-01

    Full Text Available Este trabalho teve como objetivo a avaliação das características anatômicas e fisiológicas de aguapé (Eichhornia crassipes em resposta ao estresse por arsênio. As plantas de aguapé foram cultivadas em solução nutritiva hidropônica de Hoagland em casa de vegetação sob cinco concentrações de arsênio: 0,0; 0,25; 0,5; 1,0; e 2,0 mg L-1 por período de 20 dias. As plantas demonstraram aumento na taxa fotossintética, na condutância estomática, na transpiração e na relação Ci/Ca, bem como na atividade de todas as enzimas do sistema antioxidante, com maior atividade nas folhas em relação às raízes nos tratamentos contendo arsênio. As características anatômicas das folhas das plantas sob as maiores concentrações de arsênio mostraram aumento na densidade estomática, no índice estomático e na espessura do parênquima esponjoso. A anatomia radicular não evidenciou alterações decorrentes da intoxicação por arsênio e modificações nas características do xilema e floema, porém não houve prejuízos à sua estrutura e função. Dessa forma, o estresse por intoxicação pelo arsênio, nas concentrações testadas, não é evidente nas plantas de E. crassipes, e os mecanismos de tolerância são relacionados com modificações na anatomia e fisiologia das plantas.This work aimed to evaluate the anatomical and physiological characteristics of Eichhornia crassipes in response to arsenic stress. Plants of E. crassipes were grown in Hoagland hydroponic nutritive solution under greenhouse conditions at five arsenic levels: 0.0, 0.25, 0.50, 1.0 and 2.0 mg L-1 during 20 days. The plants showed an increase in photosynthetic rate, stomatal conductance, transpiration and Ci/Ca rate, as well as in the activity of all the enzymes in the antioxidant system, with higher activity in the leaves than in the roots, in all the treatments with arsenic. The anatomical characteristics observed on the leaves of the plants under higher

  15. Potential of macrophyte for removing arsenic from aqueous solution Potencial de remoção de arsênio de solução aquosa por macrofita

    Directory of Open Access Journals (Sweden)

    F.P. Guimaraes

    2012-12-01

    estudo, com vistas à seleção de plantas para remediação de ambientes contaminados com arsênio (As. Os experimentos foram conduzidos em casa de vegetação durante seis dias, em vasos contendo solução Hoagland (¼ força iônica e As nas concentrações de 0,5; 2,5 e 5,0mgL-1. As três espécies mostraram acúmulo crescente de As tanto quanto a concentração do metalóide na solução foi aumentada. No entanto, foi detectada redução no ganho de massa fresca e seca quando as plantas foram expostas a altas concentrações de As. As três espécies de macrófitas mostraram diferenças na eficiência de remoção de As na solução. A. caroliniana, S. minima e L. gibba acumularam, em média, 0,130, 1,200 e 1,397mgmDM-1 de As, respectivamente, quando expostas a 5,0mgL-1. As macrófitas absorveram maior quantidade de As na solução com baixo índice de fosfato. Quanto maior a concentração de As nos tecidos da L. gibba, menor foi o conteúdo de clorofila e carotenoide, mostrado pela alta incidência de clorose. Lemna gibba também apresentou diminuição no tamanho da folha e As não afetou a síntese total de clorofila e carotenoide em A. caroliniana. Esta espécie apresentou folhas arroxeadas com alta concentração de antocianina cuja presença sugere associação à deficiência de fosfato. A necrose marginal ocorreu nas folhas flutuantes de S. minima, e as plantas-filha não mostraram nenhum sintoma visual. A porcentagem de As removida da solução pelas plantas foi reduzida quando estas foram expostas a altas concentrações do poluente. Das três espécies estudadas, somente L. gibba pode ser considerada como hiperacumuladora de As, porém sua utilização para remediar ambientes aquáticos contaminados com As mostrou-se limitada e exige investigação mais aprofundada.

  16. Compostagem como fonte térmica de energia para aquecimento de água na aqüicultura = Composting as thermal source of energy for heating the water in the aquaculture

    Directory of Open Access Journals (Sweden)

    César Ademar Hermes

    2005-07-01

    Full Text Available O objetivo deste trabalho foi utilizar a compostagem como fonte térmica de energia na manutenção de organismos aquáticos. A região de Toledo possui temperatura média anual do ar de 20,5ºC e média no trimestre quente de 27ºC e no frio de 16,5ºC. O material experimental utilizado consistiu de caixas de água, tubos de alumínio, feno degramínias, esterco de aves e suínos, compressores de aquário, mangueiras e tubos, pedras porosas, alevinos de tilápia e termômetro. Foram monitoradas as temperaturas do ar, do composto, da água com e sem aquecimento pelo composto. As temperaturas médias foram de 20,9ºC e 31,1ºC, para o ar e o composto, respectivamente. A diferença de peso entre os alevinos foi de 24,0%. Concluiu-se que a compostagem pode ser uma fonte de energia térmica na aqüicultura.The objective of this work is to use the composting as thermal energy source in the maintenance of aquatic organisms. The area of Toledo possesses annual medium temperature of the air of 20.5ºC and average in the hottest quarter of 27ºC and in the more cold of 16.5ºC. The experimental material consisted of boxes of water, pipes of aluminum,hay of grassy, manure of birds and swine, aquarium compressors, hoses and pipes, porous stones, fish lingers, and thermometer. The temperatures of the air, the composition, and the water without heating were monitored. The medium temperatures obtained were 20.9ºCand 31.1ºC for the air and the composition, respectively. The temperature averages of the water with heating and without heating were 22.0ºC and 20.0ºC. The weight difference among the fish lingers was 24.0%. The conclusion is that the composting can be a thermalsource of energy in the aquaculture.

  17. Updraft biomass gasification reactor evaluation of fuel; Reator de gaseificacao de biomassa em fluxo contra corrente para aquecimento de ar de secagem

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Ivanildo da S. dos; Silva, Jadir N. da; Martins, Marcio A. [Universidade Federal de Vicosa (UFV), MG (Brazil)], Emails: ivanildomt@gmail.com, jadir@ufv.br, aredes@ufv.br

    2010-07-01

    Searching for a clean hot air from biomass for on farm applications, a gasification/combustion system was designed, built and evaluated. The system consisted of a countercurrent gasifier, coupled with a combustion chamber that burns the producer gas, and eucalyptus firewood was used as a fuel. Willing to reduce heat losses from the unit as well as to prevent thermal hazardous the unit was totally covered with brick's wall. Initial unit thermal efficiency was of about 56% and it reaches up to 71% at recharge. It was concluded that this system attended the proposed objectives, producing clean hot air that can be used for drying purposes as well as ambient space heating. (author)

  18. Sobre la conveniencia de diseñar y producir un sistema distribuido de preservación digital por replicación para las tesis doctorales generadas en las universidades españolas

    OpenAIRE

    Ferrer Gutiérrez, Ángeles

    2015-01-01

    Los sistemas distribuidos de preservación digital ?a menudo llamados sistemas en la nube, pese a que técnicamente se basan en servidores alojados en las propias instituciones? son una solución ya real y económica para la preservación de recursos digitales que puedan ser considerados críticos por nuestras instituciones. Las principales técnicas o mecanismos de preservación radican en la replicación de los datos en lugares geográficamente dispersos (para substituir las copias defectuosas por...

  19. ¿Por qué enseñar métodos de investigación en las facultades de biblioteconomía y documentación?

    OpenAIRE

    Delgado López-Cózar, Emilio

    2001-01-01

    Se pretende demostrar por qué es necesaria la enseñanza de métodos de investigación en los estudios de Biblioteconomía y Documentación. Se exponen las opiniones al respecto de diversos profesionales, profesores y científicos. Se mantiene que el aprendizaje de la metodología científica sirve, en primer lugar, para formar el espíritu crítico del alumnado y, en segundo lugar, para dotarle de herramientas que le permitan en su futuro profesional actuar de manera racional y sis...

  20. Global warming in Amazonia: impacts and Mitigation Aquecimento Global na Amazônia: impactos e Mitigação

    Directory of Open Access Journals (Sweden)

    Philip Martin Fearnside

    2009-01-01

    climate change, Brazil must assume the leadership in fighting global warming.O aquecimento global tem impactos potencialmente catastróficos na Amazônia, e, ao mesmo tempo, a manutenção da floresta amazônica oferece uma das opções mais valiosas e baratas para mitigar as mudanças climáticas. Nós sabemos que o fenômeno de El Niño, causado por uma oscilação da temperatura da superfície da água no Pacífico, tem impactos sérios na Amazônia, causando secas e incêndios florestais, como aconteceram em 1997-1998. Oscilações de temperatura no Atlântico também provocam secas severas, como em 2005. Nós também sabemos que árvores amazônicas morrem, tanto do fogo como do estresse hídrico sob condições quentes e secas. Além disso, a água reciclada pela floresta fornece chuva que mantém as condições climáticas apropriadas para floresta tropical, especialmente durante a estação seca. O que nós precisamos saber com urgência, por meio de pesquisa intensificada, inclui como representar melhor o El Niño e as oscilações no Atlântico, nos modelos climáticos, como representar as retroalimentações bióticas nos modelos usados para tomada de decisão sobre o efeito estufa, e um estreitamento da gama das estimativas da sensitividade climática (para reduzir a incerteza sobre a probabilidade de impactos muito severos. Assuntos que precisam ser negociados incluem a definição de mudança de clima "perigosa", com os correspondentes níveis máximos das concentrações de gases de estufa na atmosfera. Mitigação do efeito estufa tem que incluir a manutenção da floresta amazônica, o que traz benefícios para o combate ao efeito estufa por meio de dois papéis separados: diminuir o fluxo de emissões de carbono que acontece em cada ano devido ao ritmo rápido do desmatamento, e evitar a emissão do estoque de carbono na floresta restante que pode ser liberada de várias maneiras, inclusive por causa da própria mudança climática. Barreiras impedindo a

  1. Potencial de quatro espécies herbáceas forrageiras para fitorremediação de solo contaminado por arsênio Potential of four herbaceous forage species for phytoremediation of a soil contaminated with arsenic

    Directory of Open Access Journals (Sweden)

    Roseli Freire de Melo

    2009-04-01

    Full Text Available A fitorremediação de solos e substratos contaminados por elementos tóxicos tem despertado crescente interesse entre pesquisadores e técnicos. Particularmente em relação ao As, o obstáculo ao emprego desta técnica é o pequeno número de espécies identificadas capazes de acumular este elemento. O objetivo deste trabalho foi avaliar o potencial de plantas de estilosante (Stylosanthes humilis HBK, amendoim (Arachis pintoi Krapov. & Gregory, aveia (Avena strigosa Schreb e azevém (Lolium multiflorum Lam. como espécies fitorremediadoras de áreas contaminadas por As. Amostras de Latossolo Vermelho-Amarelo foram incubadas por 15 dias com diferentes doses de As: 0; 50; 100; e 200 mg dm-3. Em seguida, realizaram-se a semeadura das quatro espécies e as respectivas adubações. Aos 65 dias após a semeadura, as plantas foram avaliadas quanto à altura, à matéria seca da parte aérea e raízes. Determinaram-se os teores de As nas folhas jovens, intermediárias e basais, no caule e nas raízes, bem como o conteúdo e o índice de translocação (IT de As. Por meio de análises de regressão, foram estimados os teores críticos (TC de As disponíveis no solo, que proporcionaram redução de 50 % da matéria seca. As espécies estudadas apresentaram comportamento diferenciado quanto à tolerância ao As, com destaque para azevém, amendoim e estilosante, que não apresentaram lesões foliares decorrentes de fitotoxidez por esse elemento. Os TC para as plantas de aveia e azevém foram significativamente superiores aos observados para as demais espécies, caracterizando-as como espécies tolerantes ao As. As plantas de amendoim e estilosante apresentaram maior capacidade de absorção e maior IT de As para a parte aérea. As plantas de amendoim apresentaram maiores teores nas folhas basais e raízes, mostrando potencial para serem utilizadas em programas de fitorremediação. As plantas de azevém, amendoim e estilosante podem ser utilizadas na

  2. Por soñar con la libertad, los convirtieron en esclavos: presos, prisioneros y obras públicas y privadas en Andalucía durante la guerra civil

    Directory of Open Access Journals (Sweden)

    José Luis Gutiérrez Molina

    2008-12-01

    Full Text Available La conspiración cívico-militar de julio de 1936 no sólo tenía como objetivo destruir el orden constitucional vigente, también, y era su principal finalidad, la de hacer desaparecer cualquier posibilidad de cambio social. Tanto el tímido emprendido por los gobiernos republicanos, como el más radical que preconizaba un amplio sector de las clases populares. El fracaso de la rebelión casi destruyó al estado y abrió paso a una marea revolucionaria. Casi tres años pasaron antes que republicanos y revolucionarios fueran derrotados por los sublevados. Durante ellos, a medida que ciudades y pueblos iban siendo conquistados, la mayor de las esperanzas que podían tener los vencidos era ser encarcelados, escapar a las "sacas" y, una vez superada la condena, o condenas, a muerte impuestas por el consejo de guerra, convertirse en un preso que "redimía" su pena en cualquiera de las miles de obras públicas, pero también privadas, que reconstruían una España destruida. Sobrevivir era su único objetivo, aunque para ello tuvieran que convertirse en esclavos. _____________________ABSTRACT:The civic-military conspiracy of July in 1936 did not only have the aim of destroying the constitutional order in vogue, indeed, its main purpose was also to make any possibility of social change disappear. That is, the shy undertaken by the republican governments as well as the most radical preconized by a large sector of the popular classes. The insurrection failure almost destroyed the State and made way to a revolutionary tide. It was three years later when republicans and revolutionaries were defeated by the insurgents. During that time, as cities and villages were being conquered, the best hope the defeated might have was being imprisoned, escape to the sacas and, once the sentence was served, or sentences to death imposed by the jury of war, turn into a prisoner that used to redeem his punishment in any of the thousands of public works, as well as private

  3. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  4. Potencial do soro de leite líquido como agente encapsulante de Bifidobacterium Bb-12 por spray drying: comparação com goma arábica Potential of liquid whey as the encapsulating agent of Bifidobacterium Bb-12 by spray drying: comparison with arabic gum

    Directory of Open Access Journals (Sweden)

    Fabiane Picinin de Castro-Cislaghi

    2012-09-01

    Full Text Available O objetivo do trabalho foi avaliar o potencial do soro de leite líquido como agente encapsulante de Bifidobacterium Bb-12 por spray drying, comparando-o com a goma arábica, a qual é tradicionalmente utilizada na tecnologia de microencapsulação. Foram determinados o rendimento da microencapsulação e a viabilidade das microcápsulas durante o armazenamento. Quando o soro de leite foi utilizado como agente encapsulante, o rendimento da microencapsulação foi maior e a viabilidade das células manteve-se elevada e constante durante doze semanas. O soro de leite apresentou-se como um eficiente agente encapsulante de Bifidobacterium por spray drying.The objective of this study was to evaluate the potential of liquid whey as the encapsulating agent Bifidobacterium Bb-12 by spray drying, compared with arabic gum, which is typically used in microencapsulation technology. The microencapsulation yield and viability during storage were determined. When the whey was used as the encapsulating agent, the microencapsulation yield was higher, and cell viability remained high and steady for twelve weeks. The whey was shown to be an effective encapsulating agent of Bifidobacterium by spray drying.

  5. Simulação estocástica da radiação fotossinteticamente ativa e da temperatura do ar por diferentes métodos Random simulation of photosynthetically active radiation and air temperature through different methods

    Directory of Open Access Journals (Sweden)

    Thomas Newton Martin

    2007-09-01

    Full Text Available O objetivo deste trabalho foi comparar três métodos para simulação de dados de radiação fotossinteticamente ativa e temperatura do ar, com o uso de parâmetros diários de 17 estações do Estado de São Paulo. A simulação foi realizada para o primeiro e o 16º dia de cada mês, conforme: a distribuição normal truncada a mais ou menos 1,96 de desvio-padrão; distribuição triangular assimétrica; e distribuição normal bivariada. As estimativas com os dados simulados foram comparadas com os respectivos parâmetros (obtidos com os dados observados, pelos testes de homogeneidade de variância F e Bartlett, teste t de comparação de médias, coeficiente de correlação de Pearson, índice de concordância de Willmott, índice de desempenho de Camargo, coeficiente angular e o teste de normalidade dos dados. A simulação pela distribuição normal bivariada é a mais adequada para representar as variáveis climáticas.The purpose of this work was to compare three methods for simulating data of photosynthetically active radiation and air temperature, using daily parameters of 17 stations of São Paulo State, Brazil. The simulation of those elements was carried out for de 1st and the 16th day of each month, through three cases: nonsymmetric triangular distribution; normal distribution truncated at 1.96 standard deviation; and bivaried normal distribution. The simulated data were evaluated through the tests of homogeneity of variance F and Bartlett, t test, agreement index of Willmott, angular coefficient of the straight line, the index of performance of Camargo and tack the normal distribution (uni-varied. The simulation using the bi-varied normal distribution is most appropriate for representing the climate variables.

  6. Utilización de Sistemas Basados en Reglas y en Casos para diseñar transmisiones por tornillo sinfín // Use of rules based systems and cases based systems for worm gear design

    Directory of Open Access Journals (Sweden)

    Jorge Laureano Moya‐Rodríguez

    2012-01-01

    Full Text Available Las técnicas de Inteligencia Artificial se aplican hoy en día a diferentes problemas de Ingeniería,especialmente los Sistemas Basados en el Conocimiento. Entre estos últimos los más comunes son losSistemas Basados en Patrones, los Sistemas Basados en Reglas, los Sistemas Basados en Casos y losSistemas Híbridos. Los Sistemas Basados en Casos parten de problemas resueltos en un dominio deaplicación y mediante un proceso de adaptación, encuentran la solución a un nuevo problema. Estossistemas pueden ser usados con éxito para el diseño de engranajes, particularmente para el diseño detransmisiones por tornillo sin fin, sin embargo ello constituye un campo de las aplicaciones de laInteligencia Artificial aún inexplorada. En el presente trabajo se hace una comparación del uso de losSistemas Basados en Regla y los Sistemas Basados en Casos para el diseño de transmisiones portornillo sin fin y se muestran los resultados de la aplicación de los sistemas basados en regla al diseñoparticular de una transmisión por tornillo sin fin.Palabras claves: tornillo sin fin, engranajes, sistemas basados en casos, sistemas basados en reglas,inteligencia artificial.____________________________________________________________________________AbstractNowadays Artificial Intelligence techniques are applied successfully to different engineering problems,especially the “Knowledge Based Systems”. Among them the most common are the “Frame basedSystems”, “Rules Based Systems”, “Case Based Systems” and "Hybrid Systems". The “Case BasedSystems” (CBS analyze solved problems in an application domain and by means of a process ofadaptation; they find the solution to a new problem. These systems can be used successfully for thedesign of gears, particularly for designing worm gears; nevertheless it constitutes a field of the applicationsof artificial intelligence even unexplored. A comparison of the use of “Rules Based System” and

  7. Influência do resfriamento e do aquecimento local na flexibilidade dos músculos isquiotibiais Influence of local cooling and warming on the flexibility of the hamstring muscles

    Directory of Open Access Journals (Sweden)

    JS Brasileiro

    2007-02-01

    Full Text Available OBJETIVO: O propósito deste estudo foi analisar os efeitos do resfriamento e do aquecimento sobre a flexibilidade dos músculos isquiotibiais, observando os efeitos agudos e crônicos. MÉTODOS: Quarenta voluntários foram aleatoriamente incluídos em um dos quatro grupos (n=10: 1 grupo controle; 2 grupo alongamento (técnica sustentar-relaxar para os músculos isquiotibiais, por duas semanas consecutivas; 3 grupo alongamento precedido da aplicação de crioterapia (25 minutos na região posterior da coxa e 4 grupo alongamento precedido de aquecimento com diatermia por ondas curtas (25 minutos. A avaliação da flexibilidade muscular foi realizada através de uma prancha acoplada a um sistema de goniometria, especialmente preparada para avaliar o ângulo extensor do joelho. RESULTADOS: Os três grupos experimentais aumentaram significativamente a ADM em relação ao grupo controle. Os ganhos médios diários, considerados efeitos agudos, mostraram diferenças significativas em favor do grupo submetido ao resfriamento, quando comparado aos demais (aumento de 2,6 ± 0,9°, 4,3 ± 1,5° e 2,4 ± 0,7° para os grupos 2, 3 e 4, respectivamente, p= 0,008. Em relação aos efeitos crônicos, não foi observada diferença significativa entre os três grupos experimentais, embora todos diferiram do controle (aumento de 1,5 ± 0,5°, 11,1 ± 6,1°, 14,4 ± 5,4° e 14,4 ± 6,2°, para os grupos 1, 2, 3 e 4, respectivamente. CONCLUSÕES: Sessões de alongamento, aplicadas diariamente, aumentaram significativamente a flexibilidade dos músculos isquiotibiais. Os efeitos agudos foram maiores no grupo submetido ao resfriamento, quando comparado aos grupos somente alongado ou aquecido. Os efeitos crônicos não foram influenciados pelo aquecimento nem pelo resfriamento.OBJECTIVE: The aim of this study was to analyze the acute and chronic effects of cooling and warming on hamstring muscle flexibility. METHOD: Forty volunteers were randomly included in one of

  8. Uso da zootecnia de precisão na avaliação do comportamento de leitões lactentes submetidos a diferentes sistemas de aquecimento Use of animal precision production in the behavior evaluation of lactation piglets submitted to different heating systems

    Directory of Open Access Journals (Sweden)

    Iran José Oliveira da Silva

    2005-02-01

    Full Text Available Objetivou-se, nesta pesquisa, avaliar o comportamento de leitões em diferentes sistemas de aquecimento, por meio de análise de imagem e identificação eletrônica, na sala da maternidade, com 80 animais entre o nascimento e o desmame. Os tratamentos adotados para avaliação da eficiência dos diferentes sistemas de aquecimento foram: piso térmico, lâmpada incandescente, resistência elétrica e lâmpada de infravermelho. O delineamento experimental foi em blocos casualizados com quatro tratamentos e 18 blocos, as médias foram comparadas pelo teste Tukey. A avaliação física dos ambientes foi realizada por intermédio da temperatura de bulbo seco (Ts, temperatura de bulbo úmido (Tu e temperatura de globo negro (Tg, registradas por cabos termopares tipo T armazenados em uma plataforma automática de dados, em intervalo horário. Índice de temperatura de globo e umidade (ITGU, carga térmica radiante (CTR e entalpia (H foram calculados usando as variáveis ambientais registradas. Os dados ambientais foram registrados em ambiente externo, na sala da maternidade e no interior de cada abrigo escamoteador, durante 18 dias. Ganho de peso diário (GPD e mortalidade também foram registrados. A avaliação comportamental foi realizada utilizando a análise de imagem, identificação eletrônica. Para o período de inverno, o uso de lâmpada incandescente e resistência elétrica foi mais adequado sob o ponto de vista térmico, durante a primeira e segunda semanas, entretanto, considerando-se o reflexo do aquecimento no comportamento dos leitões na terceira semana, o piso térmico foi o que proporcionou melhor condição de conforto aos animais.The objective of this research was to evaluate the behavior of piglets at different heating systems using the image analysis and electronic identification devices. This research was developed in the farrowing house, with 80 piglets from birth to weaning. The treatments were the different heating systems

  9. ESTABILIDADE OXIDATIVA DE AMÊNDOAS DE NOZ MACADÂMIA SECAS POR MICRO-ONDAS COM AR QUENTE OXIDATIVE STABILITY OF MACADAMIA NUTS DRYED WITH HOT AIR MICROWAVES

    Directory of Open Access Journals (Sweden)

    Maria Ássima Bittar Gonçalves

    2011-04-01

    Full Text Available

    A nogueira macadâmia (Macadamia integrifolia Maiden & Betche produz amêndoas de alto valor comercial, que se destacam pelo fino sabor e qualidade de seu óleo. O objetivo deste trabalho foi estudar a estabilidade oxidativa de amêndoas secas, com aplicação de energia de micro-ondas com ar quente, em comparação ao processo de secagem convencional. As análises, realizadas no início (tempo zero, com 90 dias e 180 dias de armazenamento, avaliaram ácidos graxos livres, índice de peróxido, período de indução, composição em ácidos graxos e teor de tocoferol/tocotrienol. O teor de ácidos graxos livres (% das amêndoas de noz macadâmia variou de 0,095 (MW1 a 0,124 (MW3 e de 0,123 a 0,148 (CVL; os índices de peróxidos (meq O2 kg-1 de óleo entre 0,77 (MW2  e 2,57 (MW1 e de 1,52 a 3,29 (CVL; o período de indução (h de 16,7 (MW2 a 13,6 (MW4 e entre 11,9 e 10,6 (CVL; o teor de ?-Tocotrienol (mg 100 g-1 de 1,75 a 2,19 (MW1 e de 2,14 a 2,19 (CVL, respectivamente, para a secagem com micro-ondas e convencional. Os valores da composição em ácidos graxos não se alteraram durante o armazenamento, com os processos de secagem utilizados. O método de secagem com micro-ondas mostrou-se mais eficiente, em relação à estabilidade oxidativa das amêndoas de noz macadâmia, quando comparado ao processo de secagem convencional.

     

    The macadamia tree (Macadamia integrifolia Maiden & Betche produces a nut of highly commercial value, distinguishable from other nuts by its delicate flavour and oil quality. This study aimed to compare the oxidative stability of dried nuts, with the application of hot air microwave energy, in relation to conventional drying. The analyses were performed at the

  10. Characterization of iron phosphate glasses prepared by microwave heating; Obtencao de vidros fosfatos contendo ferro por meio do aquecimento em fornos de microondas

    Energy Technology Data Exchange (ETDEWEB)

    Almeida, Fabio Jesus Moreira de

    2006-07-01

    Phosphate glasses have been investigated since the fifties, because they are relatively easy to prepare, have low melting temperatures (1000 deg C - 1200 deg C), and low glass transition. However, these glasses were very sensitive to humidity, showing a very low chemical durability. Iron phosphate glasses have been prepared by melting inorganic precursors in conventional electric furnaces and induction furnaces. By adding iron, phosphate glasses became chemical resistant and were thought to be used as nuclear waste forms or mechanical resistance fibers. The use of microwaves has been investigated because it makes possible a fast and homogeneous heating of the materials. Microwave promotes the self-heating of the material by the interaction of the external electromagnetic field with the molecules and ions of the material. Niobium phosphate glasses was also produced already through the heating of precursors in microwave ovens. Other glasses containing iron in theirs structure was produced by conventional furnaces and they had your structures analyzed. But even so, it was not still published synthesis of iron phosphate glasses starting from the melting of precursors materials in microwave ovens. In the present work mixtures of (NH{sub 4}){sub 2}HPO{sub 4} and Fe{sub 3}O{sub 4} or (NH{sub 4}){sub 2}HPO{sub 4} and Fe{sub 2}O{sub 3} were exposed to microwave energy with electromagnetic waves of 2,45 GHz. It was proposed that the absorption of this radiation for the material causes the heating from room temperature to melting temperature. The obtained iron phosphate glasses was analyzed by X-ray diffraction, Moessbauer spectroscopy, and Differential Thermal Analysis. Iron phosphate glasses were also produced in electrical furnaces for comparison. (author)

  11. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  12. Avaliação energética e de desempenho de frangos com aquecimento automático a gás e a lenha Energetic evaluation and performance of broilers with automatic heating using gas and wood

    Directory of Open Access Journals (Sweden)

    Sandro R. Funck

    2008-02-01

    Full Text Available Nesta pesquisa foram analisados aquecimento automático infravermelho a gás e aquecimento automático a lenha, com três linhagens de frango, criados no período de 01/05/2005 a 16/06/2005, em aviários de 1200 m² e abatidos com 45 dias de idade. Avaliaram-se o consumo e o custo energético de cada sistema e os seguintes índices zootécnicos: peso médio, mortalidade, conversão alimentar e consumo de ração. O delineamento experimental foi inteiramente casualizado em um modelo fatorial 2 x 3, constituído de dois sistemas de aquecimento e das três linhagens de frangos machos formando seis tratamentos com seis repetições, perfazendo o total de trinta e seis aviários com 13.300 aves cada um. Utilizou-se, para a análise estatística, o programa SISVAR 4.6 e se realizaram as comparações entre as médias através do teste de Tukey. Os resultados obtidos foram os seguintes: o consumo energético de lenha de 173,21 GJ por lote e o custo de R$ 3,23 e, para o do gás, foi de 20,26 GJ por lote e o custo de R$ 53,76. Em relação ao desempenho zootécnico, não houve diferença significativa entre os dois sistemas analisados, mas entre as linhagens ocorreu diferença significativa, com a linhagem Cobb apresentando 6,62%, maior peso médio e 1,04% maior mortalidade, quando comparada com aves da linhagem Ross 1.In this research automatic infra-red gas heating and wood-burning were analyzed, with three lineages of broilers raised from May 1, 2005 to June 16, 2005 in 1200 m² poultry houses, and slaughtered at the age of 45 days. The energetic consumptions and costs were evaluated for each system, as well as the following zootechnical indexes: mean weight, mortality, feed conversion and consumption. The experimental design was completely randomized in a factorial 2 x 3 model, made up by two heating systems, three lineages of male broilers and six treatments and six replications, totaling thirty six poultry houses with 13,300 birds each. For the

  13. Ecoética e aquecimento global http://dx.doi.org/10.15601/1983-7631/rt.v8n14p66-74

    Directory of Open Access Journals (Sweden)

    Manuel Alfonso Díaz Muñoz

    2015-08-01

    Full Text Available RESUMO: O presente artigo pretende apresentar os dados científicos mais recentes sobre a questão do aquecimento global e discutir suas implicações políticas e éticas. Destaca-se a centralidade da questão ética e a necessidade de um novo paradigma biocêntrico, pois a vivência de uma nova ética ambiental global ou ecoética aparece como condição necessária para a sobrevivência humana e planetária. Conclui-se o artigo com o que se entende é a expressão concreta dessa referência ética comum: a Carta da Terra.Palavras-chave: Ecologia; Meio Ambiente

  14. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  15. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  16. Umidificação e aquecimento do gás inalado durante ventilação artificial com baixo fluxo e fluxo mínimo de gases frescos

    OpenAIRE

    Gorayb Susane Bruder Silveira; Braz José Reinaldo Cerqueira; Martins Regina Helena Garcia; Módolo Norma Sueli Pinheiro; Nakamura Giane

    2004-01-01

    JUSTIFICATIVA E OBJETIVOS: Em pacientes sob intubação traqueal ou traqueostomia, a umidificação e o aquecimento do gás inalado são necessários para a prevenção de lesões no sistema respiratório, conseqüentes ao contato do gás frio e seco com as vias aéreas. O objetivo da pesquisa foi avaliar o efeito do sistema respiratório circular com absorvedor de dióxido de carbono do aparelho de anestesia Cícero da Dräger, quanto à capacidade de aquecimento e umidificação dos gases inalados, utilizando-s...

  17. Correlação entre a necrose de frutos associada ao Colletotrichum spp. com as características frutos por nó e produtividade entre genótipos de café arábica Correlation between fruit necrosis associated to Colletotrichum spp. with the fruits per node and yield traits of arabic coffee

    Directory of Open Access Journals (Sweden)

    Gustavo Hiroshi Sera

    2008-02-01

    Full Text Available O fungo Colletotrichum spp. vem sendo associado à graves perdas para a cafeicultura brasileira. Objetivou-se neste trabalho verificar a existência de relação entre a variável necrose de frutos associada ao Colletotrichum spp. ("COL" com a quantidade média de frutos por nó produtivo ("FN" e com a produção ("PRD" em genótipos de café arábica. O ensaio de campo foi realizado no IAPAR (Londrina, PR, Brasil em dezembro de 2004 e em cafeeiros com três anos de idade. A variável "COL" foi avaliada atribuindo-se notas de 1 a 5, onde 1 representam plantas com 0 % a 5 % de frutos necrosados. "FN" foi avaliada seguindo uma escala de notas de 1 a 5, onde 1 representa plantas com 0 a 3 frutos/ nó e nota 5 com mais do que 15 frutos/ nó. A avaliação visual subjetiva da produção foi estimada em litros de frutos em estádio cereja, por planta. A correlação de Pearson foi estimada para avaliar a existência de associações entre as variáveis. Foram observadas correlações positivas e significativas a 1 % entre "COL" e "FN" e entre "COL" e "PRD". A necrose de frutos foi mais intensa em cafeeiros com mais produção e com mais frutos por nó produtivo. Sugere-se que a avaliação da resistência de campo à necrose dos frutos associada à presença de Colletotrichum spp. seja realizada em cafeeiros com alta produção e com alta quantidade de frutos por nó produtivo.Different fungi species of genus Colletotrichum has been associated with losses to the Brazilian coffee crop. The aim of this research was to evaluate the association between the variable fruit necrosis associated to Colletotrichum spp. ("COL" with the fruits per productive node average ("FN" and between "COL" and the yield ("PRD" in Coffea arabica L. genotypes. The field assay was evaluated at IAPAR (Londrina, PR, Brazil, in December 2004 and on coffee trees with three years old. The "COL" variable was evaluated attributing scores from 1 to 5, where score 1 represents plants

  18. Influence of the time/temperature binomial on the hydroxymethylfurfural content of floral honeys subjected to heat treatment Influência do binômio tempo e temperatura nos teores de hidroximetilfurfural em méis florais submetidos ao aquecimento

    Directory of Open Access Journals (Sweden)

    Roberta de Oliveira Resende Ribeiro

    2012-04-01

    Full Text Available Hydroxymethylfurfural (HMF content is internationally recognized for its ability to indicate the freshness or lack of freshness of honey and can be used to judge the processing and storage condition of honey. The objective of the present study was to evaluate the evolution of HMF levels in fresh extracted honeys submitted to different temperatures ranging from 30 to 100º C, during pre-established time intervals (30, 45, 60, 180 and 720 minutes.The test was conducted in floral honey with an initial HMF content of 2.2 mg/Kg. The maximum value recommended by the Brazilian law (60 mg/Kg was not exceeded in the samples subjected to heating for 30, 45 and 60 minutes regardless of the temperatures used. When the samples were heat treated during 180 minutes at 90º C the official value was surpassed. The highest values were observed in samples subjected to heating over 720 minutes, and the limit was exceeded at 70º C. The results obtained indicate that the HMF content gradually increases when the honey is heated at high temperatures for long periods. Therefore, we suggest a process optimization, considering the initial HMF content of the product and standardizing times and temperatures to ensure a good quality of the final product.O teor de hidroximetilfurfural (HMF é reconhecido internacionalmente pela capacidade de indicar o frescor do mel, podendo ser usado para avaliar o processamento e condições de armazenamento do mel. Neste trabalho objetivou-se avaliar a evolução dos níveis de HMF em mel recém-obtido, submetidas a diferentes temperaturas que variaram de 30 a 100º C, por intervalos de tempo pré-definidos (30, 45, 60, 180 e 720 minutos. O ensaio foi realizado em mel floral, cujo valor inicial de HMF foi de 2,2 mg/Kg. O valor máximo preconizado pela legislação brasileira não foi ultrapassado nas amostras submetidas ao aquecimento por 30, 45 e 60 minutos independente das temperaturas. Por um período de 180 minutos, o limite legal de

  19. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  20. Air quality and emergency pediatric care for symptoms of bronchial obstruction categorized by age bracket in Rio de Janeiro, Brazil Qualidade do ar e atendimentos pediátricos de emergência por sintomas de obstrução brônquica categorizados por faixas etárias no Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Marisa Moura

    2009-03-01

    Full Text Available The objective of this study was to estimate the association between levels of air pollutants and respiratory symptoms in children. An ecological time-series study was conducted between April 2002 and March 2003 with daily data on PM10, SO2, CO, NO2, and O3 and paediatric care in emergency rooms due to symptoms indicating bronchial obstruction. The potential confounding factors considered were: time trend, seasonality, meteorological variables, respiratory infections and the effects of weekends and holidays. A semi-parametric Poisson regression was used to model the time series. Splines (data smoothing functions, indicator variables and cubic polynomials were used to adjust the effects of the confounding variables. A 5% significance level was adopted for the study. A statistically significant increase of 6.7% in paediatric visits of children of less than 2 years of age was associated with PM10. A 3% positive association with O3 showed borderline significance (p O objetivo deste trabalho foi estimar a associação entre os níveis dos poluentes atmosféricos e sintomas respiratórios em crianças. Foi realizado um estudo ecológico de séries temporais, entre abril de 2002 e março de 2003, com dados diários de PM10, SO2, CO, NO2 e O3 e dos atendimentos pediátricos de emergência ocasionados por sintomas de obstrução brônquica. As variáveis de confusão foram: tendência temporal, sazonalidade, fatores meteorológicos, infecções respiratórias e os efeitos dos finais de semana e feriados. Regressão de Poisson semiparamétrica foi usada para modelar as séries temporais. Curvas suaves, splines, variáveis indicadoras e polinômios cúbicos foram empregadas para corrigir os efeitos dos fatores de confundimento. Foi adotado o nível de significância de 5%. Um incremento estatisticamente significativo dos atendimentos, de 6,7%, esteve associado com PM10 nas crianças menores do que dois anos. Associação positiva com o O3, em torno de 3

  1. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  2. Estudo da hemodinâmica venosa por meio da pletismografia a ar no pré e pós-operatório de varizes dos membros inferiores Venous hemodynamic study by air plethysmography in the pre- and postoperative period of lower limb varicose veins

    Directory of Open Access Journals (Sweden)

    Nei Rodrigues Alves Dezotti

    2009-03-01

    Full Text Available Contexto: O tratamento cirúrgico das varizes primárias dos membros inferiores deve proporcionar alívio da estase venosa, a fim de evitar a evolução da doença venosa para estágios de maior gravidade clínica. Objetivo: Estudar as alterações da hemodinâmica venosa em pacientes portadores de varizes primárias dos membros inferiores no pré e pós-operatório, utilizando a pletismografia a ar. Método: Foram estudados 63 membros inferiores em 39 pacientes (35 mulheres e quatro homens, com média de idade igual a 46,3 anos, operados no Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo, no período de janeiro de 2001 a dezembro de 2004. Os membros inferiores foram classificados de acordo com a classificação CEAP, em critério clínico = C2 a C6 (C2 = 6, C3 = 32, C4 = 15, C5 = 7 e C6 = 3, critério etiológico = Ep, critério anatômico = As e critério fisiopatológico = Pr. Os pacientes foram avaliados por exame clínico pré e pós-operatório, mapeamento dúplex pré-operatório e pletismografia a ar pré e pós-operatória. Resultados: Houve melhora da hemodinâmica venosa no pós-operatório, demonstrada pela diminuição do índice de enchimento venoso e da fração de volume residual e aumento da fração de ejeção nos membros inferiores submetidos à operação de varizes. Conclusão: A operação venosa superficial aliviou a estase venosa e proporcionou adequado tratamento, com o objetivo de interromper a evolução fisiopatológica da doença venosa crônica, em qualquer nível de gravidade clínica.Background: Surgical treatment of primary varicose veins of the lower limbs might contribute to venous stasis relief by preventing evolution of the venous disease to worse severity stages. Objective: To study venous hemodynamic changes in patients with primary varicose veins of the lower limbs during the pre- and postoperative period using air plethysmography. Method: Sixty-three lower

  3. INIBIÇÃO DE SALMONELLA POR EXTRATO DE ALECRIM (Rosmarinus officinalis): EFEITO DOS EXTRATOS ETANÓLICOS E AQUOSO INHIBITION OF Salmonella BY ROSEMARY EXTRACTS (Rosmarinus officinalis): EFFECT OF WATER AND ETHANOL EXTRACTS

    OpenAIRE

    Maria Célia Lopes Torres; Alonso Salustiano Pereira; Magdala Alencar Teixeiras; Paulo César Stringheta

    2007-01-01

    Estudou-se os efeitos inibidores do extrato etanólico e do extrato aquoso de alecrim, obtidos em Soxhlet e após aquecimento a 121°C por 10 minutos respectivamente, sobre sete espécies de Salmonella isoladas de frangos. Determinou-se a presença do princípio ativo bactericida do alecrim nos extratos aquoso e etanólico, sua concentração com efeito inibidor sobre Salmonella, “in vitro”, e a ocorrência de um possível sin...

  4. Avaliação da influência do infravermelho e da diatermia por microondas associados ao alongamento passivo no encurtamento dos músculos isquiotibiais - doi:10.5102/ucs.v5i1.416

    OpenAIRE

    Aline Simões Alencastro; Flavia Ladeira Dumas

    2008-01-01

    A diatermia por microondas é uma modalidade de aquecimento profundo, e a radiação infravermelha aquece praticamente a epiderme. Em algumas práticas clínicas, para se obter um maior ganho da flexibilidade usam-se técnicas de alongamento associadas ao calor. Este estudo teve como objetivo verificar a influência e as diferenças na utilização dos recursos térmicos de calor profundo e superficial na flexibilidade da musculatura isquiotibial. Dezenove estudantes do Curso de Fisioterapia do Centro ...

  5. Otimização das condições de extração de senosídeos por soluções hidroetanólicas das folhas de Senna alexandrina MILL empregando planejamento fatorial

    Directory of Open Access Journals (Sweden)

    Alexandre de Almeida Lopes Severo

    2013-12-01

    Full Text Available Senna alexandrina MILL é um arbusto alto, originário da Arábia, amplamente cultivado na Índia e largamente utilizado como laxativo na constipação aguda e em casos em que a defecação é aconselhável, como após intervenção cirúrgica antes ou depois de operação abdominal, sendo empregado na forma de pós, xaropes, comprimidos e cápsulas. Como estas formulações geralmente são preparadas à partir de derivados do extrato líquido, torna-se fundamental para a qualidade e eficácia que este tenha seu processo de extração otimizado. O presente trabalho teve por objetivo determinar as melhores condições de extração, por soluções hidroetanólicas, das folhas de Senna alexandrina, empregando planejamento fatorial completo com ponto central 23 (três fatores e dois níveis onde os níveis dos fatores foram codificados como -1 (baixo, 0 (ponto central e 1 (alto, e metodologia de superfícies de respostas, para avaliar a influência do solvente, da quantidade de planta e do método de extração sobre o teor de derivados hidroxiantracênicos expressos em senosídeo B (SB e sobre o resíduo seco (RS nos extratos líquidos preparados. Foram realizados planejamentos experimentais completos, sendo um realizado pelo deslocamento dos níveis, após a análise do primeiro planejamento. Após a análise da superfície de resposta do planejamento com os níveis deslocados encontrou-se a faixa de melhor extração dos derivados hidroxiantracênicos expressos em senosídeo B com a melhor relação SB/RS, utilizando o solvente etanol/água a 60% V/V, 15 gramas da planta, e extração com aquecimento e agitação.

  6. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  7. STABILITY OF OILS HEATED BY MICROWAVE: UV - SPECTROPHOTOMETRIC EVALUATION ESTABILIDADE DE ÓLEOS REFINADOS AQUECIDOS POR MICROONDAS: AVALIAÇÃO ESPECTROFOTOMÉTRICA NA FAIXA DO UV

    Directory of Open Access Journals (Sweden)

    Thais M. F. S. VIEIRA

    1998-10-01

    Full Text Available The effects of microwave heating on the oxidative stability of refined canola, corn and soybean oils were determined by absorptivity in the UV spectrum and by chemical analysis (peroxide and acid values. Samples were heated in a microwave oven (800 W, 2,450 MHz for 0 to 36 min. Microwave heating produced oxidative degradation in the three oils. Absorptivity at 232 and 270 nm increased gradually with an increase in microwave exposure time (0-36 min for canola, corn and soybean oils. Values of absorptivity at 232 nm increased from 4.812, 3.568 and 4.183 to 10.579, 12.874 and 15.950 after 36 min of heating canola, corn and soybean oil, respectively. The absorptivity at 232nm, due to the formation of conjugated dienes, was a good index for measuring the degradation of microwaved samples. UV scanning (220 - 320 nm detected alterations in the spectrum of microwaved samples. Acid value also increased within 36 min of heating for all oils. Peroxide value showed a significant difference (PO efeito do aquecimento por microondas sobre a estabilidade oxidativa de óleos refinados de canola, milho e soja foi determinado através de análises físicas (absortividade na faixa do UV e químicas (índice de peróxido e de acidez. Amostras de óleo foram aquecidas em um forno de microondas (800 W, 2450 MHz por períodos de 0 a 36 min. O aquecimento por microondas promoveu a degradação oxidativa em todos os óleos. Os valores de absortividade em 232 nm e em 270 nm apresentaram acréscimos crescentes com o aumento do período de exposição às microondas, indicando a ocorrência do processo oxidativo. A absortividade em 232 nm aumentou de 4,812, 3,568 e 4,183 para 10,579, 12,874 e 15,950 depois de 36 min de aquecimento nos óleos de canola, milho e soja, respectivamente. Devido à formação de dienos conjugados, compostos da oxidação, a absortividade em 232 nm mostrou-se um bom índice para o acompanhamento do efeito do aquecimento por microondas sobre a

  8. Study of growth of gadolinium-doped ceria nanobelts by a hydrothermal microwave system; Estudo do crescimento de nanofitas de ceria dopada com gadolinio por sistema de aquecimento por micro-ondas

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, R.F.; Castro, D.A.; Santos, M.R.C.; Figueiredo, A.T.; Godinho Junior, M. [Universidade Federal de Goias (UFG), Catalao, GO (Brazil). Dept. de Quimica; Barrado, C.M. [Universidade Federal do Para (UFPA), Belem, PA (Brazil). Inst. de Ciencias Exatas e Naturais; Leite, E.R. [Universidade Federal de Sao Carlos (INCTMN/UFSCar), SP (Brazil). Dept. de Qumica

    2013-07-15

    Cerium oxide (ceria) has attracted attention because of its important applications such as solid oxide fuel cells, catalysts for automobile exhaust gas, catalysts to obtain hydrogen, UV blockers, biomaterials, etc.. Control methods for synthesis of ceria are of great importance to explain or predict these properties. Thus, the objective of this work was to study the growth of cerium oxide nanobelts in a microwave-assisted hydrothermal system, where in 8 min 330 nm nanobelts were obtained at 130 deg C and 3 atm. The results collaborate to the research on reformers for ethanol and/or solid oxide fuel cells anode. (author)

  9. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  10. Pulsed discharge production Ar* metastables

    Science.gov (United States)

    Han, Jiande; Heaven, Michael C.; Emmons, Daniel; Perram, Glen P.; Weeks, David E.; Bailey, William F.

    2016-03-01

    The production of relatively high densities of Ar* metastables (>1012 cm-3) in Ar/He mixtures, at total pressures close to 1 atm, is essential for the efficient operation of an optically pumped Ar* laser. We have used emission spectroscopy and diode laser absorption spectroscopy measurements to observe the production and decay of Ar* in a parallel plate pulsed discharge. With discharge pulses of 1 μs duration we find that metastable production is dominated by processes occurring within the first 100 ns of the gas break-down. Application of multiple, closely spaced discharge pulses yields insights concerning conditions that favor metastable production. This information has been combined with time-resolved measurements of voltage and current. The experimental results and preliminary modeling of the discharge kinetics are presented.

  11. por valores

    Directory of Open Access Journals (Sweden)

    Jazmín Díaz-Barrios

    2005-01-01

    Full Text Available La era actual se caracteriza por una búsqueda de la identidad del hombre, donde el pivote del cambio organizacional es el individuo; cambiar en este entorno depende, en gran medida, de los valores que imperen en la cultura de la organización. Este trabajo documental intenta identificar aquellos valores, condición sine-qua-non, para el logro de los objetivos de cambio y analizarlos a fin de determinar sus indicadores, con el objeto de presentar una herramienta a las organizaciones que les facilite adaptarse a los nuevos tiempos. Se encontró que los valores: Delegación, Comunicación, Colaboración, Participación y Aprendizaje, son esenciales en los cambios integrales de esta era. Se determinaron 20 indicadores de su presencia. Se concluye que con esta información cada ente puede elaborar instrumentos que le permitan saber si los valores requeridos están presentes y en caso contrario tomar decisiones que alineen a la organización alrededor de los valores humanistas planteados, incrementando así las posibilidades de éxito en el proceso de cambio y por ende, las posibilidades de supervivencia en esta nueva época.

  12. What to teach to patients with heart failure and why: the role of nurses in heart failure clinics ¿Qué enseñar a los pacientes con insuficiencia cardiaca y por qué?: el papel de los enfermeros en clínicas de insuficiencia cardíaca O que ensinar aos pacientes com insuficiência cardíaca e por quê: o papel dos enfermeiros em clínicas de insuficiência cardíaca

    Directory of Open Access Journals (Sweden)

    Eneida Rejane Rabelo

    2007-02-01

    Full Text Available The most important objective of heart failure (HF treatment is to reach and preserve patients' clinical stability. Several studies have shown that programs aimed at systematic education, developed by multidisciplinary teams, are positive strategies to work with these patients. Nurses active in HF clinics play a fundamental role in the educational process and continuity of patient care. The objectives of these processes are to teach, reinforce, improve and constantly evaluate patients' self-care abilities, which include weight monitoring, sodium and fluid restrictions, physical activities, regular medication use, monitoring signs and symptoms of disease worsening and early search for medical care. Therefore, education to understand HF and the development of self-care abilities are considered key points to improve adherence, avoid decompensation crises and, consequently, to maintain patients clinically stable. This article presents a careful review of the aspects involved in the patient education process by nurses in the context of HF clinics.El principal objetivo del tratamiento de la insuficiencia cardiaca (IC consiste en obtener y mantener la estabilidad clínica del paciente. Varios estudios demostraron que programas de educación sistemática, desarrollados por equipos multidisciplinares, son estrategias positivas para estos pacientes. Enfermeras que trabajan en clínicas de IC tienen un papel fundamental en la educación y apoyo de los pacientes. Los objetivos del proceso son enseñar, reforzar, mejorar y evaluar constantemente la capacidad de autoayuda, que incluye el control de peso, restricciones al consumo de sodio y líquidos, actividades físicas, el uso adecuado de medicamentos, la observación de señales y síntomas de agravamiento de la enfermedad y la búsqueda precoz de los servicios médicos. Los puntos principales para promover el mejor cumplimiento de la terapia y evitar crisis de descompensación serian entonces la educaci

  13. Consumo de arsénico y riesgo cardiovascular

    OpenAIRE

    Lachiner Saborío Morales; Luis Fernando Hidalgo Murillo

    2015-01-01

    El arsénico (As) es un elemento considerado como ubicuo, cuyas fuentes pueden ser naturales o productos de la actividad humana. La exposición a este elemento ocurre principalmente por la vía oral. Las presentaciones inorgánicas del As son consideradas como las más tóxicas. La absorción del As ocurre en el intestino delgado y por medio de acuaporinas ingresa a los hepatocitos, en casos de ingesta crónica el As tiende acumularse en hígado, riñones, corazón, sistema nervioso, pulmones, músculo, ...

  14. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  15. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  16. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscien

  17. 40Ar/39Ar dating of Daqingshan thrust

    Institute of Scientific and Technical Information of China (English)

    LIU Zhenghong; XU Zhongyuan; YANG Zhensheng

    2003-01-01

    The Daqingshan thrust system, to the south of the Shiguai Mesozoic basin, is a complex system of top-to- the-north thrusting tectonic sheets. The thrust system has a complicated evolution due to multi-stage thrusting. In order to date the thrusting events, syntectonic muscovite and biotite grains are respectively analyzed with normal 40Ar/39Ar dating and laser 40Ar/39Ar dating, which yield 2 isochron ages, i.e. 193.74 ± 3.88 Ma and 121.6 ± 1.6 Ma. These ages suggest that faults within the Daqingshan thrust system formed during 2 stages of thrusting, one the early Indosinian and the other the late Yanshanian. The isotopic dating is consistent with field geological relations. Indosinan deformation is evidenced by top-to-the-north thrusting, with the occurrence of a series of large-scale east-west trending thrust faults and folds, while the Yanshanian thrusting is characterized by top-to-the-NNW thrusting. It is superposed on and modifies early Indosinian thrust faults.

  18. Os impactos do crescimento econômico sobre o aquecimento terrestre: a contribuição dos países em desenvolvimento

    Directory of Open Access Journals (Sweden)

    Maria Fernanda Cavalieri de Lima Santin

    2007-07-01

    Full Text Available O objetivo deste artigo é estimar as emissões de dióxido de carbono, CO2, para o ano de 2012, provenientes das atividades econômicas em alguns países em desenvolvimento, a saber: África do Sul, Argentina, Brasil, China, Índia e México. Inicialmente, são apresentadas as principais causas do aquecimento terrestre e como a utilização de combustíveis fósseis amplia o efeito estufa. Em seguida, são estimadas as emissões de CO2 para três cenários alternativos utilizando-se da Identidade de Kaya. Nos três cenários foram considerados que o aumento populacional e o crescimento da economia seguiriam as taxas médias do período 2000-05. Tentou-se avaliar os efeitos da redução dos índices de intensidade energética e de CO2, mantida a mesma taxa de crescimento econômico e populacional. Neste sentido, nem mesmo no cenário no qual é previsto um maior uso de energias renováveis e de tecnologias voltadas à proteção do meio ambiente, foi possível reduzir os níveis de emissões de CO2 em todos os países.Abstract The main aim of this paper is to evaluate the emissions of carbon dioxide in 2012 as consequence of economic activities in developing countries (South Africa, Argentina, Brazil, China, India and Mexico. To achieve this purpose, we appraise the causes of global warm and the main uses of fossil fuels and how these factors affect the world economy. Then we estimate the CO2 emissions in three alternatives scenarios, using Kaya identity. In the three scenarios was 25consider the economic growth and increase in population equal to period 2000-05. In each scenario, we try to evaluated the effects of reduce the index of energy intensity and CO2. As result, even in the scenario where we simulate major changes in renewable energy and the use of appropriate technologies, it was not feasible to reduce the level of CO2 emission in all the countries.

  19. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  20. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  1. Reproducción de Eisenia foetida en suelos agrícolas de áreas mineras contaminadas por cobre y arsénico Reproduction of Eisenia foetida in agricultural soils from mining areas contaminated with copper and arsenic

    Directory of Open Access Journals (Sweden)

    Gonzalo Ávila

    2007-03-01

    Full Text Available El objetivo del trabajo fue evaluar la toxicidad del cobre y arsénico en suelos agrícolas, mediante bioensayos estandarizados de toxicidad aguda y crónica sobre Eisenia foetida y relacionar la respuesta de ésta con las concentraciones de cobre y arsénico en los suelos. Los suelos agrícolas fueram muestreados en las inmediaciones de áreas mineras en la cuenca del río Aconcagua, Chile. E. foetida expuesta a los suelos estudiados mostró una baja mortalidad, indicando la ausencia de toxicidad aguda. Además, se observó una disminución en la producción de capullos y desarrollo de juveniles, indicando la existencia de toxicidad crónica. Dicha disminución fue relacionada con las concentraciones de cobre y arsénico en los suelos. El cobre y arsénico en conjunto disminuyeron la producción de capullos, mientras que sólo el arsénico disminuyó el desarrollo de juveniles. Suelos agrícolas provenientes de áreas mineras de la cuenca poseen potenciales características tóxicas para el desarrollo de la macrofauna edáfica.The objective of this work was to evaluate copper and arsenic toxicity in agricultural soils, by means of standardized bioassays of chronic and acute toxicity on Eisenia foetida, and to relate E. foetida response to copper and arsenic concentrations in soils. The agricultural soils were sampled in the proximity of copper mining industries, in the Aconcagua river basin, Chile. E. foetida exposed to the studied soils exhibited a low mortality, indicating the absence of acute toxicity. Besides, a decrease in the cocoon production and juvenile development was observed, indicating the existence of chronic toxicity. Reduction in the cocoon production and juvenile development was related to soil concentrations of copper and arsenic. Both copper and arsenic reduced the cocoon production, while only arsenic diminished the juvenile development. Agricultural soils from mining areas of the basin have potentially toxic characteristics

  2. Influence of storage and heating on mother´s milk microbiota Influência do armazenamento e aquecimento na microbiota do leite materno

    Directory of Open Access Journals (Sweden)

    Josefa Gardenas Borrell

    2009-03-01

    , Stapholococcus aureus and Bacillus cereus; microbian rates, even when higher than the ones stablished, did not influence the clinical status of the NB; the breast milk collected, transported and stored under the conditions presented in this study can be safely used up to 24 hours after being stored in a refrigerator at 4°C.RACIONAL: Existe consenso que os recém-natos são particularmente propensos a desenvolverem infecções gastrointestinais devido a múltiplos fatores dentre eles a hipóxia. Há facilidade de colonização anormal e destruição de bactérias com absorção de toxinas. OBJETIVO: Identificar micro-organismos no leite materno depois de estocado em refrigerador a 4°C e também depois do aquecimento, e pesquisar se os sinais laboratoriais encontrados teem alguma correlação clínica. MÉTODOS: As amostras coletadas contemplaram as três fases do leite materno. Em 16 casos, colostro foi obtido como amarelado até a segunda semana do nascimento. Em 14 casos o tipo transicional, entre colostro e leite maduro, ocorreu de sete e 15 dias depois do nascimento. Em 14 casos o leite maduro foi obtido também entre sete e 15 dias. Os diversos tipos foram subdivididos de acordo com o período de conservação e de aquecimento. RESULTADOS: Os micro-organismos que não cresceram foram: Salmonella sp, Molds/leavens e Pseudomonas aeruginosa. Foram observados coliformes totais e fecais. Não ocorreu crescimento bacteriano significativo. Cresceram mesófilos aeróbicos, Staphilococcus aureus e Bacillus cereus. Embora com esses crescimentos, não houve repercussão clínica nos recém-nascidos. CONCLUSÕES: Nas condições propostas neste estudo, não houve crescimento significativo de coliformes fecais, Salmonella sp, Molds/leavens e Pseudomonas aeruginosa; os micro-organismos que cresceram mantiveram-se acima no nível de detecção (mesófilos aeróbicos, coliformes totais, Stapholococcus aureus e Bacillus cereus. As taxas de micro-organismos mesmo sendo mais altas que as

  3. Uma análise do efeito do aquecimento global na produção de batata no Brasil An analysis of the potato production in Brazil upon global warming

    Directory of Open Access Journals (Sweden)

    CA Lopes

    2011-03-01

    Full Text Available Face às prováveis mudanças climáticas afetando as áreas agricultáveis do planeta, foi feita uma revisão bibliográfica sobre os efeitos do aumento da temperatura no metabolismo da planta de batata, enfatizando suas consequências no desenvolvimento vegetativo e na produtividade da cultura. Embora a ênfase maior desse artigo se prenda ao efeito do clima na redução de alimentos, alerta-se ainda para o risco de erosão genética pelo desaparecimento de espécies silvestres, de grande importância para programas de melhoramento genético. A partir dessas informações e de dados climáticos das regiões produtoras publicados em literatura nacional, foi realizada uma análise prospectiva da produção de batata no Brasil. Para tal, tomou-se como base o aumento da temperatura de até 5ºC até o final deste século e uma faixa ótima de produtividade da batata de 10ºC a 25ºC, conforme indicado em literatura especializada. Foram selecionados seis municípios representando as regiões geográficas onde se cultiva a batata: São Joaquim-SC; Guarapuava-PR; Cristalina-GO; Mucugê-BA; Vargem Grande do Sul-SP e Araxá-MG. Para municípios com prevalência de temperaturas mais baixas, como São Joaquim, o aumento de temperatura preconizado não deverá restringir a produção, porém serão necessárias adequações de épocas de plantio. Por outro lado, a situação é preocupante em regiões e épocas de cultivo sujeitas a temperaturas altas, como Mucugê e Cristalina, onde o cultivo deverá se restringir a poucos meses do ano, contrastando com o plantio contínuo, durante o ano todo, ora sendo realizado. O intuito deste artigo é alertar, e não alarmar, a cadeia produtiva de batata no sentido de se preparar para os ajustes fitotécnicos visando a preservar a bataticultura nacional face a um eventual aquecimento global. Considerações sobre o melhoramento genético para atenuar, pelo menos em parte, esta situação é discutida.The future of

  4. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  5. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  6. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L.) sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L.) under air exposure stress

    OpenAIRE

    Roberta Dias da Silva; Laudicéia Oliveira Rocha; Bruno Duarte Alves Fortes; Dirson Vieira; Maria Clorinda Soares Fioravanti

    2012-01-01

    No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus) sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM), a hemoglobina corpuscular média (HCM), a concentração de hemoglobina corpuscular média (CHCM), o leucograma, contagem diferencial de l...

  7. Analysis of the electric heating conventional system replacement by the solar heating in day-care centers at Poco de Caldas - MG; Analise da substituicao de sistema convencional de aquecimento eletrico por aquecimento solar em creches em Pocos de Caldas -MG

    Energy Technology Data Exchange (ETDEWEB)

    Dantas, Carlos Tadeu [Escola Tecnica Limassis, Delfim Moreira, MG (Brazil); Mariotoni, Carlos Alberto [Universidade Estadual de Campinas, SP (Brazil)

    2006-07-01

    Located in the South of Minas Gerais, average altitude of 1186 m and population about 170.000 inhabitants Pocos de Caldas is one of the most developed tourist cities of Minas Gerais. Beyond this quality, that makes it one of the best cities in quality of life in Brazil, measured for the HDI, the city presents an enviable educational polar region comparing to cities of the south region. With 91 institutions of education, from children's education to superior education, Pocos de Caldas has more than 49,000 students today. From this scholar population, 1870 pupils represent the children's education in particular or municipal day-care centers, called CEI. Pocos de Caldas has its own generation of energy through the Municipal Department of Electricity, DME. The energy production today arrives the house of 58 MW reaching 100% of the population in 2005. The analysis of the substitution of conventional system of electric heating for solar heating in day-care centers has left of an unknown project, with the objective to minimize the consumption of energy unfastened during the children's baths who stay at CEI. In this context, this work presents a study carried through this project, after the implantation of the related system in four of the eleven day-care centers that the initial project composes. The data had been collected in the DME and the City department of Education. The pathological manifestations in the points of water consumption of the related day-care centers as well as the state of conservation of the systems of implanted solar heating had been investigated also. (author)

  8. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  9. Limpeza da superfície de corte de rebolos por um sistema de ar comprimido na retificação cilíndrica externa de mergulho de materiais cerâmicos refrigerados com a técnica da mínima quantidade de lubrificante (MQL Grinding wheel surface cleaning using a compressed air system, in external plunge grinding of ceramics using the minimum quantity lubricant (MQL technique

    Directory of Open Access Journals (Sweden)

    E. C. Bianchi

    2012-06-01

    Full Text Available Nos processos de retificação, a utilização de fluidos de corte é uma maneira de implementar a qualidade final do processo, pois os fluidos têm como finalidade a lubrificação na área de contato entre a peça e ferramenta e a refrigeração das superfícies, assim evitando danificações na superfície da peça. Com isso, a utilização de fluidos de corte tem sido constantemente estudada, visando diminuir a utilização deste, pois a utilização de fluidos de corte tem seus problemas. O custo do produto final aumenta consideravelmente com o uso de fluidos de corte no processo de retificação, além de que os fluidos de corte são substâncias tóxicas e nocivas tanto às pessoas quanto ao meio ambiente. Portanto, indústrias, universidades e centros de pesquisas são levados a pesquisar métodos alternativos menos prejudiciais ao meio ambiente. Dentre as alternativas surge a técnica da mínima quantidade de lubrificante (MQL, que também tem suas desvantagens, como por exemplo, a formação de um borra de óleo na superfície de corte do rebolo, o que gera uma rugosidade maior na peça. Porém, visando minimizar o problema da formação da borra de óleo podem ser usados jatos de ar comprimido incidindo na superfície de corte do rebolo, com o objetivo de limpar a mesma. Este estudo será feito através da análise da avaliação das variáveis de saída do processo de retificação externa, como o comportamento da rugosidade superficial e dos desvios de circularidade. Através dos resultados obtidos pretende-se estudar a técnica do MQL, visando melhorá-la através da limpeza da superfície de corte do rebolo com jatos de ar comprimido.In grinding, the use of cutting fluids aims to improve the final quality of the process, because their purpose is to lubricate the contact area between workpiece and tool and the surface cooling, thus avoiding damages on the machined part. Therefore, this subject has been constantly studied, in order

  10. Occurrences of Excess 40Ar in Hydrothermal Tourmaline:Interpretations from 40Ar-39Ar Dating Results by Stepwise Heating

    Institute of Scientific and Technical Information of China (English)

    QIU Huaning; PU Zhiping; DAI Tongmo

    2007-01-01

    The occurrences of excess 40Ar within a hydrothermal tourmaline is discussed in term of the analysis data of syngenetic muscovite and tourmaline from the Lushui hydrothermal tin-tungsten deposit in western Yunnan, China, using the 40Ar-39Ar stepwise heating technique. About 80% excess 40Ar was released in the last step when the tourmaline was fused, corresponding to a release of only ~3% 39Ar (K), which indicates that most excess 40Ar was held in the mineral lattice rather than in the channels parallel to the Z-axis. This suggests that the excess 40Ar was incorporated during crystallization and not diffused into the tourmaline during the post-crystallization history.

  11. Remoção dos compostos odoríferos geosmina e 2-metilisoborneol de águas de abastecimento através de processos de aeração em cascata, dessorção por ar e nanofiltração Removal of the odoriferous compounds geosmin and 2-methylisoborneol from drinking water by the processes of cascade aeration, air strippingand nanofiltration

    Directory of Open Access Journals (Sweden)

    Michely Zat

    2011-12-01

    Full Text Available Atividades humanas aceleram o processo natural de eutrofização das águas, favorecendo a floração de algas e cianobactérias. Estes organismos emitem os compostos 2-metilisoborneol (MIB e geosmina, que conferem gosto e odor de mofo e terra à água. A presença destes compostos se estende à água potável uma vez que os processos convencionais de tratamento são insuficientes para removê-los. Esta pesquisa foi realizada com o objetivo de avaliar alternativas de processos de tratamento para a remoção de MIB e geosmina da água. Os processos estudados foram aeração em cascata, dessorção por ar e nanofiltração. Os resultados sugerem a possibilidade de remoção quase total de MIB e geosmina da água através do sistema de nanofiltração, enquanto que os processos baseados em aeração e dessorção foram relativamente ineficientes.Human activities accelerate the natural process of eutrophication, favouring the occurrence of algae and cyanobacterial blooms. These organisms emit the compounds 2-methylisoborneol (MIB and geosmin, which confer earthy and moldy taste and odor to water. The presence of MIB and geosmin is extended to drinking water inasmuch they are not completely removed by the processes used in conventional treatment. This research was conducted to evaluate the capability of alternative treatment processes to remove MIB and geosmin from water. The processes studied were cascade aeration, air stripping, and nanofiltration. The results suggested that MIB and geosmin can be almost completely removed by nanofiltration, while the processes based on aeration and stripping were relatively inefficient.

  12. Behaviour of AR glass fibre for building structural applications

    Directory of Open Access Journals (Sweden)

    Miravete, A.

    2005-12-01

    Full Text Available The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be used as reinforcement of organic matrix composite materials, broadening the range of structural applications. The mechanical properties of AR glass fibre and organic matrix composite materials will be studied in this paper. First, the behaviour of this material under stress corrosion will be analysed. Their mass loss will be compared to E, C, and boron free glass fibres. Second, an experimental study dealing with 3P test bending and short beam ofAR glass fibre/polyester will de described with the goal of obtaining their Young modulus and tensile and interlaminar shear strengths. Finally, these experimental results will be compared to E glass fibre/polyester and several conclusions about their structural applications will be drawn.

    El vidrio AR y su presentación en forma de fibras de refuerzo, fue diseñado para ser inerte a los álcalis de los cementos. Por este motivo se viene utilizando desde hace varias décadas como refuerzo de morteros y hormigones en forma de fibra corta. El ensimaje que estas fibras de vidrio de refuerzo A R presentaba en su origen no era compatible con resinas de tipo sintéticas, por lo que el refuerzo era exclusivo para cementos y hormigones fuera cual fuera la aplicación, formato o proceso productivo. Recientemente, gracias al desarrollo específico de ensimajes especiales acordes a las fibras de vidrio AR ha aparecido la misma tipología de vidrio AR como refuerzo en forma de fibra continua compatible con resinas sint

  13. ANÁLISE DE DIFERENTES VISCOSIDADES A PARTIR DA APLICAÇÃO DO AQUECIMENTO GERAL INDIRETO COMO MÉTODO DE RECUPERAÇÃO EM RESERVATÓRIOS PETROLÍFEROS

    OpenAIRE

    Elthon John Rodrigues Medeiros; Raimundo Nonato de Medeiros Júnior; Janusa Soares de Araújo; Jennys Lourde Meneses Barillas; Tarcílio Viana Dutra Junior; Wilson da Mata

    2011-01-01

    Cada barril de petróleo é relevante e até os campos produtores de difícil acesso têm importância. O petróleo viscoso e os baixos níveis de pressão nos reservatórios rasos dificultam a recuperação. O principal método de recuperação aplicado a esse tipo de petróleo é a injeção de vapor. O Aquecimento Geral Indireto - AGI (Blanket Heating) é uma técnica que utiliza a injeção de vapor através de canalizações horizontais. O fluido aquecido funciona como um trocador de calor, transferindo indiretam...

  14. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    , but more precise (±0.10%) than, the previous 40Ar/39Ar age determined by intercalibration with astronomically tuned tephras from the Melilla Basin (Morocco). Using this proposed age for FCs, combined with measurements using the A1Ts as the neutron fluence monitor, a weighted mean Bishop Tuff 40Ar/39Ar...

  15. Consumo de arsénico y riesgo cardiovascular

    Directory of Open Access Journals (Sweden)

    Lachiner Saborío Morales

    2015-03-01

    Full Text Available El arsénico (As es un elemento considerado como ubicuo, cuyas fuentes pueden ser naturales o productos de la actividad humana. La exposición a este elemento ocurre principalmente por la vía oral. Las presentaciones inorgánicas del As son consideradas como las más tóxicas. La absorción del As ocurre en el intestino delgado y por medio de acuaporinas ingresa a los hepatocitos, en casos de ingesta crónica el As tiende acumularse en hígado, riñones, corazón, sistema nervioso, pulmones, músculo, tracto gastrointestinal y bazo. El consumo crónico de agua con concentraciones de As por encima del valor de referencia dado por la Organización Mundial de la Salud (OMS ha demostrado un aumento del riesgo de accidentes vasculares cerebrales (AVC, hipertensión arterial (HTA, aterosclerosis carotidea, enfermedades arteriales periféricas, mortalidad por infarto agudo del miocardio (IAM, aumento en enfermedades cardiovasculares en la población pediátrica y diabetes mellitus tipo II.

  16. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  17. PF-AR upgrading project

    CERN Document Server

    Kasuga, T

    2002-01-01

    The upgrading project of the dedicated pulse X-ray source PF-AR has been completed by the end of the 2001 fiscal year. Machine commissioning exclusively using the injector linac was successfully accomplished in the beginning of January 2002. After fine tuning of the machine and cleaning of the vacuum system with the beams from the middle of January to the middle of March, routine operation for users has begun in April. The historical details, commissioning and results of the project are reported. (author)

  18. Aquecimento de vinho tinto e suco de uva utilizados em preparações culinárias não afeta a capacidade antioxidante e o teor de fenóis totais Heating of red wine and grape juice in food preparations does not affect their antioxidant capacity and total phenol content

    Directory of Open Access Journals (Sweden)

    Jeanine Schütz Cardoso Teófilo

    2011-02-01

    Full Text Available OBJETIVO: Avaliar a capacidade antioxidante e a concentração dos compostos fenólicos de vinho tinto e suco de uva utilizados em preparações culinárias, quando submetidos ao processo de fervura. Métodos: A avaliação ocorreu após diferentes períodos de aquecimento (100°C em dois sistemas: i panela de alumínio e chama de fogão e ii balão de vidro e manta térmica. Amostras comerciais de vinho tinto (n=4 e suco de uva integral (n=4 foram submetidas à fervura por 10, 20 e 60 minutos. Antes e após cada período de fervura, a capacidade antioxidante total foi avaliada pela medida do potencial redutor férrico, e o teor de fenóis totais foi quantificado pelo método de Folin-Ciocalteau. As diferenças foram comparadas pela análise de variância para medidas repetidas (pObjective: This study evaluated the antioxidant capacity and concentration of phenolic compounds in red wine and grape juice used in culinary preparations subjected to boiling. Methods: The assessments were done after different boiling times (100°C using two systems: i aluminum pot and stove flame and ii volumetric flask and heating mantle. Samples of red wine (n=4 and grape juice (n=4 were subjected to boiling for 10, 20 and 60 minutes. Before and after each boiling period, the total antioxidant capacity was evaluated by the ferric reducing antioxidant power assay and the total phenol content was determined by the Folin-Ciocalteu reagent. Differences were compared by repeated measures analysis of variance (RM-ANOVA (p<0.05. Results: The different boiling times did not cause significant changes in the total antioxidant capacity or total phenol content of the beverages, regardless of boiling method. Conclusion: The results show that the antioxidant properties of red wine and grape juice did not change significantly after boiling for 60 minutes.

  19. Characterization of bacteriocins produced by Lactococcus lactis strains Caracterização de bacteriocinas produzidas por linhagens de Lactococcus lactis

    Directory of Open Access Journals (Sweden)

    Izildinha Moreno

    2000-09-01

    Full Text Available Bacteriocins produced by fifteen strains of Lactococcus lactis (14 L. lactis subsp. lactis and one L. lactis subsp. cremoris were heat resistant, sensitive to several proteolytic enzymes and active over a wide range of pH. Their resistance to the heating was greatly influenced by the pH. Only the strain L. lactis subsp. lactis ITAL 383 produced a bacteriocin with a wide activity spectrum, similar to nisin of L. lactis subsp. lactis ATCC 11454. This bacteriocin inhibited closely related species and other Gram-positive microorganisms including Listeria monocytogenes and Staphylococcus aureus, but it was not active against the Gram-negative bacteria tested. The identification of partially purified antimicrobial compounds by SDS-PAGE showed that bacteriocin produced by strain ITAL 383 had the same molecular weight of nisin produced by L. lactis subsp. lactis ATCC 11454.Bacteriocinas resistentes ao aquecimento produzidas por quinze linhagens de Lactococcus lactis (14 L. lactis subsp. lactis e 1 L. lactis subsp. cremoris foram sensíveis à enzimas proteolíticas e ativas em uma ampla faixa de pH. A resistência dessas bacteriocinas ao aquecimento foi fortemente influenciada pelo pH do meio. Somente a linhagem L. lactis subsp. lactis ITAL 383 produziu uma bacteriocina com um amplo espectro de atividade, semelhante ao da nisina de L. lactis subsp. lactis ATCC 11454. Esta bacteriocina inibiu as espécies relacionadas e outros microorganismos gram-positivos, inclusive Listeria monocytogenes e Staphylococcus aureus, mas não as bactérias Gram-negativas examinadas. A identificação do composto antimicrobiano parcialmente purificado por SDS-PAGE revelou um peso molecular similar entre a bacteriocina ITAL 383 e a nisina de L. lactis subsp lactis ATCC 11454.

  20. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  1. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  2. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian....... XRD-data indicated that some mineral separates prepared for Ar-Ar stepwise heating analysis were monomineralic, whereas others were composed of two white micas (muscovite with paragonite or margarite), or biotite and chlorite. In monomineralic samples 37Ar/39Ar and 38Ar/39Ar (proportional to Ca....../K and Cl/K ratios) did not change and the resulting ages can be interpreted unambiguously. In mineral separates containing two white micas, Ca/K and Cl/K ratios were variable, reflecting non-simultaneous laboratory degassing of the two heterochemical Ar-reservoirs. These ratios were used to identify each...

  3. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L. sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L. under air exposure stress

    Directory of Open Access Journals (Sweden)

    Roberta Dias da Silva

    2012-12-01

    Full Text Available No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM, a hemoglobina corpuscular média (HCM, a concentração de hemoglobina corpuscular média (CHCM, o leucograma, contagem diferencial de leucócitos, o plaquetograma, a glicose, a proteína total, o colesterol, o triglicerídeo e os eletrólitos (cálcio, cloretos, sódio e potássio. Os resultados revelaram que houve uma homogeneidade de distribuição para hemácias, volume globular, hemoglobina, índices hemantimétricos, proteína total, glicose, colesterol, e íons séricos, indicados pelos valores relativamente baixos do coeficiente de variação. Houve correlação positiva somente para leucócitos totais, células de defesa orgânica (neutrófilos e linfócitos, glicose, colesterol, sódio e cálcio. Quanto ao leucograma, à medida que os animais foram expostos ao ar, o número de leucócitos diminuiu gradativamente (leucopenia, ocorrendo simultaneamente neutrofilia e linfopenia. O índice glicêmico constituiu um bom indicador de estresse fisiológico, devido à hiperglicemia (82,0±20,88mg/dL demonstrada nos tratamentos. A exposição ao ar constituiu um fator de desequilíbrio na homeostase iônica, e na síntese de colesterol endógeno. Entretanto, o tempo de recuperação não ocasionou a completa reabilitação fisiológica frente ao desafio imposto.The present study evaluated the hematological and biochemical parameters of adult tilapia (Oreochromis niloticus under the influence of the physiological stress factor in animals submitted to air exposure during fattening in raceway system. Blood cell count, hemoglobin, hematocrit, mean corpuscular volume (MCV, mean

  4. 40Ar/39Ar Interlaboratory Calibration into the Holocene.

    Science.gov (United States)

    Heizler, M. T.; Jicha, B.; Koppers, A. A. P.; Miggins, D. P.

    2015-12-01

    Advances in 40Ar/39Ar analytical precision for very young rocks requires collaborative efforts amongst argon geochronology labs to demonstrate age reproducibility commensurate with high precision. NM Tech (NMT), the University of Wisconsin (UW) and Oregon State University (OSU) have each dated Quaternary flux monitor standard AC-2 sanidine (~1.185 Ma), a blind sanidine described as being 50-100 ka (BS) and sanidine from the Qixiangshan (QIX) flow (~10 ka), Changbaishan volcano, China. The samples were irradiated in a single package with FC-2 sanidine (28.201 Ma) as the flux monitor and the irradiated material was distributed amongst the labs. Heizler was present during analysis at both OSU and UW and Jicha attended OSU during analysis. Physical presence was key towards gaining understanding of individual protocols and prompted valuable discussions. Analyses were carried out on single crystals using total fusion and/or step heating approaches. Age agreement was achieved within 2s uncertainty that ranged between (0.03-0.3%, 0.13-0.37% and 1.8-2.6%) for AC-2, BS and QIX, respectively. Each lab found AC-2 to vary somewhat beyond a normal distribution and to yield an age relative to FC-2 of ~1.185 Ma that is ~1.3% (~5-10 sigma) lower than some published estimates. A key cause of the variation between this study and previous results may be variable gas pressure equilibration times between extraction line and mass spectrometer coupled with variable choices to estimate time zero by other laboratories. The majority of our efforts concentrated on the QIX sanidine where prior data obtained by our labs revealed a factor of two spread in age (~11 and 23 ka) based on experiments carried out by total fusion and bulk incremental heating. By conducting single crystal age spectrum analysis we were able to mitigate effects of melt inclusion hosted excess argon and xenocrystic contamination towards obtaining analytical agreement with apparent ages near 10 ka. However, philosophical

  5. Estudio de daños genotóxicos y teratogénicos en pez cebra (danio rerio Hamilton, 1822) por acumulación del nivel de arsénico presente en el agua de Zimapán, Hidalgo

    OpenAIRE

    Baéz Ramírez, Oliveria Araceli

    2005-01-01

    Se estudiaron los daños genotóxicos (inducción de micronúcleos en células de las branquias) y teratogénicos en el pez cebra (danio rerio), causados por la exposición a niveles subcrónicos de As en agua. Los peces se estudiaron en agua de un pozo de referencia y del pozo "Zimapán 5", el segundo con un contenido de As que varía de 395 a 630 µg/L. Para el estudio genotóxico los especímenes fueron observados durante 180 días en 3 lotes separados con 55 animales/lote: uno con agua del pozo de refe...

  6. Optimization of a computer simulation code to analyse thermal systems for solar energy water heating; Aperfeicoamento de um programa de simulacao computacional para analise de sistemas termicos de aquecimento de agua por energia solar

    Energy Technology Data Exchange (ETDEWEB)

    Pozzebon, Felipe Barin

    2009-02-15

    The potential of solar water heating systems through solar energy in Brazil is excellent due to the climatic features of the country. The performance of these systems is highly influenced also by the materials used to build it and by the dimension of its equipment and components. In face of global warming, solar energy gains more attention, since it is one of the renewable energy that will be largely used to replace some of the existing polluting types of energy. This paper presents the improvement of a software that conducts simulations of water heating systems using solar energy in thermosyphon regime or forced circulation. TermoSim, as it is called, was initiated at the Solar Labs, and is in its version 3.0. The current version is capable of simulating 6 different arrangements' possibilities combined with auxiliary energy: systems with solar collectors with auxiliary energy with gas, electric energy, internal electric energy, electric energy in series with the consumption line, and no auxiliary energy. The software is a tool to aid studies and analysis of solar heating systems, it has a friendly interface that is easy to comprehend and results are simple to use. Besides that, this version also allows simulations that consider heat losses at night, situation in which a reverse circulation can occur and mean efficiency loss, depending on the simulated system type. There were many simulations with the mathematical models used and comparisons were made with the climatic data of the city of Caxias do Sul, in Rio Grande do Sul state, in Brazil, determining the system with the most efficient configuration for the simulated water consume profile. The paper is finalized with simple economic analyses with the intention of foreseeing the time for payback on the investment, taking into account the current prices for electrical energy in the simulated area and the possible monthly economy provided with the use of a solar energy heating system. (author)

  7. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  8. Study of the symbiotic star AR Pavonis

    Directory of Open Access Journals (Sweden)

    C. Quiroga

    2001-01-01

    Full Text Available We present a study of the optical spectra and linear polarization of the eclipsing binary AR Pavonis. The optical spectra were obtained between 1990 and 1998, and polarimetric data between 1995 and 1998. From spectroscopic variations along the orbital motion we analized the nature of the system. Polarimetric studies indicate that AR Pav has intrinsic polarization.

  9. Umidificação e aquecimento do gás inalado durante ventilação artificial com baixo fluxo e fluxo mínimo de gases frescos

    Directory of Open Access Journals (Sweden)

    Gorayb Susane Bruder Silveira

    2004-01-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Em pacientes sob intubação traqueal ou traqueostomia, a umidificação e o aquecimento do gás inalado são necessários para a prevenção de lesões no sistema respiratório, conseqüentes ao contato do gás frio e seco com as vias aéreas. O objetivo da pesquisa foi avaliar o efeito do sistema respiratório circular com absorvedor de dióxido de carbono do aparelho de anestesia Cícero da Dräger, quanto à capacidade de aquecimento e umidificação dos gases inalados, utilizando-se fluxo baixo (1 L.min-1 ou mínimo (0,5 L.min-1 de gases frescos. MÉTODO: O estudo aleatório foi realizado em 24 pacientes, estado físico ASA I, com idades entre 18 e 65 anos, submetidos à anestesia geral, utilizando-se a Estação de Trabalho Cícero da Dräger (Alemanha, para realização de cirurgias abdominais, os quais foram distribuídos aleatoriamente em dois grupos: grupo de Baixo Fluxo (BF, no qual foi administrado 0,5 L.min-1 de oxigênio e 0,5 L.min-1 de óxido nitroso e fluxo mínimo (FM, administrando-se somente oxigênio a 0,5 L.min-1. Os atributos estudados foram temperatura, umidade relativa e absoluta da sala de operação e do gás no sistema inspiratório. RESULTADOS: Os valores da temperatura, umidade relativa e umidade absoluta no sistema inspiratório na saída do aparelho de anestesia e junto ao tubo traqueal não apresentaram diferença significante entre os grupos, mas aumentaram ao longo do tempo nos dois grupos (BF e FM, havendo influência da temperatura da sala de operação sobre a temperatura do gás inalado, nos dois grupos estudados. Níveis de umidade e temperatura próximos dos ideais foram alcançados, nos dois grupos, a partir de 90 minutos. CONCLUSÕES: Não há diferença significante da umidade e temperatura do gás inalado utilizando-se baixo fluxo e fluxo mínimo de gases frescos.

  10. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  11. Revised error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, Pieter

    2015-12-01

    The main advantage of the 40Ar/39Ar method over conventional K-Ar dating is that it does not depend on any absolute abundance or concentration measurements, but only uses the relative ratios between five isotopes of the same element -argon- which can be measured with great precision on a noble gas mass spectrometer. The relative abundances of the argon isotopes are subject to a constant sum constraint, which imposes a covariant structure on the data: the relative amount of any of the five isotopes can always be obtained from that of the other four. Thus, the 40Ar/39Ar method is a classic example of a 'compositional data problem'. In addition to the constant sum constraint, covariances are introduced by a host of other processes, including data acquisition, blank correction, detector calibration, mass fractionation, decay correction, interference correction, atmospheric argon correction, interpolation of the irradiation parameter, and age calculation. The myriad of correlated errors arising during the data reduction are best handled by casting the 40Ar/39Ar data reduction protocol in a matrix form. The completely revised workflow presented in this paper is implemented in a new software platform, Ar-Ar_Redux, which takes raw mass spectrometer data as input and generates accurate 40Ar/39Ar ages and their (co-)variances as output. Ar-Ar_Redux accounts for all sources of analytical uncertainty, including those associated with decay constants and the air ratio. Knowing the covariance matrix of the ages removes the need to consider 'internal' and 'external' uncertainties separately when calculating (weighted) mean ages. Ar-Ar_Redux is built on the same principles as its sibling program in the U-Pb community (U-Pb_Redux), thus improving the intercomparability of the two methods with tangible benefits to the accuracy of the geologic time scale. The program can be downloaded free of charge from

  12. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  13. 40Ar/39Ar and K-Ar data bearing on the metamorphic and tectonic history of western New England.

    Science.gov (United States)

    Sutter, J.F.; Ratcliffe, N.M.; Mukasa, S.B.

    1985-01-01

    40Ar/39Ar ages of coexisting biotite and hornblende from Proterozoic Y gneisses of the Berkshire and Green Mt massifs, as well as 40Ar/39Ar and K/Ar mineral and whole-rock ages from Palaeozoic metamorphic rocks, suggest that the thermal peaks for the dominant metamorphic recrystallization in western New England occurred 465 + or - 5 m.y. (Taconian). 40Ar/39Ar age data from a poorly-defined terrain along the eastern strip of the area suggests that the area has been retrograded during a metamorphism that peaked at least 376 + or - 5 m.y. (Acadian). Available age and petrological data from western New England indicate the presence of at least three separate metamorphic-structure domains of Taconic age: 1) a small area of relict high-P and low-T metamorphism, 2) a broad area of normal Barrovian metamorphism from chlorite to garnet grade characterized by a gentle metamorphic gradient and, 3) a rather narrow belt of steep-gradient, Barrovian series metamorphic rocks. Areas of maximum metamorphic intensity within the last domain coincide with areas of maximum crustal thickening in the later stage of Taconic orogeny. -L.di H

  14. Influência do aquecimento sobre diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei (Boone, 1931 = Influence of heating under different titration methods of residual SO2 on shrimps Litopenaeus vannamei (Boone, 1931

    Directory of Open Access Journals (Sweden)

    Karla Patrícia Brito de Araújo Vieira

    2008-01-01

    Full Text Available O metabissulfito de sódio é o conservante mais aplicado na carcinicultura, com uso amparado em legislações vigentes no país, todavia, seu resíduo, dióxido de enxofre (SO2, em concentrações altas, pode provocar reações adversas à saúde. Este estudo foidesenvolvido com a finalidade de observar a influência do aquecimento sob diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei. Os camarões foram submetidos a nove concentrações de metabissulfito de sódio e avaliados com diferentesmétodos de detecção de SO2. O método da titulação Adolfo Lutz adaptado apresentou grande sensibilidade para detecção de SO2 residual. O método da titulação iodométrica com aquecimento possibilitou a detecção de maiores níveis de SO2, quando comparado aométodo sem o aquecimento. O aquecimento interferiu negativamente no método da fita reativa. Conclui-se que o aquecimento influenciou positivamente a titulação iodométrica, não ocorrendo o mesmo com a fita reativa.Sodium metabisulfite is the most applied preservative in shrimp culture, with its use supported by current legislation; however, its residue, sulfur dioxide (SO2, in high concentrations can provoke adverse health reactions. This study evaluated the influence of heating under different methods of residual SO2 titration in Litopenaeus vannamei. Shrimps were treated with nine concentrations of sodium metabisulfite and evaluated by different methods of SO2 titration. The adapted Adolfo Lutz titration method presented the highest sensitivity for the detection of SO2. The method of iodometric titration with heating made possible the detention ofhigher levels of SO2, when compared to the same method without heating. The heating influenced negatively on the reactive ribbon method. It is concluded that the heating influenced positively on the iodometric titration, as opposed to the reactive ribbon.

  15. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  16. Spatial evaluation of Ar-systematics in rocks from the British Channel Islands: a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Sherlock, S.; Kelley, S. P.

    2010-12-01

    The Ar-Ar method is a powerful tool for constraining thermal histories of metamorphic and plutonic rocks, most commonly undertaken on potassium rich mineral separates rather than whole rocks. While this approach usually yields reasonable thermal histories, it is rarely as precise as dating volcanics, and such rocks are also frequently contaminated by excess argon, artificially elevating the Ar-Ar ages. Understanding the evolution of excess argon represents a challenge; whilst it is possible to discern the ‘sink’ as the host mineral now contaminated by excess argon, examining the ‘source’ and ‘transport’ mechanism is more challenging. The approach we have taken here is to combine measurements of potassium rich and potassium poor minerals to understand the argon reservoirs and argon transfer between minerals, grain boundaries and fluids. Considering the system as a whole provides a method for understanding the complete history of the rock and thus assessing any interactions which may impact on the interpretation of ages and thermal history [Kelley, 2002, Chem. Geol. 188]. Here we have studied a series of plutonic and metamorphic basement samples from the British Channel Islands with different ages and post-emplacement histories, namely Icart Gneiss, Perelle Quartz Diorite, L’Ancresse Granodiorite, and Bordeaux Diorite. The formation age of Icart Gneiss is ~2000 Ma [D’Lemos et al., 1990, Geol. Soc. Spec. Pub. 51]. Ar-Ar ages of hornblendes and biotites from quartz diorites on Guernsey and Sark range between 606 and 596 Ma [Dallmeyer et al. 1991, J. Geol. Soc. London 148], whilst U-Pb zircon ages are in the range 710 to 613 Ma [Dallmeyer et al. 1991; Samson & D’Lemos 1998, J. Geol. Soc. London 155; Miller et al. 1999, Tectonophysics 132]. Detailed petrograpic (microscope, electron microprobe) investigations established the crystallization and deformation history of the samples, and revealed that post-magmatic alteration is unevenly distributed. This

  17. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  18. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  19. Progreso y retos de la geocronología 40Ar/39Ar en Costa Rica y Nicaragua Progress and Challenges Using 40Ar/39Ar Geochronology in Costa Rica and Nicaragua

    Directory of Open Access Journals (Sweden)

    Ian Saginor¹

    2011-12-01

    Full Text Available Con el principal objetivo de realizar mejores cálculos de la producción volcánica, en el Arco Volcánico de América Central, realizamos 61 dataciones 40Ar/39Ar en tefras y lavas en localidades de frente volcánico de Costa Rica y Nicaragua por medio de varias campañas de campo y análisis de laboratorio (preparación de muestras, envió al reactor nuclear, espectroscopía de masas de las muestras radiactivas, al laboratorio de gases nobles del Departamento de Ciencias de la Tierra y Planetarias de la Universidad Rutgers del 2002-2008. En este artículo presentamos diferentes observaciones que resultaron de este estudio donde se describe la precisión, exactitud y la confiabilidad de las edades 40Ar/39Ar. El primer resultado muestra las limitaciones de esta técnica en muestras baja en K2O con edades To better estimate the extrusive flux of the Central American Arc, from 2002-2008, we obtained sixty one high precision 40Ar/39Ar ages on geographically well-situated lavas and tephra from Costa Rica and Nicaragua. Here, we describe a number of observations encountered during this study using four examples that well document the precision, accuracy and general reliability of the 40Ar/39Ar ages. First, low K2O values, particularly in samples from Nicaragua, is a major limitation in or attempts to obtain reliable dates on samples under 1 My. Second, extensive weathering of samples due to the tropical climate of Central America has resulted in various levels of argon loss even when the hand sample appeared unaltered. Third, our field and geochronological data lead us to conclude that eruptive rates have not been constant over the past 15 to 20 My, but rather appears punctuated by gaps of up to several million years. We attempted to address the temporal gaps in several ways. First, geochemical analyses were used to identify samples that may have erupted during time periods without known volcanism. For example, U/Th values in the active Central

  20. Protocolo de Quioto e as possibilidades de inserção do Brasil no Mecanismo de Desenvolvimento Limpo por meio de projetos em energia limpa The Kyoto Protocol and the possibilities for the insertion of Brazil at the Clean Development Mechanism through projects in clean energy

    Directory of Open Access Journals (Sweden)

    Helena Margarido Moreira

    2008-04-01

    Full Text Available Este artigo pretende estudar a inserção do Brasil no Mecanismo de Desenvolvimento Limpo (MDL do Protocolo de Quioto, por meio de projetos em energia limpa, enfatizando a cooperação entre países desenvolvidos e em desenvolvimento e visando as ações práticas que esse mecanismo permite desenvolver para se alcançar o desenvolvimento sustentável e para conter o aquecimento global. Para isto, realizou-se extensa revisão bibliográfica dos acordos internacionais referentes às mudanças climáticas e de livros e artigos sobre a inserção brasileira no Protocolo de Quioto e no Mecanismo de Desenvolvimento Limpo. O Protocolo de Quioto é um acordo internacional que prevê a redução das emissões de gases de efeito estufa por intermédio de mecanismos flexibilizadores. O Mecanismo de Desenvolvimento Limpo é o único que permite a participação de países em desenvolvimento, para que eles reduzam emissões por meio de projetos que busquem o desenvolvimento sustentável. Neste contexto, o Brasil surge como um país atrativo para o recebimento destes projetos, por sua vocação para desenvolver fontes alternativas de energia e pela sua liderança no processo negociador do Protocolo. O MDL configura-se, portanto, em uma grande oportunidade para o Brasil, visto que esses projetos representam uma fonte de recursos financeiros para que o país busque o desenvolvimento sustentável, além de incentivarem um maior conhecimento científico e a adoção de novas tecnologias.This article intends to study the insertion of Brazil at the Clean Development Mechanism (CDM of the Kyoto Protocol, through clean energy projects, emphasizing the cooperation between developed and developing countries, and aiming the practical actions that this mechanism allows to build up in order to reach the sustainable development and to stop the global warming. To achieve this, an intense bibliographic review of the international agreements concerning climate change, and

  1. Quantificação das Emissões de Gases Efeito Estufa – GEEs – Segundo Matriz Energética Diesel ou GNV no Transporte Público por Ônibus em NATAL–RN

    OpenAIRE

    Ricardo Teixeira Gregório Andrade; Enilson Medeiros dos Santos

    2010-01-01

    Dentre os contribuintes à poluição atmosférica mundial, o setor de transportes é responsável por considerável montante de emissões de gases poluentes. As emissões de gases poluentes causam uma gama de prejuízos sanitários, ambientais e, portanto, econômicos. Face à temática do aquecimento global e ao contexto do ganho de créditos de carbono via projetos tipo Mecanismo de Desenvolvimento Limpo (MDL), mostram-se favoráveis os estudos que possibilitem mitigar tais emissões e conseqüentes prejuíz...

  2. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  3. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  4. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  5. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  6. Differential AR algorithm for packet delay prediction

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different delay prediction algorithms have been applied in multimedia communication, among which linear prediction is attractive because of its low complexity. AR (auto regressive) algorithm is a traditional one with low computation cost, while NLMS (normalize least mean square) algorithm is more precise. In this paper, referring to ARIMA (auto regression integrated with moving averages) model, a differential AR algorithm (DIAR) is proposed based on the analyses of both AR and NLMS algorithms. The prediction precision of the new algorithm is about 5-10 db higher than that of the AR algorithm without increasing the computation complexity.Compared with NLMS algorithm, its precision slightly improves by 0.1 db on average, but the algorithm complexity reduces more than 90%. Our simulation and tests also demonstrate that this method improves the performance of the average end-to-end delay and packet loss ratio significantly.

  7. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  8. Estudio del sistema simbiótico AR Pavonis

    Science.gov (United States)

    Quiroga, C.; Brandi, E.; Ferrer, O.; García, L.; Barbá, R.

    Se presenta un estudio espectroscópico y polarimétrico de la binaria eclipsante AR Pavonis a partir de observaciones obtenidas con el telescopio de 2.15 m. del CASLEO (San Juan). El estudio de la naturaleza del sistema se realizó a través del análisis de algunos espectros reunidos entre los años 1990 y 1995 y de datos polarimétricos correspondientes al intervalo 1995 y 1997. El análisis espectroscópico indica que AR Pav está compuesta por una gigante roja M3.7 y una componente caliente compacta, con una temperatura mayor a 90000 K y una luminosidad del orden de 500Lsolar. A lo largo del período orbital, las variaciones observadas en flujo y en velocidades radiales, reflejan que las emisiones permitidas se forman en una región que rodea la componente caliente. El estudio de la polarización lineal de AR Pav indica que además de una componente interestelar, existe una componente intrínseca del sistema que varía temporalmente y con la longitud de onda de la luz polarizada. El distinto comportamiento del grado de polarización y del ángulo de posición observado en fases diferentes, sugiere que distintos mecanismos pueden estar actuando, dependiendo de la región de scattering observado a lo largo de la línea de la visual.

  9. The mass of $^{32}Ar$ and $^{33}Ar$ for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides ^32Ar (T_1/2=98 ms) and ^33Ar (T_1/2=173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10_-8 (deltam=1.8 keV) and 1.4 x 10_-8 (deltam=0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaric-multiplet mass equation IMME. Furthermore, the improved accuracy for the mass of ^32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for ^44Ar and ^45Ar, and a 20sigma deviation for ^44Ar from the literature value was found and interpreted.

  10. Efeito da temperatura e velocidade do ar sobre a taxa de secagem da madeira de Pinus elliottii Engelm.

    Directory of Open Access Journals (Sweden)

    Elio José Santini

    2010-08-01

    Full Text Available Para avaliar o efeito da temperatura e velocidade do ar sobre a taxa de secagem, peças de madeira de Pinus elliottii de 25 x 125 x 750 mm foram submetidas à secagem em estufa semi-industrial de convecção forçada. O processo foi conduzido para duas temperaturas e duas velocidades de ar e controlado por meio de um sistema computadorizado. Os resultados mostraram que a taxa de secagem tem uma relação diretamente proporcional com a temperatura, velocidade do ar e umidade da madeira. Por meio da análise de regressão múltipla detectou-se efeito estatisticamente significativo da temperatura e da velocidade do ar sobre a taxa e o tempo de secagem, com um nível de confiança de 99%. Como a importância da velocidade do ar na secagem decresce com a diminuição do teor de umidade, sugere-se, por razões de economia, mais investigações acerca das relações entre as duas variáveis durante o período de taxa de secagem decrescente.

  11. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  12. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  13. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  14. Celulitis por citomegalovirus

    Directory of Open Access Journals (Sweden)

    A. Ruiz Lascano

    2002-12-01

    Full Text Available Las lesiones cutáneas por citomegalovirus (CMV son infrecuentes y a menudo una manifestación tardía de una enfermedad sistémica, que generalmente anuncia un curso fatal. Comunicamos un caso de celulitis por CMV: una mujer de 70 años con trasplante renal efectuado 1 mes antes de la consulta, terapia inmunosupresora con ciclosporina A y metilprednisona. La paciente ingresó por fiebre, dolor e impotencia funcional en pierna derecha. Comprobamos la existencia de una placa de 8 por 4 cm eritematoedematosa. La tratamos con antibióticos sin mejoría, por lo que realizamos un estudio histopatológico de piel que mostró cambios citopáticos compatibles con infección por CMV. Los cultivos bacteriológicos y micológicos fueron negativos. La inmunohistoquímica específica para CMV y el estudio de reacción en cadena de la polimerasa (PCR de la biopsia de piel fueron positivas, al igual que la antigenemia. El tratamiento con ganciclovir produjo la mejoría del cuadro clínico. En la literatura revisada no hemos encontrado la celulitis como manifestación de enfermedad cutánea por CMV.

  15. Cuantificación de arsénico por inyeccion en flujo-generación de hidruros-espectrometría de abosorcion atómica (IF-GH-EAA previa derivatzación con l-cisteína: Validación y comparación intermetodológica utilizando dos técnicas de referencia Arsenic quantitation by flow injection-hydride generation-atomicabsorption spectrometry (FI-HG-AAS after l-cysteine derivatization: Validation and inter-methodological comparison using two reference techniques

    Directory of Open Access Journals (Sweden)

    Julio A Navoni

    2010-12-01

    Full Text Available La presencia de Arsénico (As en aguas de consumo representa una problemática para la salud pública en muchas regiones del mundo, incluida la Argentina. La cuantificación de arsénico en agua de bebida y en orina se utiliza para evaluar la exposición a este contaminante. El presente trabajo tuvo como objetivo la validación metodológica de una técnica para la cuantificación de especies del As [AsV + AsIII + ácido monometilarsónico (MMA + ácido dimetilarsínico (DMA] por inyección en flujo-generación de hidruros-espectrometría de absorción atómica (IF-GH-EAA, previa derivatización con L-cisteína. Los resultados fueron comparados con los obtenidos utilizando dos metodologías de referencia, generación de hidruros-espectrometría de absorción atómica (GH-EAA para muestras de aguas y orina, y cromatografía de alta resolución -generación de hidruros-espectrometría de absorción atómica (HPLC-GH-EAA para muestras de orina. Además, se evaluó la selectividad de la cuantificación por IF-GH-EAA, en presencia de otras especies químicas del As, provenientes del consumo de alimentos producto de la pesca, a través de un ensayo biológico. Los niveles de As hallados en las muestras de agua y de orina utilizando las técnicas de referencia presentaron un rango de 6 a 176 μg/L y de 143 a 3312 μg/g de creatinina, respectivamente. Los coeficientes de Pearson resultantes de la comparación de los datos obtenidos por IF-GH-EAA, con los logrados por los métodos de referencia fueron r = 0,9976 y r = 0,9422, para agua y orina, respectivamente. Los resultados de la prueba biológica indicaron un mayor nivel de As, debido al consumo de alimentos producto de la pesca, cuando las muestras de orina fueron previamente mineralizadas (GH-EAA, con la consecuente sobreestimación del contenido de As proveniente del consumo de As inorgánico. Este aumento no se observó cuando éstas fueron analizadas por IF-GH-EAA. Los valores, encontrados

  16. Análise estratigráfica e distribuição do arsênio em depósitos sedimentares quaternários da porção sudeste do Quadrilátero Ferrífero, bacia do Ribeirão do Carmo, MG Stratigraphic analysis and distribution of arsenic in quaternary sedimentary deposits of the southeastern portion of the Quadrilátero Ferrífero, basin of the Ribeirão Carmo, MG

    Directory of Open Access Journals (Sweden)

    Adivane Terezinha Costa

    2010-12-01

    Full Text Available A região do QF, em Minas Gerais, tornou-se internacionalmente conhecida pela exploração de ouro no século XVIII. Nesse artigo, serão apresentados valores de referência (background para o arsênio em sedimentos aluviais provenientes de áreas que foram intensamente afetadas pela exploração de ouro no passado, contidas na bacia do ribeirão do Carmo. A análise da sucessão faciológica dos perfis aluviais foi realizada em depósitos sedimentares de planícies de inundação, barrancos de rios (cutbank e terraços aluviais e foi o alicerce para a obtenção do valor de referência do arsênio em depósitos de fácies de canal e de planícies de inundação. A partir do conhecimento do valor de referência obtido pelo método estatístico, com base na confecção de curvas de freqüência acumulada em escala linear, foram gerados mapas geoquímicos no sistema SIG. A obtenção do valor de referência e do mapa geoquímico do arsênio, na bacia do ribeirão do Carmo, com representação das áreas com concentrações anômalas desse elemento, é fundamental para o diagnóstico e planejamento ambiental de um distrito mineiro potencialmente contaminado por arsênio.The Quadrilátero Ferrífero region, in the State of Minas Gerais, became internationally known due to the exploitation of gold in the eighteenth century. In this paper, we will present background values for arsenic in alluvial sediments from areas that were heavily affected by the exploitation of gold in the past, in the Carmo River Basin. The analyses of the facies succession of the alluvial profiles were carried out in the sedimentary deposits of flood plains, cutbank and alluvial terraces; this being the foundation for obtaining the arsenic background in the facies of the channel and flood plains. From the knowledge of the background obtained by the statistical method, and based on the construction of cumulative frequency curves on a linear scale, geochemical maps were generated

  17. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This is an Operating System Setup Guide. This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  18. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  19. A refined astronomically calibrated 40Ar/39Ar age for Fish Canyon sanidine

    NARCIS (Netherlands)

    Rivera, T.A.; Storey, M.; Zeeden, C.; Hilgen, F.J.; Kuiper, K.

    2011-01-01

    Intercalibration between the astronomical and radio-isotopic dating methods provides a means to improving accuracy and reducing uncertainty of an integrated, multi-chronometer geologic timescale. Here we report a high-precision 40Ar/39Ar age for the FishCanyon sanidine (FCs) neutron fluence monitor,

  20. Modeling Augmented Reality User Interfaces with SSIML/AR

    Directory of Open Access Journals (Sweden)

    Arnd Vitzthum

    2006-06-01

    Full Text Available Augmented Reality (AR technologies open up new possibilities especially for task-focused domains such as assembly and maintenance. However, it can be noticed that there is still a lack of concepts and tools for a structured AR development process and an application specification above the code level. To address this problem we introduce SSIML/AR, a visual modeling language for the abstract specification of AR applications in general and AR user interfaces in particular. With SSIML/AR, three different aspects of AR user interfaces can be described: The user interface structure, the presentation of relevant information depending on the user’s current task and the integration of the user interface with other system components. Code skeletons can be generated automatically from SSIML/AR models. This enables the seamless transition from the design level to the implementation level. In addition, we sketch how SSIML/AR models can be integrated in an overall AR development process.

  1. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    analog enabling precise measurement of very small 36Ar signals for accurate correction for atmospheric-derived 40Ar; (iii) higher mass resolution allows pseudo resolution of hydrocarbon isobaric interferences from 36Ar through to 40Ar; (iv) multi-collection, allowing more data to be gathered in a fixed...

  2. Neutrino Capture Reactions on $^{40}$Ar

    CERN Document Server

    Suzuki, Toshio

    2012-01-01

    Gamow-Teller (GT) strength in $^{40}$Ar is studied by shell-model calculations with monopole-based universal intearction, which has tensor components of $\\pi$\\rho$-meson exchanges. Calculated GT strength is found to be consistent with the experimental data obtained by recent ($p, n$) reactions. Neutrino capture cross sections on $^{40}$Ar for solar neutrinos from $^{8}$B are found to be enhanced compared with previous calculations. The reaction cross sections for multipoles other than $0^{+}$ and $1^{+}$ are obtained by random-phase approximation (RPA). Their contributions become important for neutrino energies larger than 50 MeV.

  3. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  4. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  5. Condicionamento de ar em salas de operação e controle de infecção - uma revisão

    Directory of Open Access Journals (Sweden)

    May Socorro Martinez Afonso

    2006-04-01

    Full Text Available Revisão bibliográfica, realizada junto aos bancos de dados MED LINE, LILACS, SCIELO, Ministério da Saúde e outros buscadores, com o objetivo de identificar os fatores que torna o ar condicionado fonte de contaminação ambiental. O ar é contaminado por partículas que transportam microrganismos. As fontes de partículas incluem pacientes e equipe cirúrgica. O controle da temperatura, umidade relativa, pressão, número de trocas de ar realizadas por hora, paramentação, tráfego, número de pessoas nas salas e manutenção e limpeza do sistema de ar condicionado dos centros cirúrgicos, são fatores importantes na redução do número de microrganismos no ambiente de sala de operação.

  6. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  7. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  8. Umidificação e aquecimento do gás inalado durante ventilação artificial com baixo fluxo e fluxo mínimo de gases frescos Humidificación y calentamiento del gas inhalado durante ventilación artificial con bajo flujo y flujo mínimo de gases frescos Inhaled gases humidification and heating during artificial ventilation with low flow and minimal fresh gases flow

    OpenAIRE

    Susane Bruder Silveira Gorayb; José Reinaldo Cerqueira Braz; Regina Helena Garcia Martins; Norma Sueli Pinheiro Módolo; Giane Nakamura

    2004-01-01

    JUSTIFICATIVA E OBJETIVOS: Em pacientes sob intubação traqueal ou traqueostomia, a umidificação e o aquecimento do gás inalado são necessários para a prevenção de lesões no sistema respiratório, conseqüentes ao contato do gás frio e seco com as vias aéreas. O objetivo da pesquisa foi avaliar o efeito do sistema respiratório circular com absorvedor de dióxido de carbono do aparelho de anestesia Cícero da Dräger, quanto à capacidade de aquecimento e umidificação dos gases inalados, utilizando-s...

  9. Modification of stearic acid in Ar and Ar-O{sub 2} pulsed DC discharges

    Energy Technology Data Exchange (ETDEWEB)

    Bernardelli, E.A.; Souza, T.; Maliska, A.M.; Kleinjohann, K.J.; Bendo, T. [Federal University of Santa Catarina (UFSC), Florianopolis, SC (Brazil); Mafra, M. [Nancy-Universite (France). Institut Jean Lamour; CNRS, Nancy (France); Belmonte, T. [Federal University of Technology from Parana (UTFPR), Curitiba, PR (Brazil)

    2010-07-01

    Stearic acid (C{sub 1}8H{sub 36}O{sub 2}) was treated into Ar and Ar-O{sub 2}(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O{sub 2} plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O{sub 2} in all states) strongly enhance the etching process with regards to A{sup *} species, regardless of their concentration. After treatment by Ar and Ar-O{sub 2} plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O{sub 2} plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  10. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  11. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  12. "Ars Dictaminis" and Modern Rhetorical Practice.

    Science.gov (United States)

    Sewell, Ernestine P.

    Although not all the problems of writing are solved by practice in letter writing, a review of the classical texts on "ars dictaminis"--letter writing--creates a strong argument for its increased use as an exercise in college composition classrooms. By incorporating the lessons of dictamen as a device for achieving rhetorical modes--narration,…

  13. 78 FR 9448 - Arkansas Disaster #AR-00061

    Science.gov (United States)

    2013-02-08

    ... ADMINISTRATION Arkansas Disaster AR-00061 AGENCY: U.S. Small Business Administration. ACTION: Notice SUMMARY: This is a Notice of the Presidential declaration of a major disaster for Public Assistance Only for the... Disaster Assistance, U.S. Small Business Administration, 409 3rd Street SW., Suite 6050, Washington,...

  14. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  15. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  16. Theoretical prediction on vibrational spectra of [Ar…Ar-H]+

    Institute of Scientific and Technical Information of China (English)

    李巍; 赵新生

    2003-01-01

    Centrosymmetric linear [Ar-H-Ar]+ and asymmetric linear [Ar…Ar-H]+ are two stable configurations of [Ar2H]+. Based on the global potential energy surface of [Ar2H]+ provided by our group recently, we calculated the vibrational spectra of [Ar…Ar-H]+ with total angular momentum J = 0 by time-dependent quantum mechanical method, and the influence of quantum tunneling effect on vibrational spectra was found. With the help of the observation on the eigenstate functions and the modified potential energy surface, assignments were made to the spectra. The strong coupling between the excited bending mode of [Ar-H-Ar]+ and the vibrational states of [Ar…Ar-H]+ was discussed.

  17. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  18. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  19. Nevo epidérmico manifestando-se como hiperceratose do mamilo e aréola Verrucous epidermal nevus manifesting as nipple and areola hyperkeratosis

    OpenAIRE

    Roberto Rheingantz da Cunha Filho; Hiram Larangeira de Almeida Jr.; André Cartell

    2006-01-01

    Relata-se caso raro de nevo epidérmico na aréola mamária direita de menina de 13 anos. Segundo a classificação proposta por Levy-Franckel, essa variante é a hiperceratose do mamilo e aréola do tipo I, quando associada a nevo verrucoso. A histologia mostrou papilomatose, acantose e hiperceratose. Foram realizadas duas sessões de crioterapia sem melhora. Foi obtido bom resultado por meio de shaving e eletrocauterização.A rare case of a 13-year-old female patient with epidermal verrucous nevus o...

  20. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  1. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  2. ANÁLISE DE DIFERENTES VISCOSIDADES A PARTIR DA APLICAÇÃO DO AQUECIMENTO GERAL INDIRETO COMO MÉTODO DE RECUPERAÇÃO EM RESERVATÓRIOS PETROLÍFEROS

    Directory of Open Access Journals (Sweden)

    Elthon John Rodrigues Medeiros

    2011-12-01

    Full Text Available Cada barril de petróleo é relevante e até os campos produtores de difícil acesso têm importância. O petróleo viscoso e os baixos níveis de pressão nos reservatórios rasos dificultam a recuperação. O principal método de recuperação aplicado a esse tipo de petróleo é a injeção de vapor. O Aquecimento Geral Indireto - AGI (Blanket Heating é uma técnica que utiliza a injeção de vapor através de canalizações horizontais. O fluido aquecido funciona como um trocador de calor, transferindo indiretamente o calor do vapor ao óleo, reduzindo a sua viscosidade. Para testar esse método e compará-lo ao tradicional processo de injeção contínua de vapor foi utilizado o simulador comercial STARS da CMG. Estudou-se a eficiência do método em relação à variação nos parâmetros de reservatório. Os resultados mostraram que a recuperação pode ser maximizada proporcionalmente ao aumento no número de canalizações e da sua temperatura. A produção acumulada de óleo diminuiu quando as canalizações foram afastadas entre si, ou dos poços produtores. O AGI não produziu emissões consideráveis de vapor à superfície, confirmando a redução na água produzida. Houve diferença significativa entre as recuperações primárias de modelos com viscosidades distintas, quando aplicado nesses mesmos modelos o processo AGI, sobretudo entre óleos de 300 e 10000 cP.

  3. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  4. Influência do aquecimento sobre diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei (Boone, 1931 - DOI: 10.4025/actascianimsci.v30i1.3437 Influence of heating under different titration methods of residual SO2 on shrimps Litopenaeus vannamei (Boone, 1931 - DOI: 10.4025/actascianimsci.v30i1.3437

    Directory of Open Access Journals (Sweden)

    Alfredo Oliveira Galvez

    2008-06-01

    Full Text Available O metabissulfito de sódio é o conservante mais aplicado na carcinicultura, com uso amparado em legislações vigentes no país, todavia, seu resíduo, dióxido de enxofre (SO2, em concentrações altas, pode provocar reações adversas à saúde. Este estudo teve como finalidade observar a influência do aquecimento sob diferentes métodos de titulação de SO2 residual em camarões Litopenaeus vannamei. Os camarões foram submetidos a nove concentrações de metabissulfito de sódio e avaliados diferentes métodos de detecção de SO2. O método da titulação Adolfo Lutz adaptado apresentou grande sensibilidade para detecção de SO2 residual. O método da titulação iodométrica com aquecimento possibilitou a detecção de maiores níveis de SO2, quando comparado ao método sem o aquecimento. O aquecimento interferiu negativamente no método da fita reativa. Conclui-se que o aquecimento influenciou positivamente a titulação iodométrica, não ocorrendo o mesmo com a fita reativa.Sodium metabisulfite is the most applied preservative in shrimp culture, with its use supported by current legislation; however, its residue, sulfur dioxide (SO2, in high concentrations can provoke adverse health reactions. This study evaluated the influence of heating under different methods of residual SO2 titration in em>Litopenaeus vannamei. Shrimps were treated with nine concentrations of sodium metabisulfite and evaluated by different methods of SO2 titration. The adapted Adolfo Lutz titration method presented the highest sensitivity for the detection of SO2. The method of iodometric titration with heating made possible the detention of higher levels of SO2, when compared to the same method without heating. The heating influenced negatively on the reactive ribbon method. It is concluded that the heating influenced positively on the iodometric titration, as opposed to the reactive ribbon.

  5. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  6. DECOMPOSIÇÃO TÉRMICA DE PELLETS DE MADEIRA POR TGA

    Directory of Open Access Journals (Sweden)

    Dorival Pinheiro Garcia

    2016-03-01

    Full Text Available A utilização dos pellets de madeira para a geração de energia térmica está se difundindo no Brasil e a termogravimetria tem sido amplamente aplicada para o estudo da decomposição da madeira e seus principais componentes como a celulose, hemiceluloses e lignina. O objetivo deste trabalho foi investigar o comportamento térmico de quatro diferentes amostras de pellets de madeira, em condições não isotérmicas, por meio das análises termogravimétricas TGA. Os ensaios foram conduzidos desde a temperatura ambiente até 500°C, com taxa de aquecimento de 20°C/min, em atmosfera inerte de gás nitrogênio, com fluxo de 100 mL/min.  Os termogramas mostraram três estágios de decomposição: o primeiro, atribuído à evaporação da água e dos materiais voláteis; o segundo, refere-se à decomposição da holocelulose na pirólise ativa; e o terceiro, atribuído a decomposição da lignina na pirólise passiva. Além disso, conclui-se que a maior decomposição térmica ocorreu na faixa de temperatura compreendida entre 250°C e 400°C, com perdas superiores a 60,8% da massa inicial do biocombustível.

  7. Osteomielitis por salmonella

    Directory of Open Access Journals (Sweden)

    Alicia Velázquez Pérez

    2014-08-01

    Full Text Available Se presenta el caso de una paciente femenina de color blanco y dos años de edad, con diagnóstico prenatal de sicklemia, que desde edades tempranas tiene problemas de la enfermedad. Ingresó en esta ocasión por una de las complicaciones infecciosas que ocasiona este padecimiento, una osteomielitis del húmero izquierdo, aislándose el germen en el hemocultivo realizado, una salmonella. Necesitó de tratamiento enérgico y prolongado; se obtuvo un resultado satisfactorio en la evolución de la enfermedad y se sigue sistemáticamente por consulta externa en la actualidad

  8. On concentration of $^{42}$Ar in the Earth's atmosphere

    CERN Document Server

    Barabash, A S

    2016-01-01

    Data from the DBA liquid argon ionization chamber experiment have been used to obtain an estimate on the concentration of $^{42}$Ar in the Earth's atmosphere, $6.8^{+1.7}_{-3.2}\\cdot10^{-21}$ atoms of $^{42}$Ar per atom of $^{40}$Ar corresponding to the $^{42}$Ar activity of $1.2^{+0.3}_{-0.5}$ $\\mu$Bq per cubic meter of air.

  9. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  10. Dermatitis canina por Malassezia

    Directory of Open Access Journals (Sweden)

    Rejas López, Juan

    2008-05-01

    Full Text Available La dermatitis por Malassezia en perros en generalmente una complicación a procesos alérgicos, seborreicos, presencia de pliegues, etc. aunque también se han descrito otras presentaciones, como la hipersensibilidad contra esta levadura. La demostración de la presencia de Malassesia pachydermatis se hace de manera sencilla mediante citología. El tratamiento de esta dermatitis puede ser tópico u oral.

  11. Dermatitis canina por Malassezia

    OpenAIRE

    Rejas López, Juan

    2008-01-01

    La dermatitis por Malassezia en perros en generalmente una complicación a procesos alérgicos, seborreicos, presencia de pliegues, etc. aunque también se han descrito otras presentaciones, como la hipersensibilidad contra esta levadura. La demostración de la presencia de Malassesia pachydermatis se hace de manera sencilla mediante citología. El tratamiento de esta dermatitis puede ser tópico u oral.

  12. Growth Rate Estimates of Supergene Manganese Nodule by 40Ar/39Ar Isotopic Dating

    Institute of Scientific and Technical Information of China (English)

    Li Jianwei; Vasconcelos P M

    2004-01-01

    Increasing world-class, high-grade, and metals-enriched supergene manganese ore deposits have been discovered in the last two decades, making them more and more economically important. However, data on the timing and duration of their formation are sparse, mainly due to the difficulties extracting datable minerals suited to traditional radiometric dating methods. Hollandite, cryptomelane, coronadite, todorokite, and manjiroite are common manganese oxide minerals in supergene environments. These minerals host potassium of variable amounts from 0.1 wt% to 5.0 wt% in their structural sites. This geochemical property provides possibility to date supergene manganese ores by using K-Ar and 40Ar/39Ar methods. In this study, we perform 40Ar/39Ar dating on a 7.1-cm-thick botryoidal manganese nodule from an ancient weathering profile at Mount Tabor, central Queensland, Australia. Laser microprobe incremental analyses of distinct growth bands, from the inner core through the intermediate bands to the outermost crusts of the nodule, have yielded high quality 40Ar/39Ar ages at 27.3 Ma, 20.9 Ma, 19.2 Ma, and 16.1 Ma, respectively. The age results permit preliminary estimates on the average growth rates of the nodule varying from 4.7×10-3 mm/ka to 7.6×10-3 mm/ka to 9.0×10-3 mm/ka, from the core to the rim. Results of this study are of significance in our understanding of the mode, mechanism, process, and climatic conditions in the formation of supergene manganese ore deposits.

  13. causada por Fusarium moniliforme

    Directory of Open Access Journals (Sweden)

    Mariano Mendoza Elos

    2006-01-01

    Full Text Available El objetivo de éste trabajo fue determinar la resistencia horizontal de 134 líneas S1 de maíz al hongo Fusarium moniliforme. La enfermedad fue inducida mediante inoculación en la etapa de floración masculina bajo condiciones de campo utilizando la técnica del palillo. Las líneas se evaluaron en México en 2002. La estimación de la enfermedad se hizo en dos ocasiones con una separación de 20 días. Las evaluaciones mostraron que las líneas Roque-801, 804, 1103 y 1405 fueron resistentes en la primera evaluación. Las tasas de incremento de la enfermedad variaron de 0,01 a 0,229 por unidad por día. Las líneas mostraron bajos niveles de enfermedad de 0 a 1 % en la primera evaluación. En la segunda evaluación, los niveles de enfermedad variaron de 49 a 100 %. En un programa de mejoramiento genético estas líneas pueden ser utilizadas para mejorar la resistencia horizontal del maíz a la pudrición del tallo causada por Fusarium moniliforme

  14. Ibn Bâq, Kitâb Zahrat al-raw fi taljîs taqdîr al-farḍ (Libro de la flor del jardín, acerca del resumen de la evaluación de la obligación, edición y estudio por Rachid El Hour, Madrid : CSIC, Fuentes arábico-hispanas, 29, 2003, 268 p.

    Directory of Open Access Journals (Sweden)

    Ana María Carballeira

    2011-12-01

    Full Text Available La collection publiée depuis 1991 par le CSIC sous le titre “Fuentes arábico-hispanas” sert de cadre à l’édition et à l’étude réalisées par R. El Hour sur cette œuvre inédite. Les autorités avaient chargé l’auteur de ladite œuvre, Ibn Bâq (m. 763/1362, spécialiste de l’estimation des obligations et paiements légaux dans l’Almería naḍride, de mener à bien un travail qui puisse servir de manuel ou de guide à toute personne intéressée par le sujet. La composition même de l’œuvre a pu être inspi...

  15. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    OpenAIRE

    Alexandra Galetovic Carabantes; Nilda A.G.G. de Fernicola

    2003-01-01

    La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC), como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupac...

  16. Antarlides: A New Type of Androgen Receptor (AR) Antagonist that Overcomes Resistance to AR-Targeted Therapy.

    Science.gov (United States)

    Saito, Shun; Fujimaki, Takahiro; Panbangred, Watanalai; Igarashi, Yasuhiro; Imoto, Masaya

    2016-02-18

    Prostate cancer is treated with androgen receptor (AR) antagonists but most patients experience disease progression after long-term treatment with these compounds. Therefore, new AR antagonists are required for patient follow-up treatment. In the course of screening for a new AR antagonist, we isolated the novel compounds antarlides A-E (1-5) from Streptomyces sp. BB47. Antarlides are mutually isomeric with respect to the double bond and have a 22-membered-ring macrocyclic structure. The full stereostructure of 1 was established by chemical modifications, including methanolysis, the Trost method, acetonide formation, and the PGME method. 1-5 inhibited the binding of androgen to ARs in vitro. In addition, 2 inhibited the transcriptional activity of not only wild-type AR but also mutant ARs, which are seen in patients with acquired resistance to clinically used AR antagonists. Therefore, antarlides are a potent new generation of AR antagonists that overcome resistance.

  17. Tracking fluid action in Little Sark Pluton (Channel Islands, UK): a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Schwanethal, J.; Tindle, A. G.; Kelley, S. P.; Sherlock, S. C.

    2011-12-01

    Little Sark pluton (Channel Islands, UK) is a weakly to moderately deformed pluton of quartz diorite composition. Zircon from Little Sark has been dated as 611.4(+2.1/-1.3) Ma [Miller et al. 1991, Tectonophysics, 312], whereas titanite has an age of 606.2±0.6 Ma. Hornblende yields an Ar-Ar age of 606.4±3.4 Ma [Dallmeyer et al., 1991, J. Geol. Soc. London 148]. The rocks show evidence for post-magmatic hydrous alteration including chloritisation of biotite, and sericite formation in feldspar. We investigated the alteration in order to understand its influence on the Ar-Ar system. Detailed petrographic investigations of two samples indicate different deformation levels - S1, (less deformed), and S2 (more deformed). The feldspar is andesine to oligoclase in composition, but contains K-rich areas with patchy and sometimes cleavage guided sericitization. Mafic minerals include hornblende and biotite (the latter partially chloritized). Ar-Ar investigations were carried out using high spatial resolution UV laser ablation gas release in combination with a Nu instruments Noblesse gas mass spectrometer using spots of 80 to 140 μm diameter. Mafic minerals in S1 have highly variable 38Ar/39Ar and 37Ar/39Ar ratios and unusually high atmospheric contents for such old samples, possibly reflecting the presence of fluid inclusions associated with the sericite, particularly in the feldspar. The apparent ages in their entirety range from 429 to 668 Ma. Hornblende yields homogeneous apparent ages, whereas the younger and older ages are measured in both micas and feldspars, whose apparent ages range from 245-670 Ma. The modal age for feldspar is around 400-450 Ma, but this may not have geological meaning. Sample S2 shows many of the same features as S1. Mafic minerals span a slightly smaller age range and feldspars display apparent ages of ~245-645 Ma with a mode around 480 Ma. The alteration of both samples appears to have been accompanied by the introduction of 40Ar-rich fluids

  18. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  19. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  20. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  1. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  2. Active cutaneous warming systems to prevent intraoperative hypothermia: a systematic review Métodos activos de calentamiento cutáneo para la prevención de hipotermia en el período intraoperatorio: revisión sistemática Métodos ativos de aquecimento cutâneo para a prevenção de hipotermia no período intraoperatório: revisão sistemática

    Directory of Open Access Journals (Sweden)

    Vanessa de Brito Poveda

    2012-02-01

    íveis na literatura sobre a efetividade dos diferentes métodos ativos de aquecimento cutâneo, para a prevenção de hipotermia no período intraoperatório. Para tal, a revisão sistemática foi empregada como método de revisão. A busca por estudos primários foi realizada nas bases de dados CINAHL, EMBASE, Cochrane Register of Controlled Trials e MEDLINE. A amostra da revisão foi composta por 23 ensaios clínicos randomizados controlados. Na literatura, há evidências que indicam que o sistema de circulação de água aquecida é o método mais efetivo à manutenção da temperatura corporal. Os resultados evidenciados podem subsidiar a tomada de decisão do enfermeiro na implementação de medidas efetivas para a manutenção da temperatura corporal. Recomenda-se, entretanto, que a escolha do sistema em cada serviço de saúde seja também baseada na análise custo/benefício, devido aos custos relativos à aquisição dos sistemas investigados.

  3. Modelagem de um condicionador de ar de alta precisão para uso em processamento agrícola Modeling of a high precision air conditioner for use in agricultural processing

    Directory of Open Access Journals (Sweden)

    Mauri Fortes

    2006-08-01

    Full Text Available Apresenta-se neste trabalho, estudo detalhado sobre a modelagem de um condicionador de ar com controle acurado de temperatura e umidade relativa. Desenvolveu-se um programa de computador que permite predizer o comportamento do sistema sob diferentes condições psicrométricas e de vazão do ar de entrada. O modelo global físico-matemático inclui equações de balanço de massa e de energia para três diferentes volumes de controle que compõem o condicionador. Modelaram-se os processos de mistura, evaporação (ou condensação simultânea de uma superfície d'água e de uma gota e o aquecimento de corrente de ar, separadamente. Propõem-se expressões semi-empíricas simples para os coeficientes de transferência de calor e massa inerentes ao processo de evaporação sobre uma superfície d'água e um modelo simplificado para o sistema de spray. Construiu-se um condicionador de ar no qual foram feitos testes experimentais para o ajuste das constantes que aparecem nas expressões para os coeficientes de transferência. Os dados obtidos validaram o modelo global, com precisão aceitável para projetos de engenharia.In this work, a detailed procedure for the analysis of an accurately controlled air conditioner is presented. A computer program, that allows predicting the behavior of the system under different psychrometric conditions and different input air mass flow rates, was developed. The global physical-mathematical model includes mass and energy conservation equations for three different control volumes that compose the conditioner. Thus, the processes of mixture of air, simultaneous evaporation (or condensation from a water surface and from a drop, and the air-stream heating are modeled separately. Simple semi-empiric expressions for heat and mass coefficients inherent to the evaporation process on a water surface are proposed as well a simplified model for the spray system. Experimental tests made on an air-conditioner allowed to obtain

  4. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  5. Miotoxicidade por organofosforados

    Directory of Open Access Journals (Sweden)

    Cavaliere Maria J.

    1996-01-01

    Full Text Available Os organofosforados são um grupo de compostos químicos amplamente utilizados em agropecuária como inseticidas, ocasionando intoxicações acidentais em animais e humanos, e mesmo sendo utilizados em tentativas de suicídio. A toxicidade desses produtos decorre sobretudo de insuficiência cárdio-respiratória por compromentimento do sistema nervoso autônomo. Sabe-se que alguns destes compostos induzem em animais de experimentação e em humanos, uma miopatia caracterizada por degeneração de células musculares, comprometendo sobretudo a musculatura respiratória. Baseado no fato de que este comprometimento contribui para a piora da função respiratória, propõe-se um protocolo de avaliação rotineira de miotoxicidade por compostos organofosforados, através de uma bateria mínima e suficiente de colorações e reações histoquímicas para quantificação da necrose muscular. Utilizaram-se como modelo experimental, grupos de ratos albinos (Wistar intoxicados com o organofosforado paraoxon, com e sem antídotos (atropina ou pralidoxima. Verificou-se nos grupos tratados com paraoxon e paraoxon mais atropina, necrose de fibras musculares no diafragma, que atingia em determinadas áreas até 15% das fibras. No grupo tratado com paraoxon mais pralidoxima, a necrose foi mínima, evidenciando o papel mioprotetor deste último antídoto.

  6. Por mil devaluados pesos

    Directory of Open Access Journals (Sweden)

    Annie Rodríguez Collázos

    2013-03-01

    Full Text Available El estudio de lo popular y lo urbano hasta ahora se ha centrado en el comportamiento y en algunas relaciones de los habitantes con su entorno. “Por mil devaluados pesos. Publicidad popular y urbana”, pretende explorar las formas de publicidad, dispersas en diferentes espacios populares y urbanos en Bogotá, identificando esquemas y formas características de sus propios códigos comunicativos; se centran en un objeto de estudio consistente en las estrategias publicitarias y los códigos comunicativos en los mensajes publicitarios populares en las subculturas de San Victorino, 7 de Agosto y Sanandresito de San José.

  7. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  8. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  9. Escala Diagnóstica Adaptativa Operacionalizada de Autorrelato - EDAO-AR: Evidências de Validade

    Directory of Open Access Journals (Sweden)

    Elisa Medici Pizao Yoshida

    2013-04-01

    Full Text Available A Escala Diagnóstica Adaptativa Operacionalizada-Revisada (EDAO-R fornece medida da eficácia adaptativa, entendida como o grau de sucesso obtido no enfrentamento das vicissitudes da vida. Sua avaliação baseia-se em material de entrevista clínica. O estudo teve por objetivo obter evidências de validade da versão de autorrelato da EDAO-R, ou EDAO-AR. Foram desenvolvidos itens para avaliar a adequação da adaptação de dois setores da personalidade: Afetivo-Relacional (A-R e Produtividade (Pr. A amostra foi composta por 237 pacientes ambulatoriais e acompanhantes. Houve evidências de validade baseada na estrutura interna (consistência interna, análise fatorial, análise de agrupamentos e validade baseada em variáveis externas (relação entre EDAO-AR e Escala de Avaliação de Sintomas-40/EAS-40. Os resultados apontaram boa consistência interna e três dimensões para ambos os setores: foco na situação problema, foco na relação interpessoal e foco no eu. Obteve-se, conforme esperado, correlações negativas entre a EDAO-AR e EAS-40. Foram feitas sugestões para a segunda versão da escala.

  10. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  11. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  12. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  13. Condições ergonômicas dos trabalhadores em galpões de frangos de corte durante a fase de aquecimento Ergonomic conditions of workers in poultry houses during the heating phase

    Directory of Open Access Journals (Sweden)

    Cinara da C. S. Carvalho

    2012-11-01

    Full Text Available A adoção das práticas de bem-estar durante o processo de criação animal tem ganhado maiores espaços devido à comprovada melhora na produção. Hoje, a condição de bem-estar pode ser estendida também para o humano que, tendo boas condições de trabalho acaba, assim, por refletir em um manejo de sucesso dos animais. Buscando atender a essa nova tendência do mercado objetivou-se, com este trabalho, avaliar as condições ergonômicas e a salubridade do ambiente de galpões de frangos de corte equipados com três diferentes sistemas de ventilação mínima (positiva, negativa e natural no que se refere à saúde do trabalhador. Com base nos efeitos dos sistemas de ventilação mínima avaliou-se carga física de trabalho, qualidade do ar, ambiente térmico, nível de ruído e iluminação, além da análise postural e biomecânica. De posse dos dados analisados verificou-se que o galpão equipado com sistema de ventilação positiva possuía um ambiente de maior salubridade para o trabalhador. Independente do sistema de ventilação utilizado, atividades como abastecimento manual do comedouro, limpeza de bebedouros e revolvimento da cama, podem oferecer riscos de lesão corporal em virtude da forma como são executados.The adoption of the practices of well-being in animal husbandry has gained increased space due to proven improvement in production. Today, the condition of well being, may be extended to the human beings, that having good working conditions may reflect in a successful management of animals. Seeking to meet this new market trend, the aim of this study was to evaluate the ergonomic conditions of the environment and health in broiler sheds, equipped with three different minimal ventilation systems (positive, negative and natural regarding workers' health. Associated with the effects of minimum ventilation systems evaluated the physical load of work, air quality, thermal environment, noise level and lighting besides postural

  14. Estudo da transferência das cloraminas da água para o ar duma piscina coberta

    OpenAIRE

    Barbosa, Albino António da Silva

    2009-01-01

    Mestrado em Engenharia Química A qualidade do ar em ambientes de piscinas cobertas, bem como seus efeitos no sistema respiratório humano, tem vindo a ser estudada por diversos autores. Estes concluíram, por exemplo, que a exposição prolongada à tricloramina é causa de asma ocupacional entre funcionários de piscinas, e muito provavelmente causa de asma entre frequentadores assíduos. O cloro combinado ou as cloraminas assim como outros subprodutos da desinfecção resultam da reacção entre ...

  15. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  16. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  17. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  18. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  19. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  20. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  1. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  2. The role of mitochondrial fusion and StAR phosphorylation in the regulation of StAR activity and steroidogenesis.

    Science.gov (United States)

    Castillo, Ana F; Orlando, Ulises; Helfenberger, Katia E; Poderoso, Cecilia; Podesta, Ernesto J

    2015-06-15

    The steroidogenic acute regulatory (StAR) protein regulates the rate-limiting step in steroidogenesis, i.e. the delivery of cholesterol from the outer (OMM) to the inner (IMM) mitochondrial membrane. StAR is a 37-kDa protein with an N-terminal mitochondrial targeting sequence that is cleaved off during mitochondrial import to yield 30-kDa intramitochondrial StAR. StAR acts exclusively on the OMM and its activity is proportional to how long it remains on the OMM. However, the precise fashion and the molecular mechanism in which StAR remains on the OMM have not been elucidated yet. In this work we will discuss the role of mitochondrial fusion and StAR phosphorylation by the extracellular signal-regulated kinases 1/2 (ERK1/2) as part of the mechanism that regulates StAR retention on the OMM and activity.

  3. Behavior of argon gas release from manganese oxide minerals as revealed by 40Ar/39Ar laser incremental heating analysis

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Manganese oxides in association with paleo- weathering may provide significant insights into the multiple factors affecting the formation and evolution of weathering profiles, such as temperature, precipitation, and biodiversity. Laser probe step-heating analysis of supergene hollandite and cryptomelane samples collected from central Queensland, Australia, yield well-defined plateaus andconsistent isochron ages, confirming the feasibility dating very-fined supergene manganese oxides by 40Ar/39Ar technique. Two distinct structural sites hostingAr isotopes can be identified in light of their degassing behaviors obtained byincremental heating analyses. The first site, releasing its gas fraction at thelaser power 0.2-0.4 W, yields primarily 40Aratm, 38Aratm, and 36Aratm (atmospheric Ar isotopes). The second sites yield predominantly 40Ar* (radiogenic 40Ar),39ArK, and 38ArK (nucleogenic components), at ~0.5-1.0 W. There is no significant Ar gas released at the laser power higher than 1.0 W, indicating the breakdown of the tunnel sites hosting the radiogenic and nucleogenic components. The excellent match between the degassing behaviors of 40Ar*, 39ArK, and 38ArK suggests that these isotopes occupy the same crystallographic sites and that 39ArK lossfrom the tunnel site by recoil during neutron irradiation and/or bake-out procedure preceding isotopic analysis does not occur. Present investigation supports that neither the overwhelming atmospheric 40Ar nor the very-fined nature of the supergene manganese oxides poses problems in extracting meaningful weathering geochronological information by analyzing supergene manganese oxides minerals.

  4. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  5. Ojo por ojo

    OpenAIRE

    Ramón del Llano Ibáñez

    2011-01-01

    Nuestro pan y café de la mañana se acompaña de noticias alrededor de ejecuciones, de fosas clandestinas, de batallas del ejército, de balaceras en las calles y civiles caídos por balas perdidas : la muerte acompaña nuestro desayuno. Las calaveras de azúcar del día de muertos hoy son calaveras reales y amargas : 40 000 muertos en cuatro años después que el Presidente Calderón declaró la guerra a los narcotraficantes. Se han apresado a varios e importantes miembros de los cárteles : pero han si...

  6. Sepsis por shigella flexneri

    Directory of Open Access Journals (Sweden)

    César Cabrera C

    2005-04-01

    Full Text Available Se presenta un caso raro de sepsis por Shigella flexneri en una paciente de 45 años de edad quien estando hospitalizada para el estudio de un tumor cerebral, requirió el uso de manitol y dosis altas de corticoides; luego de ello presenta deposiciones líquidas con moco y sangre, desarrolla síndrome de respuesta inflamatoria sistémica, luego se aísla Shigella flexneri en el hemocultivo; recibió tratamiento antibiótico con ciprofloxacina. Se describen las características del caso y se comenta de acuerdo con la revisión de literatura.

  7. Onicomicosis por hongos fuliginosos

    Directory of Open Access Journals (Sweden)

    Ingrid Salas-Campos

    2009-12-01

    Full Text Available Justificación y objetivo: Las infecciones de las uñas producidas por hongos son un problema de frecuente consulta dermatológica. Los dermatofitos son la mayor causa de estas infecciones, siendo Trichophyton rubrum el agente etiológico más importante. Sin embargo, los hongos no dermatofitos, tanto hialinos como fuliginosos, pueden ser también responsables de estos cuadros clínicos. Debido a que estos hongos tienden a ser resistentes a los antimicóticos comúnmente usados para tratar las onicomicosis, es que se hace indispensable que el clínico se asegure por medio de un examen de laboratorio de la etiología de la infección. Métodos: Se estudiaron tres casos de pacientes con lesiones en uñas, que acudieron al laboratorio de Micología Médica, Facultad de Microbiología, Universidad de Costa Rica. Se realizaron los análisis de rutina para aislamiento e identificación de hongos patógenos. Resultados: En los tres casos estudiados se observó al examen directo micelio fuliginoso. En uno de los casos se aisló e identificó Scytalidium dimidiatum, hongo que presenta resistencia a los antifúngicos utilizados para tratar onicomicosis. Conclusión. El reporte de hongos diferentes a los dermatofitos como agentes etiológicos de onicomicosis es importante para que el médico pueda elegir el tratamiento más recomendado para este tipo de infección.

  8. Motivado por cirujanos

    Directory of Open Access Journals (Sweden)

    Carlos Salazar-Vargas

    2010-12-01

    Full Text Available Comenzaba la década de los 60 y nuestro grupo nerviosamente iniciaba lecciones en los hospitales de San José. En aquellos años, el estudiante de medicina empezaba su contacto con pacientes, por lo menos 1 ó 2 años después de iniciada la carrera. El estudio del ser humano normal que ya habíamos concluido, continuaba con el del enfermo, y más adelante aprenderíamos el tratamiento. La enfermedad descrita en el libro, de pronto se convertía en un enfermo, y es a este quien hoy veíamos, cohibido pero inquisidor, en la cama de un hospital. Los profesores nos enseñaban a interrogar y a examinar a los pacientes, y cada gesto suyo, cada pregunta, cada maniobra, eran celosamente guardados en la memoria de los educandos. Con claridad percibíamos, aun a temprana edad, las diferencias entre los especialistas, y casi de manera involuntaria, cada quien iba tomando partido y escogía su futuro camino. Fue durante esos tempranos años, cuando mi vida se cruzó con la de 7 maravillosas personas y excelentes cirujanos, que marcaron para siempre mi destino y, sin quererlo ellos, me hicieron inclinarme por la cirugía. Dos eran serios y profundamente académicos: el Dr. Manuel Aguilar Bonilla y el Dr. Vesalio Guzmán Calleja; 3, decididos, incansables y muy hábiles: el Dr. Longino Soto Pacheco, el Dr. Claudio Orlich Carranza y el Dr. Carlos Prada Díaz, y 2, abordables, prácticos, joviales y amistosos: el Dr. Fernando Valverde Soley y el Dr. Randall Ferris Iglesias….

  9. Sob os ventos da mudança climática: desafios, oportunidades e o papel da função produção no contexto do aquecimento global Straws in the wind of climate change: challenges, opportunities, and the role of production function in the context of global warming

    Directory of Open Access Journals (Sweden)

    Charbel José Chiappetta Jabbour

    2009-03-01

    Full Text Available O objetivo deste artigo é lançar luzes sobre as implicações da mudança climática para as organizações. Para fazer frente a esse debate, são explorados: o conceito de "inteligência ambiental" (IA; as estratégias por meio das quais as organizações fazem frente ao desafio da mudança climática; as oportunidades que explicam a adoção dessas estratégias; e o papel fornecido pela função produção para que tais estratégias possuam o efeito desejado. Por fim, tais conceitos são sistematizados, buscando-se uma integração dos modelos teóricos existentes, até então considerados de maneira estanque.The aim of this paper is to enlighten the implications of climate change for organizations. To deal with this subject, the follow issues are analyzed: concept of environmental intelligence; opportunities which justify the adoption of these strategies, and the main role performed by the production function to implement such strategies. Finally, concepts of prior theoretical models are taken into account.

  10. Androgen Receptor-Mediated Growth Suppression of HPr-1AR and PC3-Lenti-AR Prostate Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Young-Chae Kim

    Full Text Available The androgen receptor (AR mediates the developmental, physiologic, and pathologic effects of androgens including 5α-dihydrotestosterone (DHT. However, the mechanisms whereby AR regulates growth suppression and differentiation of luminal epithelial cells in the prostate gland and proliferation of malignant versions of these cells are not well understood, though they are central to prostate development, homeostasis, and neoplasia. Here, we identify androgen-responsive genes that restrain cell cycle progression and proliferation of human prostate epithelial cell lines (HPr-1AR and PC3-Lenti-AR, and we investigate the mechanisms through which AR regulates their expression. DHT inhibited proliferation of HPr-1AR and PC3-Lenti-AR, and cell cycle analysis revealed a prolonged G1 interval. In the cell cycle, the G1/S-phase transition is initiated by the activity of cyclin D and cyclin-dependent kinase (CDK complexes, which relieve growth suppression. In HPr-1AR, cyclin D1/2 and CDK4/6 mRNAs were androgen-repressed, whereas CDK inhibitor, CDKN1A, mRNA was androgen-induced. The regulation of these transcripts was AR-dependent, and involved multiple mechanisms. Similar AR-mediated down-regulation of CDK4/6 mRNAs and up-regulation of CDKN1A mRNA occurred in PC3-Lenti-AR. Further, CDK4/6 overexpression suppressed DHT-inhibited cell cycle progression and proliferation of HPr-1AR and PC3-Lenti-AR, whereas CDKN1A overexpression induced cell cycle arrest. We therefore propose that AR-mediated growth suppression of HPr-1AR involves cyclin D1 mRNA decay, transcriptional repression of cyclin D2 and CDK4/6, and transcriptional activation of CDKN1A, which serve to decrease CDK4/6 activity. AR-mediated inhibition of PC3-Lenti-AR proliferation occurs through a similar mechanism, albeit without down-regulation of cyclin D. Our findings provide insight into AR-mediated regulation of prostate epithelial cell proliferation.

  11. Seasonality of net radiation in two sub-basins of Paracatu by the use of modis sensor products Sazonalidade do saldo de radiação em duas sub-bacias do Paracatu por meio da utilização de produtos do sensor modis

    Directory of Open Access Journals (Sweden)

    Evaldo de P. Lima

    2012-12-01

    Full Text Available The net radiation (Rn represents the main source of energy for physical and chemical processes that occur in the surface-atmosphere interface, and it is used for air and soil heating, water transfer, in the form of vapor from the surface to the atmosphere, and for the metabolism of plants, especially photosynthesis. If there is no record of net radiation in certain areas, the use of information is important to help determine it. Among them we can highlight those provided by remote sensing. In this context, this work aims to estimate the net radiation, with the use of products of MODIS sensor, in the sub-basins of Entre Ribeiros creek and Preto River, located between the Brazilian states of Goiás and Minas Gerais. The SEBAL (Surface Energy Balance Algorithm for Land was used to obtain the Rn in four different days in the period of July to October, 2007. The Rn results obtained were consistent with others cited in the literature and are important because the orbital information can help determine the Rn in areas where there are not automatic weather stations to record the net radiation.O saldo de radiação (Rn representa a principal fonte de energia para os processos físico-químicos que ocorrem na interface superfície-atmosfera, sendo utilizado no aquecimento do ar e do solo, transferência da água, na forma de vapor da superfície para a atmosfera, e metabolismo das plantas, especialmente a fotossíntese. Se não houver o registro do saldo de radiação em determinadas áreas, torna-se importante a utilização de informações que ajudem a determiná-lo. Entre elas, podemos destacar as fornecidas por sensoriamento remoto. Neste contexto, este trabalho tem o objetivo de determinar o saldo de radiação, com a utilização de produtos do sensor MODIS, nas sub-bacias do Ribeirão Entre Ribeiros e Rio Preto, que ficam entre os Estados de Goiás e Minas Gerais. O SEBAL (Surface Energy Balance Algorithm for Land foi utilizado para a obten

  12. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  13. Temperatura do ar exalado, um novo biomarcador no controle da asma: um estudo piloto Exhaled breath temperature, a new biomarker in asthma control: a pilot study

    OpenAIRE

    Raul Emrich Melo; Popov, Todor A.; Dirceu Solé

    2010-01-01

    OBJETIVO: Avaliar se a temperatura do ar exalado (TAE), medida por um método não invasivo, é efetiva no monitoramento de pacientes com asma não controlada. MÉTODOS: Estudo piloto com nove pacientes (sete mulheres e dois homens; média de idade: 39 anos) com diagnóstico de asma por pelo menos um ano e sem uso de tratamento de manutenção por pelo menos três meses antes do início do estudo. Na primeira visita, os pacientes foram submetidos à espirometria e à medida da TAE. Todos os pacientes fora...

  14. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone.

  15. PROPUESTA DE ITINERARIO DIDÁCTICO POR LA PROVINCIA DE TORRIJOS (TOLEDO) PARA ALUMNOS DE SECUNDARIA

    OpenAIRE

    Luis Alfonso Cruz Näimi

    2005-01-01

    El presente artículo tiene por finalidad analizar las ventajas educativas de los itinerarios didácticos urbanos comentando y poniendo como ejemplo una propuesta llevada a cabo con alumnos del Programa de Diversificación Curricular en Secundaria. Los itinerarios didácticos suponen una manera de enseñar más estimulante para los alumnos, a la vez que una forma más innovadora y motivadora de enseñar contenidos de Geografia urbana, ya que el alurnnado puede participar en su propio proceso de enseñ...

  16. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  17. Sociedad por Acciones Simplificada

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Arcila Salazar

    2009-06-01

    Full Text Available En Colombia, aspectos como la responsabilidad limitada; supresión de la llamada doctrina de ultra vires; duración ilimitada; eliminación de la regla, una acción, un voto; remedios al abuso de los derechos; posibilidad de eliminar prohibiciones a los administradores, libertad de establecer restricciones para la transferencia de acciones y la simplificación de los procedimientos de fusión; son inviables bajo nuestra legislación. Sin embargo, la Ley 1258 de 2008, ha incorporado al derecho societario colombiano un nuevo tipo societario híbrido, llamado “Sociedad por Acciones Simplificada”. Esta forma societaria híbrida se basa en un principio básico: garantizar amplia libertad a los empresarios en la estructuración de sus relaciones a través de disposiciones contractuales. La S.A.S. provee a los empresarios significativa flexibilidad contractual, a la vez que preserva beneficios como la limitación de la responsabilidad.

  18. Sociedad por Acciones Simplificada

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Arcila Salazar

    2009-07-01

    Full Text Available En Colombia, aspectos como la responsabilidad limitada; supresión de la llamada doctrina de ultra vires; duración ilimitada; eliminación de la regla, una acción, un voto; remedios al abuso de los derechos; posibilidad de eliminar prohibiciones a los administradores, libertad de establecer restricciones para la transferencia de acciones y la simplificación de los procedimientos de fusión; son inviables bajo nuestra legislación. Sin embargo, la Ley 1258 de 2008, ha incorporado al derecho societario colombiano un nuevo tipo societario híbrido, llamado “Sociedad por Acciones Simplificada”. Esta forma societaria híbrida se basa en un principio básico: garantizar amplia libertad a los empresarios en la estructuración de sus relaciones a través de disposiciones contractuales. La S.A.S. provee a los empresarios significativa flexibilidad contractual, a la vez que preserva beneficios como la limitación de la responsabilidad.

  19. Avaliação da influência do infravermelho e da diatermia por microondas associados ao alongamento passivo no encurtamento dos músculos isquiotibiais - doi:10.5102/ucs.v5i1.416

    Directory of Open Access Journals (Sweden)

    Aline Simões Alencastro

    2008-11-01

    Full Text Available A diatermia por microondas é uma modalidade de aquecimento profundo, e a radiação infravermelha aquece praticamente a epiderme. Em algumas práticas clínicas, para se obter um maior ganho da flexibilidade usam-se técnicas de alongamento associadas ao calor. Este estudo teve como objetivo verificar a influência e as diferenças na utilização dos recursos térmicos de calor profundo e superficial na flexibilidade da musculatura isquiotibial. Dezenove estudantes do Curso de Fisioterapia do Centro Universitário de Brasília foram distribuídos de forma aleatória em três grupos distintos: GC (alongamento muscular passivo, GCS (infravermelho associado ao alongamento passivo e GCP (diatermia por microondas associada ao alongamento. Os resultados foram obtidos através da analise do ângulo poplíteo antes e depois de cada intervenção, relacionando o recurso com o alongamento. Concluiu-se que a aplicação da termoterapia profunda ou superficial auxilia no alongamento da musculatura isquiotibial

  20. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  1. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  2. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  3. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  4. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  5. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  6. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  7. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  8. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  9. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  10. Electrical and microstructural properties of microwave sintered SnO2-based varistors Propriedades elétricas e microestruturais de varistores à base de SnO2 sinterizados por microondas

    Directory of Open Access Journals (Sweden)

    P. S. Furtado

    2012-06-01

    Full Text Available An investigation was made of the microstructural and electrical properties of SnO2-based varistors microwave sintered at 1200 ºC, applying a heating rate of 120 ºC/min and treatment times of 10, 20, 30, 40, 50 and 60 min. The system used in this study was (98.95-X %SnO2.1.0%CoO.0.05%Cr2O3.X%Ta2O5, where X corresponds to 0.05 and 0.065 mol%. Sintering was carried out in a domestic microwave oven (2.45 GHz fitted for lab use. Silicon carbide was placed in a refractory vessel to form a heating chamber surrounding the sample holder. The pellets were examined by scanning electron microscopy, X-ray diffractometry, direct current measurements and impedance spectroscopy. The parameters of density, medium grain size, coefficient of nonlinearity, breakdown electrical field, leakage current, and height and width of the potential barrier were analyzed.Foi feito um estudo das propriedades microestruturais e elétricas de varistores à base de SnO2, sinterizados por microondas a 1200 ºC, com uma taxa de aquecimento de 120 ºC/min e tempos de tratamento de 10, 20, 30, 40, 50 e 60 min. O sistema utilizado neste estudo foi de (98,95-X %SnO2.1,0%CoO.0,05%Cr2O3.X%Ta2O5, onde X corresponde a 0,05 e 0,065 mol%. A sinterização foi feita em um forno de microondas doméstico (2,45 GHz, equipado para uso em laboratório. Carbeto de silício foi colocado em um recipiente refratário para formar uma câmara de aquecimento em torno do suporte da amostra. As amostras foram analisadas por microscopia eletrônica de varredura, difração de raios X, medições de corrente dc e espectroscopia de impedância. Os seguintes parâmetros foram analisados: densidade, tamanho médio de grão, coeficiente de não-linearidade, campo de rigidez dielétrica, corrente de fuga, e altura e largura da barreira de potencial.

  11. Arsénico en el agua de bebida: un problema de salud pública Arsênio na água de beber: um problema de saúde pública

    Directory of Open Access Journals (Sweden)

    Alexandra Galetovic Carabantes

    2003-12-01

    Full Text Available La presencia de arsénico en el ambiente es un problema de salud pública debido a que se trata de un evento de alta frecuencia que ha sido detectado en países como Argentina, Brasil, Chile, China, India, México y Taiwán, entre otros. El arsénico fue clasificado por la International Agency for Research on Cancer (IARC, como un agente carcinogénico para humanos con base en estudios epidemiológicos que relacionan la ingestión de arsénico en el agua de bebida y cáncer en la piel y estudios ocupacionales que relacionan la exposición al arsénico y cáncer de pulmón. La Organización Mundial de la Salud (OMS recomienda um valor orientador para agua de bebida de 10 mg As/L. Por su parte la Environmental Protection Agency (EPA, considerando estimativas de riesgo realizadas utilizando modelos estadísticos basados en observaciones en humanos y extrapolando los datos para concentraciones inferiores a 50 µg/L, reducirá el valor guía para arsénico en el agua de bebida de 50 µg/L para 10 µg/L. La utilización de biomarcadores permite el desarrollo de la epidemiología molecular que promete ser una herramienta que ayudará a detectar efectos tempranos en poblaciones expuestas, permitiendo la prevención de efectos nocivos considerando las características genéticas de las poblaciones.A presença de arsênio no ambiente é um problema de saúde pública por ser um evento de alta freqüência detectado em países como Argentina, Brasil, Chile, China, Índia, México e Taiwan, entre outros. O arsênio foi classificado pela Agência Internacional de Pesquisa sobre Câncer (IARC, como um agente carcinogênico para humanos com base em estudos epidemiológicos que relacionam a ingestão de arsênico na água para consumo humano e câncer na pele e estudos ocupacionais que relacionam a exposição ao arsênico e câncer no pulmão.A Organização Mundial da Saúde (OMS recomenda um valor orientador para água de beber de 10 mg As/L, enquanto que a

  12. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  13. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  14. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  15. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  16. Enseñar a ser creativo

    OpenAIRE

    López Martínez, Olivia

    2005-01-01

    El trabajo que aquí presentamos versa sobre una investigación que se está llevando a cabo en un centro de la Región de Murcia. Trata sobre "Cómo favorecer la creatividad dentro del contexto escolar". Generar ideas originales es un trabajo difícil. Sin embargo, a través de las estrategias y tácticas adecuadas, los niños pueden aprender de forma fácil y divertida a manejar sus recursos creativos para solucionar problemas que se le planteen en su vida. Por ello, nos deberíamos hacer estas ...

  17. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  18. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  19. AR Sco: A White Dwarf Synchronar

    CERN Document Server

    Katz, J I

    2016-01-01

    The emission of the white dwarf-M dwarf binary AR Sco is driven by the rapid synchronization of its white dwarf, rather than by accretion. This requires a comparatively large magnetic field $\\sim 100$ gauss at the M dwarf and $\\sim 10^8$ gauss on the white dwarf, larger than the fields of most intermediate polars but within the range of fields of known magnetic white dwarfs. The spindown power is dissipated in the atmosphere of the M dwarf by magnetic reconnection, accelerating particles that produce the observed synchrotron radiation. The displacement of the optical maximum from conjunction may be explained either by dissipation in a bow wave as the white dwarf's magnetic field sweeps past the M dwarf or by a misaligned white dwarf's rotation axis and oblique magnetic moment. In the latter case the rotation axis precesses with a period of decades, predicting a drift in the orbital phase of maximum. Binaries whose emission is powered by synchronization may be termed synchronars, in analogy to magnetars.

  20. Determinación de arsénico en abastecimientos de agua para consumo humano de la provincia de Cartago, Costa Rica

    OpenAIRE

    Virginia Montero-Campos; Jaime Quesada-Kimsey; Aura Ledezma-Espinoza; José A Sandoval-Mora

    2010-01-01

    Objetivos: Divulgar conocimiento científico sobre el hidroarsenicismo en América Latina, y determinar la presencia de arsénico en agua utilizada para consumo humano en lugares de riesgo en Costa Rica, específicamente en la provincia de Cartago, en los cantones de Oreamuno, Central, Paraíso y Alvarado. Métodos: Cuantificación de arsénico en su forma reducida trivalente, mediante generación de hidruros metálicos volátiles por absorción atómica de llama, metodología 7062 de la Agencia de Protecc...

  1. Estudio proteómico y de resistencia a arsénico y mercurio en la bacteria Cianotrofa Pseudomonas pseudoalcaligenes CECT5344

    OpenAIRE

    Rodríguez Caballero, Gema

    2015-01-01

    La minería, la joyería y otras actividades industriales generan residuos cianurados que además contienen otros metaloides y metales como el arsénico y el mercurio. La toxicidad del cianuro reside en su elevada afinidad por metales de tal forma que es capaz de inhibir un gran número de metaloenzimas esenciales para la vida. El arsénico es un potente carcinógeno cuyas formas más abundantes en la naturaleza son el arsenito y el arseniato. La toxicidad del arsenito es debida a su capacidad de uni...

  2. Arsénico en aguas naturales del sudeste de la provincia de Córdoba, Argentina.

    Directory of Open Access Journals (Sweden)

    Alejo Leopoldo Perez Carrera

    2013-10-01

    Full Text Available En Argentina, existen grandes regiones que por sus características edafoclimáticas, poseen excelentes aptitudes agropecuarias, sin embargo, sufren limitaciones de desarrollo debido a la disponibilidad de agua y la calidad del recurso hídrico disponible. Uno de los elementos químicos presentes en el agua, con mayor impacto sobre la salud humana y animal, es el arsénico. La región afectada, abarca las provincias de Córdoba, La Pampa, Santiago del Estero, San Luis, Santa Fe, Buenos Aires, Chaco, Salta, Tucumán, San Juan y Mendoza. El objetivo de este trabajo es analizar la presencia y distribución del arsénico en agua superficial y subterránea en el sudeste de la provincia de Córdoba, una de las zonas más afectadas de Argentina por la presencia de arsénico en el agua.

  3. Optimización y validación metodológica de la cuantificación de arsénico por inyección en flujo-generación de hidruros- espectrometría de absorción atómicas (IF-GH-EAA previa derivatizacíon con L-Cisteína Optimización and validation method for arsenic quantification by flow injection-hydride generation - atomic absorption spectrometry (fi-hg-aas after L-Cysteine derivatization

    Directory of Open Access Journals (Sweden)

    Julio A Navoni

    2009-12-01

    Full Text Available El arsénico (As es un contaminante natural que afecta una amplia zona de Argentina. El nivel de As en agua de consumo es utilizado para evaluar la fuente de exposición y en orina para evaluar exposición a este tóxico. El presente trabajo tuvo como objetivo la optimización y validación metodológica de una técnica para la cuantificación de As [As suma = As inorgánico (AsI + especies metiladas: ácido monometilarsónico (MMA y ácido dimetilarsínico (DMA], producto del metabolismo del AsI, por inyección en flujo- generación de hidruros- espectrometría de absorción atómica (IF-GH-EAA, previa derivatización con L-cisteína. La recuperación de las especies estudiadas: AsI (AsIII y AsV, MMA y DMA fue cercana al 100% en todos los casos. Los límites de detección y cuantificación encontrados fueron para agua y orina: 2 y 3 μg/L; 5 y 8 μg/L respectivamente y el rango dinámico de trabajo establecido fue desde 5 a 75 μg/L, permitiendo cuantificar As en muestras de agua cercanos a los estándares internacionales vigentes para valores máximos de As en agua de consumo y en orina en niveles comparables con los establecidos en población laboralmente no expuesta. Esta propuesta metodológica es una alternativa para evaluar la exposición al As en muestras de agua y orina, sin necesidad de utilizar prolongados pre-tratamientos de muestra, de forma más rápida y económica.Arsenic (As is a natural contaminant that affects a large area of Argentina. Quantification of As in drinking water has been used to evaluate the source of exposure and As in urine to assess exposure to this toxic. This study aimed to optimize and validate a methodological technique for the quantification of As [As sum = inorganic As (AsI + methylated species: monometilarsonic acid (MMA and dimetilarsinic acid (DMA], product of AsI metabolism by flow injectionhydride generation-atomic absorption spectrometry (FI-GH-AAS, after derivatization with L-cysteine. The recovery

  4. Estudios de especiación de arsénico y acumulación de metales en muestras de interés medioambiental : Arsenic speciation and metal accumulation studies in environmental samples

    OpenAIRE

    Garcia Salgado, Sara

    2013-01-01

    Se ha estudiado la determinación de especies de arsénico y de contenidos totales de arsénico y metales pesados, específicamente cadmio, cromo, cobre, níquel, plomo y cinc, en muestras de interés medioambiental por su elevada capacidad acumuladora de metales, concretamente algas marinas comestibles y plantas terrestres procedentes de suelos contaminados por la actividad minera. La determinación de contenidos totales se ha llevado a cabo mediante espectrometría de emisión atómica con plasma de ...

  5. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  6. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  7. Aspectos Tectônicos das Intrusões dos Granitos do Cerne, Passa Três e Rio Abaixo, Sudeste do Pré-cambriano Paranaense. Estudo Baseado em Datações 39Ar-40Ar em Micas

    Directory of Open Access Journals (Sweden)

    Leonardo Fadel Cury

    2008-04-01

    Full Text Available Os stocks graníticos do Cerne, Passa Três e Rio Abaixo são representados por corpos elípticos, alongados segundo NE-SW(granitos do Cerne e Passa Três e com formas “ovóides” (Granito Rio Abaixo, intrusivos nas seqüências metavulcanossedimentaresda porção sudeste do Cinturão Ribeira, no Estado do Paraná. Esses corpos são representados principalmente por biotitasienogranitos,monzogranitos e quartzo-sienitos porfiríticos, com megacristais de microclínio, isótropos ou com foliação de fluxomagmático, podendo apresentar termos deformados em regiões restritas às zonas de contato. Mostram afinidades petrológicas,geoquímicas e geocronológicas, com características semelhantes aos granitos tipo-A, porém, enriquecidos em Ba, Sr e Zr. Análises40Ar-39Ar em biotitas do Granito do Cerne indicaram idade integrada de 557 ± 2 Ma, valor este relativamente próximo à idade decristalizaç��o dos zircões de aproximadamente 563 Ma, definida por Cury (2003. Determinações 40Ar-39Ar obtidas em rochasencaixantes (muscovitas xistos das vizinhanças do Granito do Cerne apresentam idades mais antigas (800-1200 Ma, o quepermite concluir que a intrusão do granito, bem como o evento metamórfico regional ocorrido durante o Ciclo Brasiliano, nãoatingiram temperaturas suficientes para apagar o registro isotópico das muscovitas (T < 300oC. Os stocks graníticos do Cerne,Passa Três e Rio Abaixo representam magmatismo tardi-orogênico no contexto das deformações presentes no Domínio Apiaí eao arco-magmático Três Córregos-Cunhaporanga (630-590 Ma, relacionado aos estágios finais de transpressão, onde suacolocação é intimamente associada às zonas de cisalhamento transcorrente e desenvolvimento das grandes antiformas e sinformas.Tal período (Proterozóico Superior/Cambriano representa um importante marco na região, associado aos ajustes finais relacionadosà aglutinação do Supercontinente Gondwana.

  8. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  9. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  10. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  11. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  12. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  13. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  14. Proceedings of the ENCIT 2000: 8. Brazilian congress of thermal engineering; MERCOFRIO 2000: Fair and congress of air conditioned, refrigeration, heating and ventilation from MERCOSUL; Anais do ENCIT 2000: 8. Congresso brasileiro de engenharia e ciencias termicas; MERCOFRIO 2000: Feira e congresso de ar condicionado, refrigeracao, aquecimento e ventilacao do MERCOSUL

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-07-01

    Theoretical and experimental papers are presented in this proceedings covering the following subjects: petroleum, industry, fractions and distillates, gas turbines and power plants, reservoir engineering, fluids and rock, fracturing, fluids and hydraulics, oil field and wells, offshore drilling, cogeneration and electric power generation.

  15. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  16. Por que sou rondoniano

    Directory of Open Access Journals (Sweden)

    Mércio Pereira Gomes

    2009-01-01

    Full Text Available Numa revisão contextualizada no tempo e projetada pelos seus resultados, a obra do sertanista marechal Cândido Rondon (1867-1958 é avaliada positivamente pela dedicação à causa dos povos indígenas do Brasil, pela formação de uma ética de respeito do brasileiro para com os índios e pela institucionalização do dever do Estado brasileiro de proteger, assistir e ajudar os povos indígenas a manterem-se coesos e autônomos e ao mesmo tempo se projetarem no mundo mais amplo. A vida de Rondon é acompanhada desde a sua formação como cadete da Escola Militar, como membro da Igreja do Apostolado Positivista, como comandante da Expedição Rondon (1907-1930, que levou o telégrafo de Cuiabá a Porto Velho, e especialmente como criador e dirigente-mor do Serviço de Proteção aos Índios (SPI, 1910-1967. Rondon é o criador da expressão "Morrer se preciso for, matar nunca", que pautou a ação de indigenistas brasileiros que fizeram os primeiros contatos com muitos povos indígenas desde 1910. E muitos morreram seguindo essa norma, numa clara demonstração do novo espírito humanista criado pela atitude rondoniana. O indigenismo brasileiro implantado por Rondon teve altos e baixos ao longo de quase cem anos, que hoje prossegue pela Fundação Nacional do Índio (Funai. De fato, muitos povos indígenas perderam suas terras e muitos foram dizimados no século XX, mas os mais de 220 que sobreviveram vêm crescendo em número, obtendo suas terras (13% do território nacional e conquistando novos espaços político-culturais no Brasil.This paper reviews the life and work of Brazilian Indianist Marshall Cândido Rondon. Rondon's life is marked by a profound dedication to the Brazilian Indian cause and to instilling in Brazilians a respect for Indian peoples. He influenced the Brazilian government in shaping a policy of protecting, assisting, and helping Indian peoples retain cohesive, self-determined societies. He also encouraged Indians to

  17. 40Ar/39Ar geochronology and exhumation of mylonitized metamorphic complex in Changle-Nanao ductile shear zone

    Institute of Scientific and Technical Information of China (English)

    王志洪; 卢华复

    1997-01-01

    New 40Ar/39Ar plateau ages from rocks of Changle-Nanao ductile shear zone are 107.9 Ma(Mus), 108.2 Ma(Bi), 107. 1 Ma(Bi), 109. 2 Ma(Hb) and 117. 9 Ma(Bi) respectively, which are concordant with their isochron ages and record the formation age of the ductile shear zone. The similarity and apparent overlap of the cooling ages with respective closure temperatures of 5 minerals document initial rapid uplift during 107-118 Ma following the collision between the Min-Tai microcontinent and the Min-Zhe Mesozoic volcanic arc. The 40Ar/39Ar plateau ages, K-Ar date of K-feldspar and other geochronologic information suggest that the exhumation rate of the ductile shear zone is about 0.18-1.12 mm/a in the range of 107-70 Ma, which is mainly influenced by tectonic extension.

  18. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  19. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  20. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  1. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  2. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  3. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    International Nuclear Information System (INIS)

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  4. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Science.gov (United States)

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  5. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Science.gov (United States)

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  6. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Science.gov (United States)

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  7. Sistema de e-terapia inteligente. Un nuevo paradigma de psicoterapia asistida por ordenador

    OpenAIRE

    ZARAGOZÁ ÁLVAREZ, IRENE

    2012-01-01

    La psicoterapia asistida por ordenador (PAO) se define como cualquier sistema informático que ayude a los profesionales de la salud mental a diseñar y/ o aplicar tratamientos. No siempre que la psicoterapia y los ordenadores se encuentran puede hablarse de psicoterapia asistida por ordenador, para ello es necesario que el sistema informático tome alguna decisión en función de la información que le proporcione el paciente. Esta definición excluye los sistemas de videoconferencia, teléfono o...

  8. Quantificação das Emissões de Gases Efeito Estufa – GEEs – Segundo Matriz Energética Diesel ou GNV no Transporte Público por Ônibus em NATAL–RN

    Directory of Open Access Journals (Sweden)

    Ricardo Teixeira Gregório Andrade

    2010-01-01

    Full Text Available Dentre os contribuintes à poluição atmosférica mundial, o setor de transportes é responsável por considerável montante de emissões de gases poluentes. As emissões de gases poluentes causam uma gama de prejuízos sanitários, ambientais e, portanto, econômicos. Face à temática do aquecimento global e ao contexto do ganho de créditos de carbono via projetos tipo Mecanismo de Desenvolvimento Limpo (MDL, mostram-se favoráveis os estudos que possibilitem mitigar tais emissões e conseqüentes prejuízos. O presente estudo destina-se, primordialmente, a demonstrar a quantificação das emissões dos Gases Efeito Estufa – GEE’s expedidas pelo transporte público por ônibus da cidade de Natal-RN, no período de 2006 a 2008, tanto para a matriz energética atual, o Diesel, como para o GNV, no caso de hipotética substituição. Por conseguinte, visa a analisar a troca da matriz energética quanto à redução das externalidades e passivo ambiental gerado como conseqüência da atividade de transporte urbano, sendo o foco a temática ambiental. Os cálculos foram realizados tomando por base a metodologia explicitada pelo Painel Intergovernamental de Mudanças Climáticas – IPCC (The International Pannel for Climate Changes, na unidade de CO2eq. Os cálculos realizados indicam uma redução potencial das emissões em CO2eq de aproximadamente 49%, evidenciando que este fator deve ser considerado na avaliação mais global da viabilidade desta substituição.

  9. Periods of constant and falling-rate for infrared drying of carrot slices Períodos de secagem constante e decrescente de fatias de cenoura por infravermelho

    Directory of Open Access Journals (Sweden)

    Fernando M. Botelho

    2011-08-01

    Full Text Available The aim of this work was to study the infrared drying process of carrot slices and to determine coefficients related to the heat and mass transfer of the process. Fresh carrots were used, dried until constant weight in a dryer with infrared heating source. Different models were utilized to fit the experimental data of constant and falling drying rate periods. It was verified that the coefficients of heat and mass transfer, during the constant drying rate, significantly increased with temperature on rise. The Diffusion Approximation, Two Terms, Midili and Verna models satisfactory represented the falling period of drying rate of carrot slices. The effective diffusion coefficient increased with temperature and this relationship can be represented by the Arrhenius equation, obtaining activation energy to the drying process of 29.092 kJ mol-1.Com este trabalho objetivou-se estudar o processo de secagem por infravermelho das fatias de cenoura e determinar alguns coeficientes referentes à transferência de calor e massa do processo. Utilizaram-se cenouras frescas, secadas até massa constante em um secador com fonte de aquecimento por infravermelho. Aos dados experimentais se ajustaram diferentes modelos para os períodos de taxa de secagem constante e decrescentes. Verificou-se que os coeficientes transferência de calor e massa, referentes ao período de secagem constante, aumentaram significativamente com o aumento da temperatura e que os modelos Aproximação da Difusão, Dois Termos, Midili e Verna representaram satisfatoriamente o período de secagem decrescente das fatias de cenoura. O coeficiente de difusão efetivo aumentou com a temperatura e esta relação pode ser representada pela Equação de Arrhenius, obtendo-se uma energia de ativação para o processo de secagem de 29,092 kJ mol-1.

  10. Remoção da fração oleosa de embalagens de lubrificantes automotivos pós-consumo por drenagem gravitacional

    Directory of Open Access Journals (Sweden)

    Harley Moraes Martins

    2016-01-01

    Full Text Available RESUMO: Este trabalho aborda a questão do gerenciamento de embalagens pós-consumo de lubrificantes automotivos, considerando as dificuldades inerentes à implementação do sistema de logística reversa - prática compulsória por força de lei (Brasil, Lei 12.305/2010 - e a ineficácia dos atuais métodos utilizados para remoção da fração oleosa residual, necessária ao reprocessamento do material plástico por reciclagem mecânica direta. Para determinar metodologia apropriada para limpeza dos frascos de lubrificantes foram conduzidos experimentos para avaliar a influência do aquecimento e da posição das embalagens durante o processo de drenagem gravitacional. O procedimento analítico realizado proporcionou a escolha de uma combinação de variáveis capaz de assegurar remoção de elevado teor do resíduo oleoso com menor gasto energético. A otimização foi feita utilizando um planejamento experimental do tipo composto central com triplicata no ponto central. Os dados obtidos nos ensaios foram analisados com recursos estatísticos e demonstraram que ambos os parâmetros avaliados interferem, de forma significativa, no processo em estudo. Os resultados apontaram aumento da eficácia do processo quando a drenagem é realizada em temperaturas superiores a 35ºC e com a embalagem inclinada em ângulos próximos a 70º em relação à horizontal. Nessas condições, percentuais de remoção de óleo residual superaram 95% após 35 minutos de drenagem.

  11. Porøse materialer

    DEFF Research Database (Denmark)

    Hansen, Ernst Jan de Place

    2000-01-01

    Dette undervisningsnotat er en samling af noter, der refererer til den indledende del af kurset Materialmekanik og Porøse materailer på Insitut for Bærende Konstruktiner og Materialer (BKM).......Dette undervisningsnotat er en samling af noter, der refererer til den indledende del af kurset Materialmekanik og Porøse materailer på Insitut for Bærende Konstruktiner og Materialer (BKM)....

  12. A Survey on Web-based AR Applications

    CERN Document Server

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  13. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    OpenAIRE

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  14. Mass Spectrometric and Langmuir Probe Measurements in Inductively Coupled Plasmas in Ar, CHF3/Ar and CHF3/Ar/O2 Mixtures

    Science.gov (United States)

    Kim, J. S.; Rao, M. V. V. S.; Cappelli, M. A.; Sharma, S. P.; Meyyappan, M.; Arnold, Jim (Technical Monitor)

    2000-01-01

    Absolute fluxes and energy distributions of ions in inductively coupled plasmas of Ar, CHF3/Ar, and CHF3/Ar/O2 have been measured. These plasmas were generated in a Gaseous Electronics Conference (GEC) cell modified for inductive coupling at pressures 10-50 mTorr and 100-300 W of 13.56 MHz radio frequency (RF) power in various feedgas mixtures. In pure Ar plasmas, the Ar(+) flux increases linearly with pressure as well as RF-power. Total ion flux in CHF3 mixtures decreases with increase in pressure and also CHF3 concentration. Relative ion fluxes observed in the present studies are analyzed with the help of available cross sections for electron impact ionization and charge-exchange ion-molecule reactions. Measurements of plasma potential, electron and ion number densities, electron energy distribution function, and mean electron energy have also been made in the center of the plasma with a RF compensated Langmuir probe. Plasma potential values are compared with the mean ion energies determined from the measured ion energy distributions and are consistent. Electron temperature, plasma potential, and mean ion energy vary inversely with pressure, but increase with CHF3 content in the mixture.

  15. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Science.gov (United States)

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  16. Dicty_cDB: FC-AR08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR08 (Link to dictyBase) - - - Contig-U15118-1 FC-AR08Z (Li...nk to Original site) - - FC-AR08Z 542 - - - - Show FC-AR08 Library FC (Link to library) Clone ID FC-AR08 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR08Q.Seq.d/ Representative seq. ID FC-AR...08Z (Link to Original site) Representative DNA sequence >FC-AR08 (FC-AR08Q) /CSM/FC/FC-AR/FC-AR08Q.Seq....esfilgfmgyr tscrynrwssqlpirycs*knddasrsc*yslfkhlgllgkdchp*rsncllqrcfikch qrfrwcfs

  17. Dicty_cDB: FC-AR06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR06 (Link to dictyBase) - - - - FC-AR06Z (Link to Original site) - - FC-AR...06Z 316 - - - - Show FC-AR06 Library FC (Link to library) Clone ID FC-AR06 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...06Q.Seq.d/ Representative seq. ID FC-AR06Z (Link to Original s...ite) Representative DNA sequence >FC-AR06 (FC-AR06Q) /CSM/FC/FC-AR/FC-AR06Q.Seq.d/ XXXXXXXXXXTGATCCAAGAAAAGG

  18. Dicty_cDB: FC-AR18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR18 (Link to dictyBase) - G03231 DDB0229952 Contig-U16528-1 FC-AR...18E (Link to Original site) - - - - - - FC-AR18E 567 Show FC-AR18 Library FC (Link to library) Clone ID FC-AR...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR18Q.Se...q.d/ Representative seq. ID FC-AR18E (Link to Original site) Representative DNA sequence >FC-AR18 (FC-AR18Q) /CSM/FC/FC-AR/FC-AR...QNRALVAGPHSGVERHIINFKWIN LTPLKVNIQRGARINTLIAAIKAADLETKIAALSAVKKINARATKSNQTDFERFKANLIR RKLNKKVSGEVKKLVNIANRAA

  19. Dicty_cDB: FC-AR14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR14 (Link to dictyBase) - - - Contig-U16311-1 FC-AR14Z (Li...nk to Original site) - - FC-AR14Z 593 - - - - Show FC-AR14 Library FC (Link to library) Clone ID FC-AR14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR14Q.Seq.d/ Representative seq. ID FC-AR...14Z (Link to Original site) Representative DNA sequence >FC-AR14 (FC-AR14Q) /CSM/FC/FC-AR/FC-AR14Q.Seq....epsin, complete cds. 72 8e-09 1 BP130435 |BP130435.1 Nicotiana tabacum cDNA, clone: BY2401, primer: M13 forwar

  20. Dicty_cDB: FC-AR09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR09 (Link to dictyBase) - - - Contig-U15312-1 FC-AR09E (Li...nk to Original site) - - - - - - FC-AR09E 702 Show FC-AR09 Library FC (Link to library) Clone ID FC-AR09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR09Q.Seq.d/ Representative seq. ID FC-AR...09E (Link to Original site) Representative DNA sequence >FC-AR09 (FC-AR09Q) /CSM/FC/FC-AR/FC-AR09Q.Seq....elfikr*kerqvc*nrldsleg*r*srrk *rcw*ir*l*ygwhgyatndarygwygrygwygrygwygrygrhgryarwy

  1. High-precision 40Ar/39Ar Age of the Janisjärvi Impact Structure (Russia)

    Science.gov (United States)

    Jourdan, F.; Renne, P. R.; Reimold, U. W.

    2007-12-01

    The ~14 km Jänisjärvi impact structure occurs within the Svecofennian Proterozoic terrains, in the southeastern part of the Baltic shield, Karelia, Russia. Previous K/Ar and 40Ar/39Ar studies were interpreted to give ages of 700 ± 5 Ma and 698 ± 22 Ma respectively, both results being difficult to interpret. Recent paleomagnetic results challenged those ages and propose instead ages of either 500 Ma or 850-900 Ma. In order to better constrain the age of the Jänisjärvi impact structure, we present new 40Ar/39Ar data for melt rocks from the crater. We obtained five concordant isochron ages (based on a total decay constant of 5.543 x 10-10/y and an age of 28.03 Ma for the FCs standard) that yield a combined isochron age of 682 ± 4 Ma (2 sigma) with a MSWD of 1.2, P = 0.14 and 40Ar/36Ar intercept of 475 ± 3. We suggest that this date indicates the age of the impact and therefore can be used in conjunction with existing paleomagnetic results to refine the position of the Baltica paleocontinent at this time. Argon isotopic results imply that melt homogenization has been achieved at the hundred-micron scale certainly because of the low-silica content of the molten target rock that allows fast 40Ar* diffusion in the melt. However, the large range of F(40Ar*inherited) (3 to 8 percents) observed for seven grains show that complete isotopic homogenization was not reached at the centimeter and perhaps millimeter scale. This result is in good agreement with previous Rb and Sr isotopic data.

  2. Single-crystal 40Ar/39Ar incremental heating reveals bimodal sanidine ages in the Bishop Tuff

    Science.gov (United States)

    Andersen, N. L.; Jicha, B. R.; Singer, B. S.

    2015-12-01

    The 650 km3 Bishop Tuff (BT) is among the most studied volcanic deposits because it is an extensive marker bed deposited just after the Matuyama-Brunhes boundary. Reconstructions of the vast BT magma reservoir from which high-silica rhyolite erupted have long influenced thinking about how large silicic magma systems are assembled, crystallized, and mixed. Yet, the longevity of the high silica rhyolitic melt and exact timing of the eruption remain controversial due to recent conflicting 40Ar/39Ar sanidine vs. SIMS and ID-TIMS U-Pb zircon dates. We have undertaken 21 40Ar/39Ar incremental heating ages on 2 mm BT sanidine crystals from pumice in 3 widely separated outcrops of early-erupted fall and flow units. Plateau ages yield a bimodal distribution: a younger group has a mean of 766 ka and an older group gives a range between 772 and 782 ka. The younger population is concordant with the youngest ID-TIMS and SIMS U-Pb zircon ages recently published, as well as the astronomical age of BT in marine sediment. Of 21 crystals, 17 yield older, non-plateau, steps likely affected by excess Ar that would bias traditional 40Ar/39Ar total crystal fusion ages. The small spread in older sanidine ages, together with 25+ kyr of pre-eruptive zircon growth, suggest that the older sanidines are not partially outgassed xenocrysts. A bimodal 40Ar/39Ar age distribution implies that some fraction of rhyolitic melt cooled below the Ar closure temperature at least 10 ky prior to eruption. We propose that rapid "thawing" of a crystalline mush layer released older crystals into rhyolitic melt from which sanidine also nucleated and grew immediately prior to the eruption. High precision 40Ar/39Ar dating can thus provide essential information on thermo-physical processes at the millenial time scale that are critical to interpreting U-Pb zircon age distributions that are complicated by large uncertainties associated with zircon-melt U-Th systematics.

  3. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Science.gov (United States)

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  4. Eestlased ARS BALTICA 08-l Austrias / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2008-01-01

    Rahvusvaheline kunstinäitus "ARS BALTICA 08" Salzburgi näitusehoones Berchtoldvilla, kuraator Peter Rieder. Osalesid kunstnikud Eestist (Mare Vint, Marje Üksine, Andres Tolts, Tiiu Kirsipuu, Jüri Hain), Lätist, Leedust ja Soomest

  5. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Institute of Scientific and Technical Information of China (English)

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  6. El principio general de reductio ad aequitatem por desequilibrio contractual

    Directory of Open Access Journals (Sweden)

    José Félix Chamie

    2012-06-01

    Full Text Available Para atender las exigencias del mundo actual se requiere de la proposición de categorías dogmáticas que contribuyan en el desarrollo del sistema jurídico unificando conceptos, simplificando caminos interpretativos, y sobre la base de la propia tradición rediseñar instrumentos para mejorar el derecho poniéndolo a tono con las exigencias de su tiempo. De allí la intención del autor de aventurarse en una reconstrucción histórico-dogmática de figuras bien conocidas por la tradición del sistema jurídico romano-germánico, en aras de identificar un principio de moderación en los contratos. Un principio de equilibrio que desde los tiempos de la Escuela medieval se contiene en la expresión reductio ad aequitatem y se realiza mediante instrumentos que procuran corregir y adaptar el contrato según el caso. Así, el autor se fija en los momentos de la celebración y de la ejecución del contrato para observar la ratio de los institutos que en esos momentos del iter contractual sirven la causa de la equidad para ajustar la sinalagmaticidad de la relación, contrastar abusos y desequilibrios causados por las partes o por eventos extraños al riesgo del contrato.

  7. The emission spectra of Ar, Kr and Xe + TEA

    Science.gov (United States)

    Suzuki, Masayo; Strock, Pierre; Sauli, Fabio; Charpak, Georges

    1987-03-01

    The emission spectra of Ar, Kr and Xe + 6% TEA gas mixtures are measured by using a single wire proportional counter as the emission source. Asymmetric emission bands are observed in the range of 270 to 350 nm, which can be attributed to the radiative deexcitation of excited TEA molecules. For the practical application of optical readout of avalanche chambers, the Ar + 2.0% TEA + 20% isobutane gas mixture is also examined, and nearly the same emission band is observed.

  8. Augmented Reality Computer-Aided Drawing (AR-CAD)

    OpenAIRE

    ECT Team, Purdue

    2007-01-01

    While Virtual Reality (VR) replaces the entire real world with virtual images, Augmented Reality (AR) superimposes virtual images on the real world. Augmented Reality (a most useful form of Mixed Reality (MR)) is a popular concept for using computers to overlay virtual information onto a view of the real world. In 2000, Phillip Dunston then at the University of Washington in Seattle and his research team presented the initial concept of AR CAD developed for supporting design and construction....

  9. Plataforma MEAL: Herramienta innovadora para enseñar educación nutricional a maestros y nutricionistas

    Directory of Open Access Journals (Sweden)

    Alejandro Dominguez Rodríguez

    2015-01-01

    Full Text Available El consumo de alimentos poco saludables por parte de los niños es considerado actualmente como una problemática a nivel mundial en la medida en que la salud de los infantes está directamente relacionada con la dieta. Diversas intervenciones han sido implementadas con el objetivo de enseñar educación nutricional a niños, pero la mayoría se ha centrado solo en la transmisión de información nutricional. En este artículo se describirá la plataforma MEAL que ha sido creada con el objetivo de ayudar a maestros y nutricionistas a enseñar educación nutricional a niños entre 9 y 12 años de edad. MEAL está compuesta por 3 módulos con conceptos básicos relacionados con educación nutricional, pero también contiene información relacionada con el cambio de hábitos alimenticios y establecimiento de pautas saludables. Esta plataforma también cuenta con dos videojuegos educativos dirigidos a los niños. Por la forma en que está diseñada la plataforma MEAL, y al estar basada en las Tecnologías de la Información y la Comunicación puede suponer una herramienta muy útil y efectiva para maestros y dietistas en aras de enseñar educación nutricional a los niños.

  10. Consecuencias ecológicas del enriquecimiento por materia orgánica procedente de la acuicultura y de vertidos de petróleo en ecosistemas costeros

    OpenAIRE

    Sanz Lázaro, Carlos

    2009-01-01

    El objetivo de esta tesis es estudiar el efecto del enriquecimiento por materia orgánica producida por el cultivo de peces en el mar y por los vertidos de petróleo en el medio marino. Este trabajo intenta explicar las consecuencias ecológicas de los impactos generados por este tipo de contaminación, y en diseñar de test de toxicidad para evaluar la contaminación en el sur de las costas europeas. Específicamente, en relación con el impacto de la acuicultura, los estudios de recuperación durant...

  11. Caracterização por FT-IR da superfície de borracha EPDM tratada via plasma por micro-ondas

    Directory of Open Access Journals (Sweden)

    Renata P. dos Santos

    2012-01-01

    Full Text Available A superfície de uma borracha de etileno-propileno-dieno (EPDM vulcanizada foi modificada via plasma por microondas, com gases Ar, Ar/O2, N2/O2 e N2/H2, tendo como objetivo melhorar as propriedades adesivas da superfície. A técnica FT-IR/UATR foi escolhida para caracterizar as superfícies após tratamento, pois apresentou menor interferência dos ingredientes da formulação da EPDM, dentre as técnicas analisadas (ATR/KRS-5 e Ge. Grupos oxigenados foram inseridos na superfície da amostra tratada, mesmo quando não foi utilizado o oxigênio, pois estes grupos foram formados quando a superfície ativada foi exposta à atmosfera. Já em tratamentos contendo N2, grupos oxigenados e possíveis grupos nitrogenados foram identificados por FT-IR. Redução nos valores do ângulo de contato, aumento no trabalho de adesão e aumento no ensaio de resistência ao descascamento (EPDM × Poliuretano foram observados após tratamento com Ar e N2/H2, resultando em melhora nas propriedades adesivas da superfície tratada.

  12. Effect and mechanism of AR-6 in experimental rheumatoid arthritis.

    Science.gov (United States)

    Sun, Shi-xue; Li, Yun-man; Fang, Wei-rong; Cheng, Peng; Liu, Lifang; Li, Fengwen

    2010-06-01

    The root of Clematis chinensis Osbeck has been used widely in rheumatoid arthritis in Chinese traditional medicine and AR-6 is a triterpene saponin isolated from it. In this present study, we investigated in vivo effects of oral AR-6 in chronic rat adjuvant-induced arthritis (AA) and in vitro effect in macrophage and synoviocytes cells. Arthritic scores and serum inflammatory mediators were evaluated 19 days after AA induction by endermic injection of Freund's complete adjuvant in Sprague-Dawley(S-D) rats. Oral administration of AR-6 to arthritic rats resulted in a clear decrease of clinical signs compared to untreated controls. The synoviocyte and macrophage response ex vivo were then analyzed. Anti-arthritic effects of AR-6 correlated with significant decrease of NO and TNF-alpha produced by peritoneal macrophages, ex vivo and in vitro. AR-6 also significant decreased the proliferation of synoviocyte. These data indicate that AR-6 is a potential anti-inflammatory therapeutic and preventive agent. PMID:19842015

  13. Oficinas y nave industrial en Arévalo, Ávila.España

    Directory of Open Access Journals (Sweden)

    Pérez Arroyo, Salvador

    1992-06-01

    Full Text Available This article describes a factory of plastic materials transformation. It is an industrial building located on the "Tierras de Arévalo" etate in the province of Ávila. The construction consists of 10,000 m2 large industrial plant, areas of quality testing laboratory as well as 2,500 m2 of offices distributed in two levels. The final result is a compact white construction of prismatic volume integrated in the arid landscape of the Castillian plain.

    Se describe en este artículo una fábrica de transformación de materiales plásticos. Es un edificio de carácter industrial situado en el polígono "Tierras de Arévalo", en la provincia de Ávila. La edificación consta de 10.000 m2 de nave industrial, zonas de laboratorio de control de calidad, así como 2.500 m2 de oficinas-paisaje distribuidas en dos plantas. El resultado final es una edificación compacta, configurada por un volumen prismático blanco integrado en el árido paisaje de la llanura castellana.

  14. Nevo epidérmico manifestando-se como hiperceratose do mamilo e aréola Verrucous epidermal nevus manifesting as nipple and areola hyperkeratosis

    Directory of Open Access Journals (Sweden)

    Roberto Rheingantz da Cunha Filho

    2006-08-01

    Full Text Available Relata-se caso raro de nevo epidérmico na aréola mamária direita de menina de 13 anos. Segundo a classificação proposta por Levy-Franckel, essa variante é a hiperceratose do mamilo e aréola do tipo I, quando associada a nevo verrucoso. A histologia mostrou papilomatose, acantose e hiperceratose. Foram realizadas duas sessões de crioterapia sem melhora. Foi obtido bom resultado por meio de shaving e eletrocauterização.A rare case of a 13-year-old female patient with epidermal verrucous nevus on the right areola is reported. According to the Levy-Franckel classification, this variant is a type I nipple and areola hyperkeratosis, when associated to verrucous nevus. Histopathological examination showed papillomatosis, acanthosis and hyperkeratosis. Cryotherapy yielded unsatisfactory results after two sessions. A good result was obtained with shaving and electrocauterization.

  15. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Science.gov (United States)

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  16. Salida de campo a Montejo de Arévalo (Segovia) el 27 y 28 de mayo de 1956

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Salida de campo a Montejo de Arévalo (Segovia) el 27 y 28 de mayo de 1956, de la que se anotaron observaciones sobre Vulpes vulpes (Zorro), y las siguientes aves: Alectoris rufa (Perdiz roja), Apus apus (Vencejo común), "Biblis rupestris", Corvus corax (Cuervo), Corvus monedula (Grajilla, llamada Coloeus por el autor), Emberiza cia (Escribano montesino), Falco peregrinus (Halcón peregrino, también llamado Alcotán palomero), Falco tinnunculus (Cernícalo vulgar), Fringilla coelebs (Pinzón vulga...

  17. Ambiente de Realidad Aumentada Interactivo en Tiempo Real para Enseñar Anatomía

    OpenAIRE

    Alencastre, Moisés; Muñoz, Lourdes; Manrique, Cristina; Grostieta,Zaira; Rojas, Ricardo, 1882-1957

    2013-01-01

    En este artículo se presenta un ambiente de Realidad Aumentada (RA) que utiliza información de una cámara de profundidad para enseñar ciertos temas de Anatomía de forma interactiva a nivel Preparatoria. La idea es mostrar a los estudiantes donde se encuentran los huesos, músculos y órganos del cuerpo humano; desplegando modelos 3D sobre el cuerpo de la persona cuya imagen está siendo capturada por un Kinect en tiempo real. De esta manera, los estudiantes pueden identificar cómo se encuentran ...

  18. Volcanic history and 40Ar/39Ar and 14C geochronology of Terceira Island, Azores, Portugal

    Science.gov (United States)

    Calvert, A.T.; Moore, R.B.; McGeehin, J.P.; Rodrigues da Silva, A.M.

    2006-01-01

    Seven new 40Ar/39Ar and 23 new radiocarbon ages of eruptive units, in support of new geologic mapping, improve the known chronology of Middle to Late Pleistocene and Holocene volcanic activity on the island of Terceira, Azores and define an east-to-west progression in stratovolcano growth. The argon ages indicate that Cinco Picos Volcano, the oldest on Terceira, completed its main subaerial cone building activity by about 370-380??ka. Collapse of the upper part of the stratovolcanic edifice to form a 7 ?? 9??km caldera occurred some time after 370??ka. Postcaldera eruptions of basalt from cinder cones on and near the caldera floor and trachytic pyroclastic flow and pumice fall deposits from younger volcanoes west of Cinco Picos have refilled much of the caldera. The southern portion of Guilherme Moniz Volcano, in the central part of the island, began erupting prior to 270??ka and produced trachyte domes, flows, and minor pyroclastic deposits until at least 111??ka. The northern part of Guilherme Moniz Caldera is less well exposed than the southern part, but reflects a similar age range. The northwest portion of the caldera was formed sometime after 44??ka. Several well-studied ignimbrites that blanket much of the island likely erupted from Guilherme Moniz Volcano. The Pico Alto Volcanic Center, a tightly spaced cluster of trachyte domes and short flows, is a younger part of Guilherme Moniz Volcano. Stratigraphic studies and our new radiocarbon ages suggest that most of the Pico Alto eruptions occurred during the period from about 9000 to 1000??years BP. Santa Barbara Volcano is the youngest stratovolcano on Terceira, began erupting prior to 29??ka, and has been active historically. ?? 2006.

  19. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Science.gov (United States)

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  20. 40Ar/39Ar age evidence for Altyn fault tectonic activities in western China

    Institute of Scientific and Technical Information of China (English)

    LIU Yongjiang; J. Genser; GE Xiaohong; F. Neubauer; G. Friedl; CHANG Lihua; REN Shoumai; R. Handler

    2003-01-01

    Four 40Ar/39Ar age groups of mica, hornblende and K-feldspar were obtained from Proterozoic and early Paleozoic metamorphic rocks in the Aksay-Dangjin Pass area, western China. The samples away from the middle shear zone of the Altyn fault belt yield two plateau age groups in the range of 461-445.2 Ma and 414.9-342.8 Ma, respectively. They represent the tectono-thermal events that had been recorded in the rocks that were displaced by the Altyn strike-slip fault in late Ordovician-early Silurian and Devonian, respectively. These two age groups should be related to the closures of Northern and Southern Qilian Oceans. The deformed granitic gneiss from the northern belt gives a plateau age group of 178.4-137.5 Ma, which is interpreted as the active age of the Altyn fault in the middle-late Jurassic- early Cretaceous and should be related to the accretion of Lhasa block to the north. The sample from the middle shear zone of the Altyn fault belt yields two plateau ages of 36.4 and 26.3 Ma, respectively, suggesting the strike-slip movement with strong metamorphism at greenschist facies along the Altyn fault in the late Eocene. This event occurred in the most areas of the northern Tibet Plateau and should be in response in the north to the collision between Indian and Eurasian continents. The present study demonstrates that the Altyn fault is characterized by multiple pulse-style activities under the tectonic setting of convergence between the Indian and Eurasian continents.

  1. Deep-fat frying of meat products in palm olein Fritura por imersão de produtos cárneos em oleína de palma

    Directory of Open Access Journals (Sweden)

    Cibele Cristina Osawa

    2012-12-01

    Full Text Available This study investigated the discontinuous frying of breaded meat products in palm olein in a 28 L-electric fryer maintained at 182 ºC for 8 hours a day. Three 400-500 g batches of meat products were fried for 4.5 minutes daily. For comparison purpose, thermoxidation tests were performed using inert material with added moisture and without the addition of f ood (heating only. The total polar compound content did not reach the 25% limit, and nor did the formation of polymerized products exceed 5%, which indicates the good frying performance of palm olein for frying. Other analytical parameters and rapid tests were also evaluated. The sensory attributes, such as odor, colour, and foam formation determined when the frying oils should be discarded. The addition of water to the inert material contributed to the final value of 1.00 ± 0.01% (in palmitic acid, while the oil subjected only to heating reached respectively 0.26 ± 0.02%, and the oils used to fry breaded meat and breaded chicken reached 0.38 ± 0.00% and 2.35 ± 0.01%, respectively. This suggests a protective effect of the water during frying since the oil subjected only to heating was more prone to degradation.Este artigo estudou a fritura descontínua de alimentos cárneos empanados em oleína de palma em uma fritadeira elétrica de 28 L, mantida a 182 ºC durante 8 horas por dia. Diariamente, três bateladas de 400-500 g de alimentos cárneos foram fritos durante 4,5 minutos. Para comparação, foram conduzidos testes de termoxidação com a adição de material inerte com umidade adicionada e sem a adição de alimentos (apenas aquecimento. O teor de compostos polares totais não atingiu o limite de 25% e a formação de compostos polimerizados também não ultrapassou 5%, refletindo a boa performance da oleína de palma para frituras. Outros parâmetros analíticos, assim como testes rápidos, foram avaliados. Os atributos sensoriais, tais como odor, cor e formação de fuma

  2. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  3. Transpressional tectonics and Carboniferous magmatism in the Limousin, Massif Central, France:structural and 40Ar/39Ar investigations.

    OpenAIRE

    Gébelin, Aude; Brunel, Maurice; Monié, Patrick; Faure, Michel; Arnaud, Nicolas

    2007-01-01

    New structural, microstructural, and 40Ar/39Ar data from the NW Massif Central (France) provide additional constraints on the timing and tectonic setting of late Variscan granite magmatism. Previous studies had emphasized the role of late orogenic extension in the emplacement of granite plutons in the Limousin region. In contrast, the new data set is consistent with syntectonic emplacement of magma in a dextral simple shear active from 350 to 300 Ma in a transpressional regime. As an alternat...

  4. Detailed Ar-40/Ar-39 dating of geologic events associated with the Mantos Blancos copper deposit, northern Chile

    OpenAIRE

    Oliveros, V.; Feraud, G.; L. Aguirre; Ramirez, L.; Fornari, Michel; Palacios, C.; Parada, M.

    2008-01-01

    The Ar-40/Ar-39 geochronological method was applied to date magmatic and hydrothermal alteration events in the Mantos Blancos mining district in the Coastal Cordillera of northern Chile, allowing the distinction of two separate mineralization events. The Late Jurassic Mantos Blancos orebody, hosted in Jurassic volcanic rocks, is a magmatic-hydrothermal breccia-style Cu deposit. Two superimposed mineralization events have been recently proposed. The first event is accompanied by a phyllic hydr...

  5. A Late Mesoproterozoic 40Ar/39Ar age for a melt breccia from the Keurusselkä impact structure, Finland

    Science.gov (United States)

    Schmieder, Martin; Jourdan, Fred; Moilanen, Jarmo; Buchner, Elmar; Öhman, Teemu

    2016-02-01

    Field investigations in the eroded central uplift of the ≤30 km Keurusselkä impact structure, Finland, revealed a thin, dark melt vein that intersects the autochthonous shatter cone-bearing target rocks near the homestead of Kirkkoranta, close to the center of the impact structure. The petrographic analysis of quartz in this melt breccia and the wall rock granite indicate weak shock metamorphic overprint not exceeding ~8-10 GPa. The mode of occurrence and composition of the melt breccia suggest its formation as some kind of pseudotachylitic breccia. 40Ar/39Ar dating of dark and clast-poor whole-rock chips yielded five concordant Late Mesoproterozoic miniplateau ages and one plateau age of 1151 ± 10 Ma [± 11 Ma] (2σ; MSWD = 0.11; P = 0.98), considered here as the statistically most robust age for the rock. The new 40Ar/39Ar age is incompatible with ~1.88 Ga Svecofennian tectonism and magmatism in south-central Finland and probably reflects the Keurusselkä impact, followed by impact-induced hydrothermal chloritization of the crater basement. In keeping with the crosscutting relationships in the outcrop and the possible influence of postimpact alteration, the Late Mesoproterozoic 40Ar/39Ar age of ~1150 Ma should be treated as a minimum age for the impact. The new 40Ar/39Ar results are consistent with paleomagnetic results that suggested a similar age for Keurusselkä, which is shown to be one of the oldest impact structures currently known in Europe and worldwide.

  6. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps

    Indian Academy of Sciences (India)

    Kanchan Pande; S K Pattanayak; K V Subbarao; P Navaneethakrishnan; T R Venkatesan

    2004-12-01

    We report here a 40Ar-39Ar age of 66.0 ± 0.9Ma (2 ) for a reversely magnetised tholeiitic lava flow from the Bhimashankar Formation (Fm.), Giravali Ghat, western Deccan province, India. This age is consistent with the view that the 1.8–2km thick bottom part of the exposed basalt flow sequence in the Western Ghats was extruded very close to 67.4 Ma.

  7. Exhumation history of the NW Indian Himalaya revealed by fission track and 40Ar/39Ar ages

    Science.gov (United States)

    Schlup, Micha; Steck, Albrecht; Carter, Andrew; Cosca, Michael; Epard, Jean-Luc; Hunziker, Johannes

    2011-01-01

    New fission track and Ar/Ar geochronological data provide time constraints on the exhumation history of the Himalayan nappes in the Mandi (Beas valley) — Tso Morari transect of the NW Indian Himalaya. Results from this and previous studies suggest that the SW-directed North Himalayan nappes were emplaced by detachment from the underthrusted upper Indian crust by 55 Ma and metamorphosed by ca. 48–40 Ma. The nappe stack was subsequently exhumed to shallow upper crustal depths (

  8. Dicty_cDB: FC-AR20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR20 (Link to dictyBase) - G03232 DDB0186972 Contig-U15983-1 FC-AR...20P (Link to Original site) FC-AR20F 321 FC-AR20Z 550 FC-AR20P 871 - - Show FC-AR20 Library FC (Link to librar....0 %: cytoplasmic 24.0 %: nuclear 8.0 %: vesicles of secretory system 4.0 %: cytoskeletal 4.0 %: mitochondri...ontig Contig-U15983-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...20Q.Seq.d/ Representative seq. ID FC-AR20P (Link to Original site) Representative DNA sequence >FC-AR20 (FC-AR

  9. The mass of sup 3 sup 2 Ar and sup 3 sup 3 Ar for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides sup 3 sup 2 Ar (T sub 1 sub / sub 2 = 98 ms) sup 3 sup 3 Ar (T sub 1 sub / sub 2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10 sup - sup 8 (delta m = 1.8 keV) and 1.4 x 10 sup - sup 8 (delta m = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of sup 3 sup 2 Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for sup 4 sup 4 Ar and sup 4 sup 5 Ar, and a 20 sigma deviation for sup 4 sup 4 Ar from the literature value was found and interpreted.

  10. 40Ar/39Ar dating of alkaline and tholeiitic magmatism of Saudi Arabia related to the early Red Sea Rifting

    International Nuclear Information System (INIS)

    40Ar/39Ar plateau-ages at 27-28 Ma obtained on feeder dykes and one lava flow of the alkaline massif of Harrat Hadan are in agreement with the assumed age partly deduced from the conventional K/Ar data of the early activity of other alkaline volcanic massifs from Saudi Arabia. This magmatic activity is spatially distributed over a large area, along the western edge of the Arabian plate, and their N-S to NW-SE volcano-tectonic directions are similar to those of the future Red Sea Rift. Preliminary results obtained on tholeiitic lava flows, dykes and plutons gave 17 plateau-ages which, combined with 6 ages deduced from more disturbed age-spectra, display a main histogram peak from 24 to 21 Ma, much narrower than that obtained with conventional K/Ar ages on the same formations. Therefore, a strong tholeiitic activity affected a narrow linear area following the actual eastern Red Sea coast, over nearly 1700 km, during a brief period of time, and without showing any apparent migration. The main volcano-tectonic features of the future Red Sea are strongly outlined during this event. Such brief magmatic episodes related to continental rifts have also been documented by precise 40Ar/39Ar analyses on the British Tertiary Igneous Province, the Deccan traps and the eastern Central Atlantic. (orig.)

  11. Se los por se lo

    OpenAIRE

    José Luis Rivarola

    1985-01-01

    El sistema de la conjugación "objetiva" plantea interesantesproblemas que fueron tratados en parte por K. Heger (1966) en suestudio comparativo del francés y del español. De la comparaciónse desprende, por ejemplo, que en español hay un cierto número deambigüedades que no permiten establecer un "paradigma tan completo y unívoco" como en el caso del francés. Dentro de estas ambigüedades se encuentran las que propicia el gramema se: "El morfema [gramema] se funciona no sólo como pronombre refle...

  12. Ptose palpebral causada por Paquidermoperiostose

    Directory of Open Access Journals (Sweden)

    Patricia Regina de Pinho Tavares

    2014-08-01

    Full Text Available A paquidermoperiostose é uma síndrome caracterizada por acometimento cutâneo e ósseo, e em alguns casos ocorre comprometimento palpebral leve. É uma síndrome rara, idiopática ou hereditária, com provável herança autossômica dominante de penetrância variável. Descreve-se o caso de um paciente com ptose grave por paquidermoperiostose elucidando sua fisiopatologia e conduta cirúrgica aplicada.

  13. La individualidad de don Quijote vista por Hegel

    Directory of Open Access Journals (Sweden)

    Carlos Másmela

    2008-01-01

    Full Text Available El objetivo de este artículo consiste en desentrañar, con base en los elementos proporcionados por la Estética, la constitución irónica de la individualidad en la interiorización de los mitos, tal como ocurre en El Quijote. Para realizar esta tarea nos apoyaremos en dos textos de la Fenomenología del espíritu, a saber, “la ley del corazón y el desvarío de la infatuación” y “la virtud y el curso del mundo”, en los cuales se hará corresponder el despliegue que Hegel ejecuta en ellos a diferentes pasajes del Quijote.

  14. Evaluation of the Immunity Activity of Glycyrrhizin in AR Mice

    Directory of Open Access Journals (Sweden)

    Ai-Guo Zhou

    2012-01-01

    Full Text Available In this study, we evaluated effect of glycyrrhizin on immunity function in allergic rhinitis (AR mice. The AR mice model were induced by dripping ovalbumin in physiological saline (2 mg mL−1, 10 μL into the bilateral nasal cavities using a micropipette. After the AR model was induced, mice were randomly divided into six groups: the normal control, model, lycopene 20 mg kg−1 (as positive control drug group, and glycyrrhizin 10, 20, 30 mg kg−1 groups. After the sensitization day 14, lycopene (20 mg/kg BW and glycyrrhizin (10, 20 and 30 mg/kg BW were given orally for 20 days once a day. Mice in the normal control and model groups were given saline orally once a day for 20 days. Results showed that glycyrrhizin treatment could dose-dependently significantly reduce blood immunoglobulin E (IgE, interleukin-4 (IL-4, interleukin-5 (IL-5, interleukin-6 (IL-6, nitrous oxide (NO, tumor necrosis factor-alpha (TNF-α levels and nitrous oxide synthase (NOS activity and enhance blood immunoglobulin A (IgA, immunoglobulin G (IgG, immunoglobulin M (IgM, interleukin-2 (IL-2 and interleukin-12 (IL-12 levels in AR mice. Furthermore, glycyrrhizin treatment could dose-dependently significantly enhance acetylcholinesterase (AchE activity and reduce substance P (SP level in peripheral blood and nasal mucosa of AR mice. We conclude that glycyrrhizin can improve immunity function in AR mice, suggesting a potential drug for the prevention and therapy of AR.

  15. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    Institute of Scientific and Technical Information of China (English)

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  16. Acoustic Resonance Spectroscopy (ARS) Munition Classification System enhancements. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Vela, O.A.; Huggard, J.C.

    1997-09-18

    Acoustic Resonance Spectroscopy (ARS) is a non-destructive evaluation technology developed at the Los Alamos National Laboratory (LANL). This technology has resulted in three generations of instrumentation, funded by the Defense Special Weapons Agency (DSWA), specifically designed for field identification of chemical weapon (CW) munitions. Each generation of ARS instrumentation was developed with a specific user in mind. The ARS1OO was built for use by the U.N. Inspection Teams going into Iraq immediately after the Persian Gulf War. The ARS200 was built for use in the US-Russia Bilateral Chemical Weapons Treaty (the primary users for this system are the US Onsite Inspection Agency (OSIA) and their Russian counterparts). The ARS300 was built with the requirements of the Organization for the Prohibition of Chemical Weapons (OPCW) in mind. Each successive system is an improved version of the previous system based on learning the weaknesses of each and, coincidentally, on the fact that more time was available to do a requirements analysis and the necessary engineering development. The ARS300 is at a level of development that warrants transferring the technology to a commercial vendor. Since LANL will supply the computer software to the selected vendor, it is possible for LANL to continue to improve the decision algorithms, add features where necessary, and adjust the user interface before the final transfer occurs. This paper describes the current system, ARS system enhancements, and software enhancements. Appendices contain the Operations Manual (software Version 3.01), and two earlier reports on enhancements.

  17. Análise da contribuição ambiental por meio da alteração da matriz energética do setor brasileiro de ferro-gusa e aço

    Directory of Open Access Journals (Sweden)

    Flávia de Castro Camioto

    2014-12-01

    Full Text Available O objetivo deste artigo é analisar a possibilidade de contribuição ambiental por meio da alteração da matriz energética do setor industrial de ferro-gusa e aço. Para a medição das emissões de CO2 dos combustíveis utilizados, nesse setor, foi usado o método top-down, proposto pelo IPCC. Além disso, a partir dos dados de consumo energético, foi realizada a quantificação das emissões de CO2 supondo a mudança da matriz energética desse setor para efeito de comparação das emissões. Os resultados deste estudo indicam que o coque de carvão mineral é responsável por 44,5% do total de dióxido de carbono emitido por esse setor. Da mesma forma, se fosse possível utilizar somente um combustível na indústria de ferro-gusa e aço, para suprir sua demanda energética, as emissões de CO2 seriam menores para os combustíveis gasosos, líquidos e o alcatrão e outras fontes secundárias do petróleo. Apesar de o estudo ter indicado que o carvão vegetal é o segundo maior emissor de CO2 do setor, o mesmo pode contribuir para a redução do aquecimento global, desde que este energético seja proveniente de matas de reflorestamento destinadas para a atividade industrial.

  18. Estudio de los niveles de plomo, cadmio, zinc y arsénico, en aguas de la provincia de Salamanca

    Directory of Open Access Journals (Sweden)

    Blanco Hernández Angel Luis

    1998-01-01

    Full Text Available FUNDAMENTOS: Conocer el grado de contaminación por plomo, cadmio, cinc y arsénico de las aguas de la provincia de Salamanca y su relación con la zona de procedencia de las muestras y el punto de recogida de las mismas. MÉTODO: Estudio epidemiológico transversal, observacional y descriptivo. Se han estudiado aguas procedentes de redes de abastecimiento, fuentes, manantiales, pozos, ríos, riveras y lagunas de la provincia de Salamanca, analizándose los contenidos de plomo, cadmio, zinc y arsénico de 180 muestras, mediante espectroscopía de absorción atómica. Se han comparado los niveles de contaminación por los cuatro elementos de las muestras de agua entre las cuatro unidades comarcales de la provincia. Se han comparado los niveles de contaminación por los cuatro elementos entre las aguas procedentes de redes de abastecimiento y aquellas muestras de pozos, fuentes, manantiales y aguas de superficie. RESULTADOS: Los resultados indican que un 56% de las muestras analizadas superan las concentraciones máximas admisibles de cadmio, y un 28% del total de muestras analizadas supera las concentraciones máximas admisibles de plomo, según la legislación vigente presentando niveles tolerables de zinc y arsénico. No se han observado diferencias importantes en el grado de contaminación de las aguas por los elementos estudiados entre las cuatro unidades comarcales de la provincia. No se han observado diferencias en los niveles de contaminación por los cuatro elementos entre las aguas procedentes de redes de abastecimientos y aquellas muestras de pozos, fuentes, manantiales y aguas de superficie. CONCLUSIONES: Los resultados sugieren que las aguas de la provincia de Salamanca presentan de forma "natural" altos contenidos de cadmio y plomo, probablemente debido a las características geológicas del terreno.

  19. Celulitis por citomegalovirus Cytomegalovirus cellulitis

    Directory of Open Access Journals (Sweden)

    A. Ruiz Lascano

    2002-12-01

    Full Text Available Las lesiones cutáneas por citomegalovirus (CMV son infrecuentes y a menudo una manifestación tardía de una enfermedad sistémica, que generalmente anuncia un curso fatal. Comunicamos un caso de celulitis por CMV: una mujer de 70 años con trasplante renal efectuado 1 mes antes de la consulta, terapia inmunosupresora con ciclosporina A y metilprednisona. La paciente ingresó por fiebre, dolor e impotencia funcional en pierna derecha. Comprobamos la existencia de una placa de 8 por 4 cm eritematoedematosa. La tratamos con antibióticos sin mejoría, por lo que realizamos un estudio histopatológico de piel que mostró cambios citopáticos compatibles con infección por CMV. Los cultivos bacteriológicos y micológicos fueron negativos. La inmunohistoquímica específica para CMV y el estudio de reacción en cadena de la polimerasa (PCR de la biopsia de piel fueron positivas, al igual que la antigenemia. El tratamiento con ganciclovir produjo la mejoría del cuadro clínico. En la literatura revisada no hemos encontrado la celulitis como manifestación de enfermedad cutánea por CMV.Cutaneous lesions in CMV infection are rare, often a late manifestation of systemic infection, and usually herald a fatal course. A 70 year-old woman received a kidney transplantation one month before consulting and immunosuppressive therapy that included cyclosporine A and methylprednisone. She complained of fever, local pain in her right leg, and an erythematous and swelling plaque. She was treated with intravenous antibiotics without improvement. A skin biopsy was performed and the tissue obtained was sent for bacterial and fungal cultures as well as for histological examination. Cultures were negative. The biopsy showed CMV cytopathic changes. Immunoperoxidase staining was positive for CMV and polymerase chain reaction (PCR testing revealed CMV DNA. She was treated with ganciclovir with resolution of the lesion. CMV cellulitis is a rare cutaneous manifestation

  20. Petrografía y edad 40Ar/39Ar de leucogranitos peraluminosos al oeste de Valcheta: Macizo Nordpatagónico (Río Negro

    Directory of Open Access Journals (Sweden)

    Martín R. Gozalvez

    2009-04-01

    Full Text Available Entre la localidad rionegrina de Valcheta y la Estación Muster del ex ferrocarril Gral. Roca se localizan numerosos afloramientos de leucogranitos que en conjunto forman un cuerpo plutónico de bordes rectos y geometría elipsoidal, aquí denominado plutón Valcheta. El intrusivo mencionado forma parte del basamento ígneo-metamórfico del sector oriental del macizo nordpatagónico. El plutón Valcheta es un cuerpo leucogranítico, peraluminoso (A/CNK >1,1, de grano medio, levemente deformado en los bordes, compuesto por una facies leucogranítica con muscovita-biotita-granate y otra con muscovita-biotita. Las zonas de contacto con los esquistos de la Formación Nahuel Niyeu están cubiertas y en su interior presenta xenolitos de gneises y anfibolitas inyectados por material leucocrático. El estudio radimétrico 40Ar/39Ar en muscovita del plutón Valcheta resultó en una edad de 470 ± 1,8 Ma. Estos datos permiten descartar la correlación de rocas leucogranitcas aflorantes al noroeste de Valcheta con el Granito Flores de edad jurásica. El plutón Valcheta presenta diferencias macroscópicas, petrográficas, microestructurales y composicionales con los intrusivos ordovícicos del Complejo Plutónico Punta Sierra, aflorante sobre la costa atlántica rionegrina. En consecuencia, la extensión del magmatismo ordovícico del este del Macizo Nordpatagónico hasta las inmediaciones de Valcheta debe ser revisada. La morfología, mineralogía, rasgos microestructurales y geoquímica del plutón Valcheta se comparan favorablemente con los leucogranitos del Complejo Mina Gonzalito que forman los plutones Tapera y María Teresa. El pico metamórfico de dicho complejo, según dataciones U-Pb en circones, es del Ordovícico medio (472 ± 5 Ma. El plutón Valcheta es composicionalmente semejante a leucogranitos post-colisionales tipo S formados en una corteza engrosada.

  1. (phoenicopterus roseus por intoxicación aguda por plomo

    Directory of Open Access Journals (Sweden)

    D Romero

    2007-01-01

    Full Text Available La presencia de plomo en el medio ambiente es un hecho indiscutible. Ello es objeto de gran interés sanitario pues repercute tanto en la salud de los animales como en la del ser humano. El plumbismo es una intoxicación que puede afectar a cualquier especie animal. En el ámbito de la fauna silvestre se asocia principalmente a la actividad cinegética en los humedales y a la ingestión de plomo metálico por parte de las aves que frecuentan estos ecosistemas. En España cada año mueren decenas de miles de aves acuáticas como consecuencia de la ingesta de perdigones de plomo. En los individuos capturados enfermos se pueden observar signos clínicos, mientras que a partir de muestras de cadáveres se obtienen datos sobre niveles tisulares de plomo. Sin embargo la evaluación de lesiones anatomopatológicas en animales de vida silvestre es difícil de realizar por la dificultad de encontrar animales recién muertos o afectados de un cuadro agudo mortal. La reproducción de esta patología en animales de experimentación se suele realizar en cisnes, palomas o patos, pero no en flamencos, por lo que no es usual disponer de datos histológicos en esta especie. En este trabajo presentamos la clínica, analítica y estudio microscópico de diferentes tejidos de un flamenco común (Phoenicopterus roseus muerto por plumbismo.

  2. Modelling Ar II spectral emission from the ASTRAL helicon plasma

    Science.gov (United States)

    Munoz Burgos, Jorge; Boivin, Robert; Loch, Stuart; Kamar, Ola; Ballance, Connor; Pindzola, Mitch

    2008-11-01

    We describe our spectral modeling of ArII emission from the ASTRAL helicon plasma at Auburn University. Collisional-radiative theory is used to model the emitted spectrum, with account being taken for the density and temperature variation along the line of sight. This study has two main aims. Firstly to test the atomic data used in the model and secondly to identify spectral line ratios in the 200 nm - 1000 nm range that could be used as temperature diagnostics. Using the temperature at which Ar II emission starts to be seen we have been able to test recent ionization and recombination data. Using selected spectral lines we were then able to test the importance of the continuum-coupling effects included in the most recent Ar+ electron impact excitation data. Selected spectral line ratios have been identified that show a strong temperature variation and have potential as a temperature diagnostic.

  3. Factor Structure of CIWA-Ar in Alcohol Withdrawal.

    Science.gov (United States)

    Bakhla, Ajay Kumar; Khess, Christoday R J; Verma, Vijay; Hembram, Mahesh; Praharaj, Samir Kumar; Soren, Subhas

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance), and the third had two items (10.04% variance). Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors. PMID:24826372

  4. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Directory of Open Access Journals (Sweden)

    Ajay Kumar Bakhla

    2014-01-01

    Full Text Available Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance, second factor also had four items (24.25% variance, and the third had two items (10.04% variance. Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors.

  5. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    International Nuclear Information System (INIS)

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  6. 40Ar/39Ar laser probe evidence concerning the age and associated hazards of the Lake Nyos Maar, Cameroon

    Science.gov (United States)

    Dalrymple, G.B.; Lockwood, J.P.

    1990-01-01

    The waters of Lake Nyos are impounded by a fragile natural dam composed of pyroclastic rocks ejected during the formation of the lake crater (maar). Lateral erosion of this dam has reduced its width from over 500 m to only 45 m. Published whole-rock K-Ar ages of about 100 ka on juvenile basalt from the dam suggests that erosion has been slow and that the dam poses no imminent threat. New apparent 40Ar/39Ar ages of 1.4 to 232 Ma on xenocrystic K-feldspar contained in the basalt show that the xenocrysts, whose source is the 528-Ma crystalline basement, are carriers of inherited radiogenic 40Ar and would cause the whole-rock K-Ar ages to be too old. The best estimate for the age of the maar is provided by a 14C age of 400 ?? 100 yr BP on charcoal from the base of the dam. This young age indicates that the dam is eroding at a relatively rapid rate; its failure, perhaps within a few decades, would result in a major flood and imperil thousands of people living downstream in Cameroon and eastern Nigeria. ?? 1990 Kluwer Academic Publishers.

  7. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Science.gov (United States)

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  8. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Science.gov (United States)

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  9. A DNA polymerase mutation that suppresses the segregation bias of an ARS plasmid in Saccharomyces cerevisiae.

    OpenAIRE

    Houtteman, S W; Elder, R T

    1993-01-01

    Yeast autonomously replicating sequence (ARS) plasmids exhibit an unusual segregation pattern during mitosis. While the nucleus divides equally into mother and daughter cells, all copies of the ARS plasmid will often remain in the mother cell. A screen was designed to isolate mutations that suppress this segregation bias. A plasmid with a weak ARS (wARS) that displayed an extremely high segregation bias was constructed. When cells were grown under selection for the wARS plasmid, the resulting...

  10. Estudo técnico-económico para otimização do projeto e implementação de uma bomba de calor "heat machine"

    OpenAIRE

    Silva, Luis Carlos Diniz da

    2015-01-01

    A gestão sustentável de calor residual produzido em processos de arrefecimento em sistemas de Aquecimento, Refrigeração e Ar Condicionado (AVAC), tem recebido uma especial atenção nos últimos anos. O aproveitamento do calor normalmente desperdiçado por estes sistemas para o meio ambiente, pode resultar em poupanças energéticas significativas. Em colaboração com as empresas “ACET Engenharia e Termodinâmica” e “Recipharm”, observou-se a possibilidade de implementar um sistem...

  11. Inovar na produção de energia elétrica a partir do vento. O recurso a postes de eletricidade existentes

    OpenAIRE

    Franco, Miguel Leichsenring

    2012-01-01

    O vento é utilizado há milhares de anos para suprir as necessidades energéticas da atividade humana. A energia eólica é, como a maioria das fontes de energia renovável, uma forma de energia solar, tendo origem no aquecimento da atmosfera pelo sol, que põe em movimento as massas de ar. A rotação da terra, a forma e cobertura da superfície terrestre e os planos de água, influenciam por seu turno o regime dos ventos, ou seja, a velocidade, direção e variabilidade do vento...

  12. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  13. Interatomic scattering in energy dependent photoelectron spectra of Ar clusters

    Energy Technology Data Exchange (ETDEWEB)

    Patanen, M.; Benkoula, S.; Nicolas, C.; Goel, A. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Antonsson, E. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Physikalische und Theoretische Chemie Institut für Chemie und Biochemie, Fachbereich Biologie, Chemie, Pharmazie, Freie Universität Berlin, Takustrasse 3, 14195 Berlin (Germany); Neville, J. J. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Department of Chemistry, University of New Brunswick, Fredericton, New Brunswick E3B 6E2 (Canada); Miron, C., E-mail: Catalin.Miron@synchrotron-soleil.fr [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Extreme Light Infrastructure - Nuclear Physics (ELI-NP), ‘Horia Hulubei’ National Institute for Physics and Nuclear Engineering, 30 Reactorului Street, RO-077125 Măgurele, Jud. Ilfov (Romania)

    2015-09-28

    Soft X-ray photoelectron spectra of Ar 2p levels of atomic argon and argon clusters are recorded over an extended range of photon energies. The Ar 2p intensity ratios between atomic argon and clusters’ surface and bulk components reveal oscillations similar to photoelectron extended X-ray absorption fine structure signal (PEXAFS). We demonstrate here that this technique allows us to analyze separately the PEXAFS signals from surface and bulk sites of free-standing, neutral clusters, revealing a bond contraction at the surface.

  14. Web authentic and similar texts detection using AR digital signature

    OpenAIRE

    Πούλος, Μάριος; Σκιαδόπουλος, Σπύρος; Μπώκος, Γιώργος Δ.

    2010-01-01

    In this paper, we propose a new identification technique based on an AR model with a complexity of size O(n) times in web form, with the aim of creating a unique serial number for texts and to detect authentic or similar texts. For the implementation of this purpose, we used an Autoregressive Model (AR) 15 th order, and for the identification procedure, we employed the cross-correlation algorithm. Empirical investigation showed that the proposed method may be used as an accurate method for id...

  15. Development of a low-level Ar-37 calibration standard

    CERN Document Server

    Williams, R M; Bowyer, T W; Day, A R; Fuller, E S; Haas, D A; Hayes, J C; Hoppe, E W; Humble, P H; Keillor, M E; LaFerriere, B D; Mace, E K; McIntyre, J I; Miley, H S; Myers, A W; Orrell, J L; Overman, C T; Panisko, M E; Seifert, A

    2016-01-01

    Argon-37 is an environmental signature of an underground nuclear explosion. Producing and quantifying low-level Ar-37 standards is an important step in the development of sensitive field measurement instruments. This paper describes progress at Pacific Northwest National Laboratory in developing a process to generate and quantify low-level Ar-37 standards, which can be used to calibrate sensitive field systems at activities consistent with soil background levels. This paper presents a discussion of the measurement analysis, along with assumptions and uncertainty estimates.

  16. Multiphoton Double Ionization of Ar and Ne Close to Threshold

    International Nuclear Information System (INIS)

    In kinematically complete studies we explore double ionization (DI) of Ne and Ar in the threshold regime (I>3x1013 W/cm2) for 800 nm, 45 fs pulses. The basic differences are found in the two-electron momentum distributions - 'correlation' (CO) for Ne and 'anticorrelation' (ACO) for Ar - that can be partially explained theoretically within a 3D classical model including tunneling. Transverse electron momentum spectra provide insight into 'Coulomb focusing' and point to correlated nonclassical dynamics. Finally, DI threshold intensities, CO as well as ACO regimes are predicted for both targets.

  17. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    OpenAIRE

    Ajay Kumar Bakhla; Khess, Christoday R.J.; Vijay Verma; Mahesh Hembram; Samir Kumar Praharaj; Subhas Soren

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance...

  18. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  19. Axenfeld-Rieger syndrome (ARS): A review and case report.

    LENUS (Irish Health Repository)

    Waldron, Jennie M

    2011-08-29

    Axenfeld-Rieger syndrome (ARS) is a rare, autosomal dominant condition characterized by ocular, craniofacial, dental, and periumbilical abnormalities. Relatively little information exists on this syndrome within the dental literature despite the fact that midface hypoplasia and maxillary hypodontia are classical presenting features of this syndrome. This is a case report of a 7-year-old Caucasian female with ARS who presented with significant ocular and dental anomalies. She was also found to have osteopenia. Her dental condition is described, her immediate treatment is shown, and her long-term treatment needs are discussed.

  20. Daño a los hepatocitos por lectina inhibible por D-Galactosa/N-Acetil D-Galactosamina de Entamoeba Histolytica

    OpenAIRE

    Judith Pacheco Yépez; Adrián Rondán Zárate; Mineko Shibayama; Víctor Tsutsumi; Rafael Campos Rodríguez

    2006-01-01

    La lectina de Entamoeba Histolytica se ha involucrado de manera importante en la patogenia de la amibiasis y se cree que participa en la adherencia de los trofozoítos a las células blanco. Además, se describe que la lectina puede dañar directamente a las células blanco. Por otro lado, el papel de los anticuerpos en la inmunidad protectora es controversial. En el presente estudio nosotros analizamos si la lectina se une a la superficie de los hepatocitos y los daña directamente;...

  1. Se los por se lo

    Directory of Open Access Journals (Sweden)

    José Luis Rivarola

    1985-12-01

    Full Text Available El sistema de la conjugación "objetiva" plantea interesantesproblemas que fueron tratados en parte por K. Heger (1966 en suestudio comparativo del francés y del español. De la comparaciónse desprende, por ejemplo, que en español hay un cierto número deambigüedades que no permiten establecer un "paradigma tan completo y unívoco" como en el caso del francés. Dentro de estas ambigüedades se encuentran las que propicia el gramema se: "El morfema [gramema] se funciona no sólo como pronombre reflexivo, sinotambién como variante combinatoria del pronombre personal complemento indirecto de la tercera persona.

  2. por el Tribunal Constitucional chileno

    Directory of Open Access Journals (Sweden)

    Marisol Peña Torres

    2008-01-01

    Full Text Available La modificación introducida por la reforma constitucional de agosto de 1989 al artículo 5º de la Constitución chilena sentó un criterio decisivo en la incorporación del derecho internacional de los derechos humanos al ordenamiento jurídico interno. El artículo examina la jurisprudencia del Tribunal Constitucional antes y después de esa reforma distinguiendo entre la aplicación del Derecho Internacional de los Derechos Humanos por haberse invocado en la acción deducida y la aplicación de principios y criterios hermenéuticos extraídos del mismo.

  3. Influencia de las mezclas de gases Ar-He y Ar-He-O2 en la soldabilidad de la aleación de aluminio AA5083-O usando Proceso GMAW-P automatizado

    Directory of Open Access Journals (Sweden)

    Enrique Esteban Niebles Nuñez

    2014-09-01

    Full Text Available La problemática en las empresas fabricantes de estructuras y construcciones soldadas en aluminio se centra en la disminución de las propiedades mecánicas de las uniones soldadas influenciada por el aporte térmico en las regiones de soldadura; así como, en los efectos de las discontinuidades y defectos, los altos costos de reparación de soldaduras y la baja productividad. El objetivo de este trabajo es evaluar la influencia de las mezclas de gases 80Ar20He (MG1, 60Ar40He (MG2, 80Ar19He1O2 (MG3, 60Ar39He1O2 (MG4, sobre la soldabilidad de la aleación de aluminio AA5083-O utilizando un material de aporte ER5183 y el proceso GMAW-P automatizado. La metodología incluyó una fase de parametrización de soldaduras, la caracterización del metal base y las regiones de soldadura. El análisis de resultados se llevó a cabo en términos de la evolución microestructural en las regiones de soldadura y evaluación de las propiedades como dureza, resistencia y elongación, así como la evaluación de discontinuidades y defectos de la unión, costos y velocidad de soldadura. Los resultados muestran que las mezclas de gas que contienen O2 favorecen significativamente la soldabilidad de la aleación en estudio.

  4. Sepsis neonatal por Estreptococos Pyogenes

    Directory of Open Access Journals (Sweden)

    Gilberto Rodríguez-Herrera

    2009-09-01

    Full Text Available Se presenta el caso de un paciente masculino, recién nacido a término adecuado para la edad gestacional, quien nace por parto vaginal, con el antecedente de fiebre en la madre durante el periodo de postparto inmediato. Los padres consultan a los 2 días de vida pues le notan dificultad respiratoria, hipoactividad y rechazo a la leche materna. El paciente se interna y se aborda como una sepsis. Durante su estancia en el servicio de neonatología del Hospital Nacional de Niños asocia fallo respiratorio que amerita ventilación mecánica asistida por varios días en diferentes ocasiones, derrame pleural exudativo, convulsiones de origen hipóxico isquémico. Con reporte de hemocultivos positivos por Estreptococos pyogenes. El Estreptococos pyogenes o estreptococo β-hemolνtico del grupo A, fue un problema en los comienzos del siglo pasado, siendo frecuente en las infecciones puerperales y del reciιn nacido. En la actualidad es un germen sumamente raro en los procesos de sepsis neonatal.2 La gravedad de la enfermedad causada por este microorganismo en el periodo neonatal varνa desde una onfalitis crónica de bajo grado a una septicemia, una meningitis fulminante y la muerte.1 El presente artículo pretende hacer un resumen del paciente, con su evolución clínica, radiológica y además ejemplificar todas las complicaciones que tuvimos con este germen tan poco frecuente en la actualidad en sepsis neonatal.

  5. Thermal plasma properties for Ar-Al, Ar-Fe and Ar-Cu mixtures used in welding plasmas processes: I. Net emission coefficients at atmospheric pressure

    Science.gov (United States)

    Cressault, Y.; Gleizes, A.

    2013-10-01

    This article is devoted to the calculation of the net emission coefficient (NEC) of Ar-Al, Ar-Fe and Ar-Cu mixtures at atmospheric pressure for arc welding processes. The results are given in data tables for temperatures between 3 kK and 30 kK, for five plasma thicknesses (0, 0.5, 1, 2, 5 mm) and ten concentrations of metallic vapours (pure gas, 0.01%, 0.1%, 1%, 5%, 10%, 25%, 50%, 75% and pure metal vapours in mass proportions). The results are in good agreement with most of the works published on the subject for such mixtures. They highlight the influence of three parameters on the radiation of the plasma: the NEC is directly related to temperature and inversely related to plasma radius and is highly sensitive to the presence of metal vapours. Finally, numerical data are supplied in tables in order to develop accurate computational modelling of welding arc and to estimate both qualitatively and quantitatively the influence of each metallic vapour on the size and on the shape of the weld pool.

  6. Characterization of the ars Gene Cluster from Extremely Arsenic-Resistant Microbacterium sp. Strain A33▿ †

    Science.gov (United States)

    Achour-Rokbani, Asma; Cordi, Audrey; Poupin, Pascal; Bauda, Pascale; Billard, Patrick

    2010-01-01

    The arsenic resistance gene cluster of Microbacterium sp. A33 contains a novel pair of genes (arsTX) encoding a thioredoxin system that are cotranscribed with an unusual arsRC2 fusion gene, ACR3, and arsC1 in an operon divergent from arsC3. The whole ars gene cluster is required to complement an Escherichia coli ars mutant. ArsRC2 negatively regulates the expression of the pentacistronic operon. ArsC1 and ArsC3 are related to thioredoxin-dependent arsenate reductases; however, ArsC3 lacks the two distal catalytic cysteine residues of this class of enzymes. PMID:19966021

  7. AR-40 AR-39 Age of an Impact-Melt Lithology in DHOFAR 961

    Science.gov (United States)

    Frasl, B.; Cohen, B. A.; Li, Z.-H.; Jolliff, B.; Korotev, R.; Zeigler, R.

    2016-01-01

    , although they note that further age dating of all the stones is required to test this hypothesis. We received a split of Dhofar 961 from R. Zeigler consisting of a large clast of IM Lithology B, with some light-colored, friable matrix clinging to the external margins of the impact-melt clast. This lithology was not present in the samples investigated by Joy et al. and thus does not have corresponding U-Pb ages on it. We created multiple subsplits of both the IM and matrix lithologies, each weighing several tens of micrograms. We conducted Ar-40 Ar-39 dating of this candidate SPA material by high-resolution step heating and comparing it with the regolith that surrounds it.

  8. Thermal History of the Felsite Unit, Geysers Geothermal Field, From Thermal Modeling of 40Ar/39Ar Incremental Heating Data

    Energy Technology Data Exchange (ETDEWEB)

    T. M. Harrison (U of California); G. B. Dalrymple (Oregon State U); J. B. Hulen (U of Utah); M. A. Lanphere; M. Grove; O. M. Lovera

    1999-08-19

    An Ar-40/Ar-39 and U-Pb study was performed of the Geysers plutonic complex of the Geysers Geothermal Field in California. Sixty-nine ion microprobe spot analyses of zircons from four granite samples from the plutonic complex that underlies the Geysers geothermal field yielded Pb-207/Pb-206 vs. U-238/Pb-206 concordia ages ranging from 1.13 {+-} 0.04 Ma to 1.25 {+-} 0.04 Ma. The U-Pb ages coincide closely with Ar-40/Ar-39 age spectrum plateau and ''terminal'' ages from coexisting K-feldspars and with the eruption ages of overlying volcanic rocks. The data indicate that the granite crystallized at 1.18 Ma and had cooled below 350 C by {approximately}0.9-1.0 Ma. Interpretation of the feldspar Ar-40/Ar-39 age data using multi-diffusion domain theory indicates that post-emplacement rapid cooling was succeeded either by slower cooling from 350-300 C between 1.0 and 0.4 Ma or transitory reheating to 300-350 C at about 0.4-0.6 Ma. Heat flow calculations constrained with K-feldspar thermal histories and the pre sent elevated regional heal flow anomaly demonstrate that appreciable heat input from sources external to the known Geysers plutonic complex is required to maintain the geothermal system. This requirement is satisfied by either a large, underlying, convecting magma chamber (now solidified) emplaced at 1.2 Ma or episodic intrusion of smaller bodies from 1.2-0.6 Ma.

  9. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    Institute of Scientific and Technical Information of China (English)

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  10. DERRIDA E BARTHES: POR ENTRE SINGULARIDADES E PLURALIDADES

    Directory of Open Access Journals (Sweden)

    Raquel Campos

    2015-12-01

    Full Text Available Através da homenagem feita por Derrida a Barthes em seu ensaio “As mortes de Roland Barthes”, o artigo pretende traçar os pontos de encontro entre os dois pensadores em meio à pluralidade de suas ideias e na singularidade das mesmas. “Essa singularidade penetrada me alcança de um golpe, me fere ou me assassina e, em princípio, parece olhar diretamente para mim. […] A mim se dirige a singularidade absoluta do outro” (2008, p.275, como afirma Derrida em seu ensaio. Os pontos intransponíveis entre um indivíduo e outro criam as singularidades, ao mesmo tempo em que contribuem, aporeticamente, à pluralidade de caminhos, possibilidades e ideias. O aparente paradoxo entre esses dois pontos e a coexistência de ambos em um mesmo espaço serão analisados, na tentativa de encontrar consonâncias entre dois tão importantes pensadores, distintos, mas que, por vezes, trabalharam em suas respectivas obras com questões similares.

  11. ^(40)Ar/^(39)Ar constraints on the age and thermal history of the Urucum Neoproterozoic banded iron-formation, Brazil

    OpenAIRE

    Piacentini, Thiago; Vasconcelos, Paulo M.; Farley, Kenneth A.

    2013-01-01

    Urucum is one of the youngest banded iron-formations (BIFs) yet its exact age remains uncertain. ^(40)Ar/^(39)Ar geochronology on late-diagenetic to early metamorphic cryptomelane from the Urucum sequence reveals a minimum depositional age of 587 ± 7 Ma. Metamorphic braunite age spectra yield flat segments defining apparent ages of 547 ± 3 Ma to 513 ± 4 Ma, interpreted as recrystallization or cooling ages. Metamorphic muscovite grains from a meta-arkose interbedded with the BIF yield reproduc...

  12. Vector Magnetic Field Measurement of NOAA AR 10197

    Institute of Scientific and Technical Information of China (English)

    Hong-Fei Liang; Hai-Juan Zhao; Fu-Yuan Xiang

    2006-01-01

    A set of two-dimensional Stokes spectral data of NOAA AR 10197 obtained by the Solar Stokes Spectral Telescope (S3T) at the Yunnan Observatory are qualitatively analyzed.The three components of the vector magnetic field, the strength H, inclination γ and azimuth x, are derived. Based on the three components, we contour the distributions of the longitudinal magnetic field and transverse magnetic field. The active region (AR) has two different magnetic polarities apparent in the longitudinal magnetic map due to projection effect. There is a basic agreement on the longitudinal magnetic fields between the S3T and SOHO/MDI magnetograms, with a correlation coefficient ρBl = 0.911. The transverse magnetic field of the AR has a radial distribution from a center located in the southwest of the AR. It is also found that the transverse magnetic fields obtained by Huairou Solar Observing Station (HRSOS) have a similar radial distribution. The distributions of transverse magnetic field obtained by S3T and HRSOS have correlation coefficients, ρAzimu = 0.86 and ρBt = 0.883,in regard to the azimuthal angle and intensity.

  13. He-, Ne-, and Ar-phosgene intermolecular potential energy surfaces

    DEFF Research Database (Denmark)

    Munteanu, Cristian R.; Henriksen, Christian; Felker, Peter M.;

    2013-01-01

    Using the CCSD(T) model, we evaluated the intermolecular potential energy surfaces of the He-, Ne-, and Ar-phosgene complexes. We considered a representative number of intermolecular geometries for which we calculated the corresponding interaction energies with the augmented (He complex) and doub...

  14. Tensor Effect on Proton Bubble Structure of ~(46)Ar

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    We have calculated the proton density distribution of 46Ar for different pairing interactions with the Skyrme interactions SLy5 and SLy5+Tw (Tw is the tensor force, which was obtained by the G-matrix calculations and added perturbatively into the SLy5 interaction

  15. Big data computing: Building a vision for ARS information management

    Science.gov (United States)

    Improvements are needed within the ARS to increase scientific capacity and keep pace with new developments in computer technologies that support data acquisition and analysis. Enhancements in computing power and IT infrastructure are needed to provide scientists better access to high performance com...

  16. Expansion of the USDA ARS Aerial Application spray atomization models

    Science.gov (United States)

    An effort is underway to update the USDA ARS aerial spray nozzle models using new droplet sizing instrumen-tation and measurement techniques. As part of this effort, the applicable maximum airspeed is being increased from 72 to 80 m/s to provide guidance to applicators when using new high speed air...

  17. Interacting with Visual Poems through AR-Based Digital Artwork

    Science.gov (United States)

    Lin, Hao-Chiang Koong; Hsieh, Min-Chai; Liu, Eric Zhi-Feng; Chuang, Tsung-Yen

    2012-01-01

    In this study, an AR-based digital artwork called "Mind Log" was designed and evaluated. The augmented reality technique was employed to create digital artwork that would present interactive poems. A digital poem was generated via the interplay between a video film and a text-based poem. This artwork was created following a rigorous design flow,…

  18. Spectroscopy Study of Ar + CO2 Plasmas in ASTRAL.

    Science.gov (United States)

    Munoz, Jorge; Boivin, Robert; Kamar, Ola; Loch, Stuart; Ballance, Connor

    2006-10-01

    A spectroscopy study of the ASTRAL (Auburn Steady sTate Research fAciLity) helicon plasma source running Ar + CO2 gas mix is presented. ASTRAL produces Ar plasmas: ne = 10^10 to 10^13 cm-3, Te = 2 to 10 eV and Ti = 0.03 to 0.5 eV. A series of 7 large coils produce an axial magnetic field up to 1.3 kGauss. A fractional helix antenna is used to introduce rf power up to 2 kWatt. A spectrometer which features a 0.33 m Criss-Cross monochromator and a CCD camera is used for this study. Very different plasmas are produced following the relative importance of CO2 in the gas mixture. At low CO2 concentration, the plasmas are similar to those obtained with pure Ar with weak CO2, CO2^+, CO and CO^+ bands. The usual blue plasma core associated with intense Ar II transitions is observed with however a significant white glow coming from the outer plasma regions. At higher CO2 concentration, the plasma becomes essentially molecular and can be described as an intense white plasma column. Molecular dissociative processes associated with the production of strong C and O atomic lines are observed under specific plasma conditions. The atomic spectral lines are compared with ADAS modeling results. This study indicates the possible advantages of using a helicon source to control the CO2 plasma chemistry for industrial applications.

  19. 75 FR 12163 - Class E Airspace; Mountain View, AR

    Science.gov (United States)

    2010-03-15

    ...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p. 389... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Mountain View, AR AGENCY:...

  20. CANONICAL COMPUTATIONAL FORMS FOR AR 2-D SYSTEMS

    NARCIS (Netherlands)

    ROCHA, P; WILLEMS, JC

    1990-01-01

    A canonical form for AR 2-D systems representations is introduced. This yields a method for computing the system trajectories by means of a line-by-line recursion, and displays some relevant information about the system structure such as the choice of inputs and initial conditions.

  1. Atom trap trace analysis of {sup 39}Ar

    Energy Technology Data Exchange (ETDEWEB)

    Welte, Joachim

    2011-12-14

    Detection of {sup 39}Ar in natural water samples can be employed for radiometric dating on a timescale of 50 to 1000 years before present. This experimental work comprises the setup of an atomic beam and trap apparatus that captures and detects {sup 39}Ar atoms by the laser-cooling technique ''Atom Trap Trace Analysis''. With this approach, the limitations of low-level counting, regarding sample size and measurement time, could be overcome. In the course of this work, the hyperfine structure spectrum of the cooling transition 1s{sub 5}-2p{sub 9} has been experimentally determined. A high intensity, optically collimated beam of slow metastable argon atoms has been set up and fluorescence detection of individual {sup 39}Ar atoms in a magneto-optical trap is realized. {sup 39}Ar count rates of 1 atom in about 4 hours have been achieved for atmospheric argon. Recent improvements further suggest that even higher count rates of 1 atom/hour are within reach.

  2. Important authorship clarification for arXiv:1010.2709

    OpenAIRE

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  3. Global properties of the white dwarf pulsar AR Scorpii

    CERN Document Server

    Franzon, B

    2016-01-01

    In view of the new recent observation and measurement of the fast-rotating and highly-magnetized white dwarf AR Sco \\cite{Marsh:2016uhc}, we determine bounds for its radius, magnetic fields, moment of inertia and gravitational wave (GW) emission by using observations of the luminosity, as well the rotation frequency $\

  4. Immune epitope database analysis resource (IEDB-AR)

    DEFF Research Database (Denmark)

    Zhang, Qing; Wang, Peng; Kim, Yohan;

    2008-01-01

    We present a new release of the immune epitope database analysis resource (IEDB-AR, http://tools.immuneepitope.org), a repository of web-based tools for the prediction and analysis of immune epitopes. New functionalities have been added to most of the previously implemented tools, and a total...

  5. USDA-ARS and EMBRAPA Scientists Build Bridges With Strawberries

    Science.gov (United States)

    At the '3rd Simposio Nacional do Morango'and '2nd Encontro de Pequenas Frutas e Frutas Nativas do Mercosul' at Pelotas, Rio Grande Do Sul, Brazil, held 7 - 10 November 2006, I was invited to describe strawberry breeding in the United States and also my own USDA-ARS strawberry breeding program at Bel...

  6. Ars Fennica - isikliku ja poliitilise vahel / Janar Ala

    Index Scriptorium Estoniae

    Ala, Janar, 1979-

    2009-01-01

    2008. aasta Ars Fennica kunstiauhinna kandidaatide tööde näitus Kumu Kunstimuuseumis kuni 26. aprillini. Läti kunstniku Katrina Neiburga, soomlaste Seppo Renvalli, Maria Dunckeri ja Tea Mäkipää ning Mark Raidpere näitusel eksponeeritud töödest

  7. Mälestusi "Ars Fennica'st" / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-

    2009-01-01

    Ars Fennica 2008. aasta nominentide Tea Mäkipää, Seppo Renvalli, Maria Dunckeri, Katrīna Neiburga (Läti) ja Mark Raidpere näitus Kumu Kunstimuuseumis 26. aprillini. Preemiaga pärjati Mark Raidpere ekspositsioon

  8. Strong-field nonsequential double ionization of Ar and Ne

    International Nuclear Information System (INIS)

    We investigate the nonsequential double ionization (NSDI) of Ar and Ne based on quantitative rescattering theory (QRS). According to QRS theory, each elementary NSDI process can be calculated by multiplying the returning electron wave packet with appropriate differential electron-ion scattering cross sections. We include (e, 2e) and electron-impact excitation cross sections of Ar+ to obtain the correlated electron momentum spectra for the NSDI of Ar by few-cycle pulses to check the dependence of NSDI on the carrier-envelope phase. The results are compared to the ion momentum spectra from the recent experiment of Johnson et al. [Phys. Rev. A 83, 013412 (2011)]. Calculations have also been performed for Ar at another intensity to illustrate the intensity dependence of NSDI and to compare with the earlier data of Feuerstein et al. [Phys. Rev. Lett. 87, 043003 (2001)] and for Ne to illustrate the target dependence. We also address the presence of resonant capture processes in electron-ion collisions in the NSDI spectra.

  9. Desajuste educativo por regiones en Colombia: ¿competencia por salarios o por puestos de trabajo?

    Directory of Open Access Journals (Sweden)

    Castillo Caicedo Maribel

    2007-08-01

    Full Text Available Este trabajo aporta una perspectiva del fenómeno de la sobreeducación,
    entendida como un desajuste por exceso, entre el nivel educativo alcanzado
    por el individuo y el exigido por el puesto de trabajo en el cual se
    desempeña; esto se debe a que existe una demanda laboral estrecha de
    puestos de trabajo para personas calificadas en Colombia. Se analizan las
    contribuciones empíricas existentes y el debate sobre las mismas; se
    examinan las teorías que permiten explicar la existencia de un desajuste
    educativo y se realiza una revisión de la literatura internacional y
    nacional sobre el tema. Adicionalmente, se plantean una serie de hipótesis
    para desarrollar un esquema que permita determinar el comportamiento
    del individuo en el fenómeno de la sobreeducación.

  10. IMPACTO DEL ARSÉNICO EN EL AMBIENTE Y SU TRANSFORMACIÓN POR MICROORGANISMOS

    Directory of Open Access Journals (Sweden)

    Edelweiss Airam Rangel Montoya

    2015-06-01

    Full Text Available El arsénico (As es uno de los metaloides más tóxicos presentes en el medio ambiente y la especiación de éste depende de diversos factores químicos, físicos y biológicos. La distribución y contaminación del arsénico se debe a procesos naturales y antropogénicos, y su problemática se debe a su fácil movilización en el ambiente. Las altas concentraciones de arsénico en agua y suelo se han convertido en un problema global, ya que las exposiciones prolongadas a este metaloide pueden causar daños crónicos a la salud. Dicha situación es particularmente importante en la Comarca Lagunera en México. Por lo tanto, se ha vuelto necesaria la búsqueda de nuevas estrategias para la remoción de este metaloide, entre las cuales, la biorremediación microbiana ha cobrado importancia como una alternativa amigable con el ambiente en la solución de este problema. Los microorganismos juegan un papel fundamental en la especiación del arsénico, ya que un gran número de estos tiene la capacidad de transformar el arsénico a pesar de su toxicidad puesto que han desarrollado diferentes mecanismos que les permiten utilizar el arsénico en su metabolismo, ya sea en su forma reducida de arsenito, o en su forma oxidada de arseniato mediante reacciones de óxido-reducción transformación enzimática, metilación, quelación, exclusión e inmovilización. Este trabajo, trata sobre el impacto que tiene la especiación de arsénico, especialmente del arsenito (As III, en el medio ambiente, el riesgo que representa la contaminación para la salud, así como los mecanismos bioquímicos microbianos para la oxidación del arsenito, disminuir su toxicidad y el desarrollo de estrategias limpias y amigables con el medio ambiente para la remoción de arsénico de aguas y suelos contaminados.

  11. Gestión de recursos humanos por competencias en los proyectos de software

    Directory of Open Access Journals (Sweden)

    Jorge Soler

    2011-10-01

    Full Text Available Este trabajo tiene como objetivo contribuir a la implementación, en la industria de software, de la gestión de recursos humanos basado en el enfoque por competencias. Para ello, se realiza y fundamenta una propuesta de roles invariantes que participan tanto en proyectos de desarrollo como de implantación de software, y de competencias tanto técnicas como genéricas requeridas para desempeñar los roles propuestos. En el trabajo se fundamenta el uso del método Delphi y las variaciones requeridas, como vía para validar la propuesta de roles y competencias, y para identificar la importancia de cada competencia en el desempeño de cada rol. Además, se propone un procedimiento para determinar el índice de competencia de una persona para desempeñar un rol asignado en el proyecto.

  12. Precision angle-resolved autoionization resonances in Ar and Ne

    Energy Technology Data Exchange (ETDEWEB)

    Berrah, N.; Langer, B.; Gorczyca, T.W. [Western Michigan Univ., Kalamazoo, MI (United States)] [and others

    1997-04-01

    Theoretical work has shown that the electron angular distribution and the shape of the autoionization resonances are crucial to the understanding of certain types of electron-electron correlation. Autoionization resonances in Ne (Ar) result from the decay of the excited discrete state Ne{sup *} 2s2p{sup 6} np (Ar{sup *} 3s3p{sup 6} np) into the continuum state Ne{sup +} 2s{sup 2}2p{sup 5} + e{sup {minus}} (ks,kd) (Ar{sup +} 3s{sup 2}3p{sup 5} + e{sup {minus}} (ks,kd)). Since the continuum can also be reached by direct photoionization, both paths add coherently, giving rise to interferences that produce the characteristic Beutler-Fano line shape. In this work, the authors report on quantitative angle-resolved electron spectrometry studies of (a) the Ne 2s{sup 2}2p{sup 6} {r_arrow} 2s2p{sup 6} np (n=3-5) autoionizing resonances and the 2s{sup 2}2p{sup 6} {r_arrow} 2p{sup 4}3s3p doubly excited resonance, (b) the Ar 3s{sup 2}3p{sup 6} {r_arrow} 3s3p{sup 6} np (n=4-9) autoionization resonances and extended R-matrix calculations of the angular-distribution parameters for both Ne and Ar measurements. Their results are compared with previous theoretical work by Taylor.

  13. Medida de parámetres termoeléctricos en un sistema constituido por dispositivos PELTIER SEEBECK.

    OpenAIRE

    Arroyo Giner, Juan José

    2013-01-01

    El objetivo de este trabajo es diseñar un sistema de medida que obtenga ciertos parámetros termoeléctricos de un sistema constituido por un dispositivo Seebeck-Peltier. Para llevar a cabo las adquisiciones se utiliza como interfaz un módulo Arduino con sensores adheridos a los disipadores del sistema termoeléctrico y demás dispositivos auxiliares con el fin de adquirir la señal, por consiguiente estos datos se procesarán a través del programa Labview donde monitorizaremos los parámetros de...

  14. Interference of heating on the antimicrobial activity and chemical composition of Origanum vulgare L. (Lamiaceae essential oil Interferência do aquecimento sobre a atividade antimicrobiana e composição química do óleo essencial de Origanum vulgare L. (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Evandro Leite de Souza

    2008-06-01

    (Candida albicans, C. krusei, C. tropicalis, Bacillus cereus, Escherichia coli, Staphylococcus aureus, Yersinia enterocolitica, Salmonella enterica e Serratia marcencens mostrando amplos halos de inibição do crescimento microbiano (30a42mm. O aquecimento do óleo essencial de O. vulgare não mostrou interferência (p < 0.05 sobre sua propriedade antimicrobiana, sendo observado o desenvolvimento de halos de inibição do crescimento microbiano com diâmetros similares ou aproximados quando ensaiadas a alíquota do óleo essencial mantido em temperatura ambiente e as alíquotas submetidas a diferentes temperaturas de aquecimento. Os valores de CIM encontrados para o óleo essencial de O. vulgare oscilaram entre 10 a 40 µL.mL-1 (20 µL.mL-1 para a maioria das amostras, entretanto nenhuma diferença significativa (p < 0.05 foi notada para os valores de CIM encontrados para as alíquotas do óleo essencial exposto a diferentes temperaturas. Ademais, o aquecimento não interferiu significativamente (p < 0.05 sobre a composição química do óleo essencial. A análise da composição do óleo essencial mostrou a presença de monoterpenos, compostos terpênicos e sesquiterpenos, de modo que carvacrol (68,06 a 70,27% e p-cimeno (12,85 a 154,81% foram os compostos encontrados em maiores concentrações no óleo essencial. Estes resultados mostram a estabilidade térmica do óleo essencial de O. vulgare e suporta seu possível uso concomitante com altas temperaturas em sistemas de conservação de alimentos.

  15. Pneumonia por Legionella após uso de Infliximabe em paciente com Artrite Reumatoide

    Directory of Open Access Journals (Sweden)

    Karina de Souza Giassi

    2014-10-01

    Full Text Available Os antagonistas do fator de necrose tumoral (anti-TNF têm sido utilizados com sucesso em várias doenças inflamatórias crônicas, como artrite reumatoide (AR, mas alguns estudos observaram a ocorrência de infecções por patógenos intracelulares em pacientes medicados com anti-TNF. Relatamos um caso de paciente mulher com diagnóstico prévio de AR durante 16 anos e que estava sendo medicada com várias drogas antirreumáticas modificadoras de doença (DARMDs, tendo como resultado o insucesso terapêutico, sendo em seguida tratada com infliximab. Depois de transcorridos 15 dias da segunda dose, a paciente foi acome- tida por dor torácica ventilatório-dependente, tosse seca e dispneia. Foi hospitalizada, e o diagnóstico de pneumonia por Legionella pneumophila foi confirmado pela presença do antí- geno de Legionella na urina. TNF é uma citocina inflamatória que também promove inibição do crescimento bacteriano de patógenos intracelulares, e sua inibição parece aumentar a sensibilidade a essas infecções em alguns pacientes.

  16. Influência das temperaturas de síntese e de queima na sinterização de cerâmicas de titanato de bário obtido por via hidrotérmica

    Directory of Open Access Journals (Sweden)

    Antônio Alves Mendes Filho

    2002-04-01

    Full Text Available Pós finos de titanato de bário, na composição BaTiO3, foram produzidos por síntese hidrotérmica entre 140°C e 220°C, com tempos variando entre 4 e 20h, com o enchimento crítico das autoclaves. Foram empregadas, na mistura, proporções Ba/Ti de 1,02 e 2,00. Desses pós foram produzidas peças cerâmicas sinterizadas a 1180°C, 1250°C e 1320°C com patamares de 2,5h e taxa de aquecimento de 1°C/min. As densidades das pastilhas cerâmicas de titanato de bário foram determinadas e correlacionadas à temperatura de sinterização. As microestruturas das peças sinterizadas foram observadas por microscopia eletrônica de varredura.Fine barium titanium oxide powders were produced by the hydrothermal process in temperatures between 140 and 220°C, and times between 4 and 20 hours, for the critical filling of the autoclaves, and Ba/Ti ratios in the mixture of 1.02 and 2.00. The powders were pressed and sintered at 1180, 1250 and 1320°C for 2,5h and a heating rate of 1°C/min. The densities of the sintered bodies were measured and related to the sintering conditions. Microstructures of the ceramic samples were examined by SEM.

  17. Clonagem de canistel por estaquia

    Directory of Open Access Journals (Sweden)

    Fernando Marcelo Chiamolera

    2014-09-01

    Full Text Available O canistel é nativo do sul do México e América Central e seus frutos apresentam elevado teor de carotenoides e vitamina A. Sua propagação é feita via sementes, resultando em considerável variabilidade genética entre os indivíduos, sendo a propagação vegetativa preferível, a fim de fixar características desejáveis. Assim, o objetivo deste trabalho foi avaliar a propagação vegetativa por estaquia de ramos semi-herbáceos de canistel, em função de quatro genótipos e quatro concentrações de AIB. Foram utilizadas estacas semiherbáceas apicais, mantidas com um par de folhas, sob nebulização intermitente, por 120 dias. O delineamento experimental foi o inteiramente casualizado, em esquema fatorial 4×4 (genótipos de canistel × concentrações de AIB, com quatro repetições e dez estacas por parcela. Foram avaliados a porcentagem de sobrevivência, a retenção foliar, o enraizamento, o calejamento, o número e o comprimento médio de raízes por estaca. O genótipo PC-1 foi superior aos demais, em todas as variáveis avaliadas, com destaque para o enraizamento das estacas, superior a 60%. As concentrações de AIB (0; 1.000; 3.000 e 5.000 mg L-1 não influenciaram na sobrevivência, retenção foliar e enraizamento das estacas, mas aumentaram o número e o comprimento de raízes em relação ao tratamento-controle (sem AIB. Há diferença na capacidade de enraizamento das estacas entre os genótipos de canistel, sendo a melhor resposta obtida com PC-1. A concentração de 3.000 mg L-1 de AIB resulta em maior número e comprimento de raízes nas estacas de canistel.

  18. Once mil metros por segundo

    OpenAIRE

    2012-01-01

    Esta exposición es una ventana hacia el mundo de la Ciencia Ficción. Los sueños de escritores extraordinarios, personajes, lugares, máquinas y robots que cada día están más cerca de nuestra cotidianidad gracias a los avances de la ciencia y la tecnología hacen parte de la muestra itinerante por las sedes de la Universidad Nacional. El visitante puede recorrer los diferentes géneros que constituyen este género literario, además de conocer sus principales representantes. Así mismo se explor...

  19. Sepsis neonatal por Estreptococos Pyogenes

    OpenAIRE

    Gilberto Rodríguez-Herrera; Cinthya Ramírez-Navarro

    2009-01-01

    Se presenta el caso de un paciente masculino, recién nacido a término adecuado para la edad gestacional, quien nace por parto vaginal, con el antecedente de fiebre en la madre durante el periodo de postparto inmediato. Los padres consultan a los 2 días de vida pues le notan dificultad respiratoria, hipoactividad y rechazo a la leche materna. El paciente se interna y se aborda como una sepsis. Durante su estancia en el servicio de neonatología del Hospital Nacional de Niños asocia fallo respir...

  20. Miasis ocular por Oestrus ovis

    Directory of Open Access Journals (Sweden)

    María Beltrán F

    2006-01-01

    Full Text Available Se presentan tres casos de miasis ocular (dos adultos y un niñoprocedentes de zonas ganaderas de la provincia de Huaura,departamento de Lima,que acudieron al Hospital Regional de Huacho por presentar el ojo rojo,fotofobia, edema palpebral y sensación de cuerpo extraño;se extrajeron larvas adheridas al canto interno del ojo,las cuales se recibieron en el Instituto Nacional de Salud y fueron identificadas como Oestrus ovis .

  1. Experimental study on AR fiberglass connectors for bridges made of composite materials

    Directory of Open Access Journals (Sweden)

    Tolosana, N.

    2006-06-01

    Full Text Available One highly relevant aspect in composite material bridgedesing is the study of the shear connectors to be used.Composite material bridges most commonly comprise acomposite deck resting on steel or reinforced concrete girders.This article analyzes the connectors most frequentlyused in such bridges.It also reviews the connectors used in the King StormwaterChannel Bridge, whose fibreglass deck is supported bygirders made of concrete-filled carbon fibre girders.The paper advances proposals for several types of connectorsand discusses the results of push-out test run ona number of prototypes with different geometries.The results are analyzed to identify the optimum model forthe “Autovia del Cantabrico” Overpass, with its 46-m span,carbon fibre girders and AR glass shear connectors.Un aspecto relevante dentro del proyecto de un puenterealizado en materiales compuestos es el estudio de losconectores. El caso mas frecuente de puente en materialescompuestos es aquel que presenta un tablero de materialescompuestos soportado por vigas metalicas o de hormigonarmado. En este trabajo se analizaran los tipos deconectores mas utilizados en este tipo de puentesSe analizaran tambien los conectores utilizados en elKing Stormwater Channel Bridge, donde ademas deltablero en fibra de vidrio, se fabricaron las vigas en fibrasde carbono rellenas de hormigon.En este articulo se propondran varios tipos de conectoresy se presentaran los resultados experimentales correspondientesal ensayo de “push-out” de varios prototipos condiferentes geometrias.Tras evaluar los resultados, se determinara el mas idoneopara su implantacion en el Paso Superior de la Autovia delCantabrico, de 46 metros de luz y que presenta las vigasen fibra de carbono y los conectores de vidrio AR.

  2. Geochemistry and 40Ar/39Ar age of Early Carboniferous dolerite sills in the southern Baltic Sea

    Directory of Open Access Journals (Sweden)

    Gediminas Motuza

    2015-08-01

    Full Text Available The Early Carboniferous magmatic event in the southern Baltic Sea is manifested by dolerite intrusions. The presumable area in which the dolerite intrusions occur ranges from 30 to 60 km in east–west direction, and is about 100 km in north–south direction. The dolerites were sampled in well D1-1 and investigated by applying chemical analysis and 40Ar/39Ar step-heating dating. Dolerites are classified as alkali and sodic, characterized by high TiO2 (3.92, 3.99 wt% and P2O5 (1.67, 1.77 wt% and low MgO (4.89, 4.91 wt% concentrations, enriched in light rare earth elements, originated from an enriched mantle magma source and emplaced in a continental rift tectonic setting. The 351 ± 11 Ma 40Ar/39Ar plateau age for groundmass plagioclase indicates a considerable age gap with the 310–250 Ma magmatism in southern Scandinavia and northern Germany. The magmatic rocks in the Baltic Sedimentary Basin are coeval with alkaline intrusions of NE Poland. Both magmatic provinces lie in the northwestward prolongation of the Pripyat–Dnieper–Donetsk Rift (370–359 Ma and may constitute a later phase of magmatic activity of this propagating rift system.

  3. ISEA reversed event in the Cretaceous Normal Superchron (CNS):40Ar/39Ar dating and paleomagnetic results

    Institute of Scientific and Technical Information of China (English)

    SHI Ruiping; HE Huaiyu; ZHU Rixiang; PAN Yongxin

    2004-01-01

    In order to provide the age for the ISEA (one reversed event in the CNS) a combined rock magnetic, paleomagnetic and geochronologic study has been conducted on two Cretaceous andesitic basalt lava flows from Sanbaoying, Liaoning Province of northeastern China. Rock magnetic investigations show that pseudo-single domain (PSD) titanomagnetite with poor-Ti content is the dominant magnetic mineral in Sanbaoying lava flows. Detailed systematic thermal demagnetization allowed us to isolate two remanence components after removing a low temperature component at 100℃/150℃; an intermediate temperature component with normal polarity at 150℃/200℃-380℃/400℃ and the characteristic remanence component (ChRM) with reversed polarity above 400℃/450℃. 40Ar/39Ar dating results show that Sanbaoying rocks were erupted at 116.0±0.3 Ma. Combination of paleomagnetic results and 40Ar/39Ar dating indicates that the reversed event recorded in Sanbaoying lavas corresponds to the ISEA event in the CNS. Our age determination for ISEA reversed event provides chronological evidence to study the relevance between global geological events that occurred in the CNS and geodynamo processes.

  4. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Science.gov (United States)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  5. Ar-Ar geochronology of Late Mesozoic volcanic rocks from the Yanji area,NE China and tectonic implications

    Institute of Scientific and Technical Information of China (English)

    LI ChaoWen; GUO Feng; FAN WeiMing; GAO XiaoFeng

    2007-01-01

    Ar-Ar dating results of late Mesozoic-Cenozoic volcanic rocks from the Yanji area, NE China provide a new volcano-sedimentary stratigraphic framework. The previously defined "Triassic-Jurassic" volcanic rocks(including those from Sanxianling, Tuntianying, Tianqiaoling and Jingouling Fms.)were erupted during 118-106Ma,corresponding to Early Cretaceous. The new eruption age span is slightly younger than the main stage(130-120 Ma)of the extensive magmatism in the eastern Central Asian Orogenic Belt and its adjacent regions. Subduction-related adakites occurring in the previously defined Quanshuicun Fm. Were extruded at ca.55 Ma. Based on these new Ar-Ar ages, the late Mesozoic to Palaeocene volcano-sedimentary sequences is rebuilt as:Tuopangou Fm., Sanxianling/Tuntianying Fm.(118-115 Ma),Malugou/Tianqiaoling Fm.(K1),Huoshanyan/Jingouling Fm.(108-106 Ma),Changcai Fm.(K2),Quanshuicun Fm.(~55 Ma)and Dalazi Fm. Our results suggest that subduction of the Palaeo-Pacific Ocean beneath the East Asian continental margin occurred during 106to 55 Ma. Consistent with the paleomagnetic observations and magmatic records which indicated that the Izanagi-Farallon ridge subduction beneath the southwestern Japan took place during 95-65 Ma.

  6. Ar-Ar geochronology of Late Mesozoic volcanic rocks from the Yanji area, NE China and tectonic implications

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Ar-Ar dating results of late Mesozoic-Cenozoic volcanic rocks from the Yanji area, NE China provide a new volcano-sedimentary stratigraphic framework. The previously defined “Triassic-Jurassic” volcanic rocks (including those from Sanxianling, Tuntianying, Tianqiaoling and Jingouling Fms.) were erupted during 118―106 Ma, corresponding to Early Cretaceous. The new eruption age span is slightly younger than the main stage (130―120 Ma) of the extensive magmatism in the eastern Central Asian Orogenic Belt and its adjacent regions. Subduction-related adakites occurring in the previously defined Quanshuicun Fm. were extruded at ca. 55 Ma. Based on these new Ar-Ar ages, the late Mesozoic to Palaeocene volcano-sedimentary sequences is rebuilt as: Tuopangou Fm., Sanxianling/Tuntianying Fm. (118―115 Ma), Malugou/Tianqiaoling Fm. (K1), Huoshanyan/Jingouling Fm. (108―106 Ma), Changcai Fm. (K2), Quanshuicun Fm. (~55 Ma) and Dalazi Fm. Our results suggest that subduction of the Pa- laeo-Pacific Ocean beneath the East Asian continental margin occurred during 106 to 55 Ma, consistent with the paleomagnetic observations and magmatic records which indicated that the Izanagi-Farallon ridge subduction beneath the southwestern Japan took place during 95―65 Ma.

  7. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Energy Technology Data Exchange (ETDEWEB)

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  8. Infrared spectroscopy of ArOH: A direct probe of the Ar+OH X2Π potential energy surface

    International Nuclear Information System (INIS)

    An infrared-ultraviolet (IR-UV) double-resonance technique has been implemented to obtain the infrared spectrum of ArOH in the vicinity of the fundamental OH stretch at 2.8 μm. A rotationally resolved spectrum of the fundamental OH stretching band of ArOH is observed at 3567.85(1) cm-1 (origin). A combination band, involving both OH stretch and intermolecular bending excitation, is identified at 3577.00(1) cm-1 (origin). The intermolecular energy of the excited bending state provides a direct measure of the anisotropy of the Ar+OH X2Π interaction potential. The rotational structure of the combination band reveals a large splitting between parity components with the same total angular momentum in the excited bending state [0.69(1) cm-1 for J=(3/2)]. The experimentally derived parity splitting is compared with previous experimental and theoretical determinations of this parameter. The parity splitting associated with the excited bending state reflects the change in the intermolecular potential when the pπ orbital containing the unpaired electron of OH lies in or out of the ArOH plane. (c) 2000 American Institute of Physics

  9. Mineralogy and Ar-39 - Ar-40 of an old pristine basalt: Thermal history of the HED parent body

    Science.gov (United States)

    Takeda, Hiroshi; Mori, Hiroshi; Bogard, Donald D.

    1994-01-01

    Previous investigations of mineral chemistry and Rb-Sr and Sm-Nd ages indicated that clast,84 from eucrite Yamato 75011 had preserved the pristine nature of its initial crystallization during an early stage of the HED parent body. Microscale mineralogy and Ar-39-Ar-40 ages of this clast, however, revealed local disturbance of microtextures and partially reset ages. This evidence suggests that, in addition to initial crystallization and rapid cooling, the Y75011,84 clast experienced shock deformation, reheating of short duration at higher temperature, and brecciation. These characteristics suggest two or more impact events. Fe-rich olivine filling fractures in pyroxene may have been introduced during the accompanying shock fracturing. The inferred Ar-39-Ar-40 degassing ages for Y75011 matrix and clast, 84 are 3.94 +/- 0.04 Ga and 3.98 +/- 0.03 Ga, respectively. The suggested degassing age for a clast from Y790020, believed to be paired with Y75011, is approximately 4.03 Ga, but could be younger. We consider it likely that all three samples experienced a common degassing event 3.95 +/- 0.05 Ga ago, but we cannot rule out two or more events spaced over a approximately 0.1 Ga interval. Higher temperature extractions of the two clast samples show significantly older apparent ages up to approximately 4.5 Ga and suggest that the time/temperature regime of this event was not sufficient to degas Ar totally. Most likely, the K-Ar ages were reset by thermal metamorphism associated with one or more impact events associated with shock fracturing, formation of Fe-rich olivine veins, and/or meteorite brecciation. The pyroxene annealing that commonly occurs in many eucrites is likely to be a much earlier process than the impact-produced textural changes and reset K-Ar ages observed in these meteorites. The existence of mineralogical and chronological evidence for metamorphism in an otherwise pristine eucrite suggests that the HED parent body experienced an extensive degree of

  10. I-Xe and 40Ar-39Ar dating of silicate from Weekeroo Station and Netschaevo IIE iron meteorites

    International Nuclear Information System (INIS)

    Silicate inclusions from two IIE iron meteorites were dated by the I-Xe and 40Ar-39Ar techniques. Weekeroo Station, a 'normal' IIE iron, shows no loss of radiogenic 40Ar at low temperature, and the well defined 40Ar-39Ar plateau yields an age of 4.54 +- 0.03 Byr. The xenon data define a good I-Xe correlation with an age of + 10.9 +- 0.5 Myr relative to Bjurbole. Despite its relatively young age, Weekeroo Station's (129Xe/132Xe)sub(trapped) ratio (= 0.84 +- 0.05) lies significantly below the solar value. Netschaevo silicate has a chondritic composition, unlike 'normal' IIE silicate which is more differentiated. Nevertheless Netschaevo gives a 40Ar-39Ar plateau-age of only 3.79 +- 0.03 Byr, with the xenon data failing to define an I-Xe isochron. Only irons from the IAB and IIE groups contain silicate inclusions, but these two groups differ in many other respects, mostly suggesting that IAB meteorites are more primitive. The I-Xe chronology supports this suggestion inasmuch as Weekeroo Station formed well after IAB silicates. The four silicate-bearing IIE irons which have now been dated can be subdivided into distinct pairs: Weekeroo Station and Colomera formed near the beginning of the solar system, while Netschaevo and Kodaikanal both formed only 3.8 Byr ago. A review of other properties of these meteorites generally supports this subdivision. This work underscores the complexity of the history of IIE meteorites; in particular, an adequate model must account for the formation of two IIE irons at 3.8 Byr without disturbing rare gases in Weekeroo Station. All formation models are quite speculative, but the one which seems best to fit the available evidence postulates two parent bodies: the 3.8 Byr old silicate formed on one parent body, all other IIE material resided in a separate body, and subsequent collision(s) mixed the young silicate with IIE metal. (author)

  11. 40Ar/39Ar impact ages and time-temperature argon diffusion history of the Bunburra Rockhole anomalous basaltic achondrite

    Science.gov (United States)

    Jourdan, Fred; Benedix, Gretchen; Eroglu, Ela.; Bland, Phil. A.; Bouvier, Audrey.

    2014-09-01

    The Bunburra Rockhole meteorite is a brecciated anomalous basaltic achondrite containing coarse-, medium- and fine-grained lithologies. Petrographic observations constrain the limited shock pressure to between ca. 10 GPa and 20 GPa. In this study, we carried out nine 40Ar/39Ar step-heating experiments on distinct single-grain fragments extracted from the coarse and fine lithologies. We obtained six plateau ages and three mini-plateau ages. These ages fall into two internally concordant populations with mean ages of 3640 ± 21 Ma (n = 7; P = 0.53) and 3544 ± 26 Ma (n = 2; P = 0.54), respectively. Based on these results, additional 40Ar/39Ar data of fusion crust fragments, argon diffusion modelling, and petrographic observations, we conclude that the principal components of the Bunburra Rockhole basaltic achondrite are from a melt rock formed at ∼3.64 Ga by a medium to large impact event. The data imply that this impact generated high enough energy to completely melt the basaltic target rock and reset the Ar systematics, but only partially reset the Pb-Pb age. We also conclude that a complete 40Ar∗ resetting of pyroxene and plagioclase at this time could not have been achieved at solid-state conditions. Comparison with a terrestrial analog (Lonar crater) shows that the time-temperature conditions required to melt basaltic target rocks upon impact are relatively easy to achieve. Ar data also suggest that a second medium-size impact event occurred on a neighbouring part of the same target rock at ∼3.54 Ga. Concordant low-temperature step ages of the nine aliquots suggest that, at ∼3.42 Ga, a third smaller impact excavated parts of the ∼3.64 Ga and ∼3.54 Ga melt rocks and brought the fragments together. The lack of significant impact activity after 3.5 Ga, as recorded by the Bunburra Rockhole suggests that (1) either the meteorite was ejected in a small secondary parent body where it resided untouched by large impacts, or (2) it was covered by a porous heat

  12. Alkali-activated slag mortars reinforced with ar glassfibre. Performance and properties

    Directory of Open Access Journals (Sweden)

    Amat, T.

    2006-09-01

    Full Text Available In light of the practical problem posed by the high drying shrinkage rate exhibited by alkali-activated slag (AAS,due to these materials exhibited a high drying shrinkage the present study analyzes the behaviour of alkali-activated slag mortars reinforced with alkali-resistant (AR glass fiber especially designed to reduce drying shrink aging cementitious systems. To this end, both alkali-activated slag and reference Portland cement mortars were prepared, with and without AR fiber (in dosages ranging from 0 to 1.1% by weight of the binder. These mortars were subjected to the following tests: drying shrinkage,mechanical strength after 2, 7 and 28 days, toughness,and high temperature. The microstructure of the materials was also studied by SEM/EDX techniques. At a percentage of 0.22%, AR fiber was found to induce a significant reduction (over 20% in drying shrinkage, without detracting from the fine resistance strength, of alkali activated slag mortar. Moreover, plain activated slag mortars recovered 20% of their initial mechanical strength after exposure to high temperatures, and ins specimens reinforced with glass fiber at a rate of 0.22%,recovery climbed to 50%.El principal problema tecnológico de los cementos de escoria activada alcalinamente (AAS es su elevada retracción al secado. Por ello, en el presente trabajo se estudia el comportamiento de morteros de escoria activada alcalinamente reforzados con fibras de vidrio alcali-resistentes (AR, especialmente diseñadas para reducir la retracción al secado en sistema cementantes. Para ello se prepararon morteros de escoria activada alcalinamente y de cemento Portland como material de referencia. El porcentaje de fibra AR en los morteros varió entre 0-1,1% en peso de ligante. Los morteros preparados fueron sometidos a los siguientes ensayos:retracción al secado, resistencias mecánicas a 2, 7 y 28 días,ensayos de tenacidad, resistencia al impacto y comportamiento resistente frente a altas

  13. Polioencefalomalacia experimental em bovinos induzida por toxicose por enxofre

    Directory of Open Access Journals (Sweden)

    Paulo H.J. Cunha

    2011-01-01

    Full Text Available O presente trabalho teve como objetivos avaliar os sinais clínicos, as concentrações do sulfeto de hidrogênio ruminal e as alterações anatomopatológicas associadas à intoxicação experimental por enxofre em bovinos. Foram utilizados dez bezerros mestiços leiteiros, sendo que quatro bovinos ingeriram ração sem sulfato de sódio (G1 e seis consumiram ração com sulfato de sódio (G2. Exames clínicos (temperatura retal, frequência cardíaca e respiratória e motricidade ruminal e laboratoriais (hemograma, fibrinogênio, proteína plasmática, pH do fluido ruminal, concentração do sulfeto de hidrogênio ruminal, líquido cerebrospinal e histopatológico foram realizados. A temperatura retal, frequência cardíaca, hemograma, fibrinogênio, proteína plasmática, pH do fluido ruminal e os valores do líquido cerebrospinal estavam dentro dos valores de referência para a espécie. Taquipnéia, hipomotricidade ruminal e elevados valores de sulfeto de hidrogênio ruminal foram observados nos bezerros do grupo G2. Um bezerro do grupo G2 apresentou sinais neurológicos e lesões histopatológicas de PEM. Dois animais de cada grupo foram eutanasiados. Lesões microscópicas foram observadas nos bezerros do G2. Histologicamente as alterações observadas foram necrose neuronal cortical e lesões hemorrágicas nos núcleos basais, tálamo, mesencéfalo, ponte e bulbo. O protocolo experimental constituído por uma dieta rica em carboidrato de alta fermentação, baixa quantidade de fibra efetiva e altos níveis de enxofre (0,52% ocasionou alterações clinicas e histológicas e elevadas concentrações de sulfeto de hidrogênio ruminal compatíveis com quadro de intoxicação por enxofre.

  14. Crater Retention Ages from (4) Vesta Matching Independent Ar-Ar Ages of HED Meteorites

    Science.gov (United States)

    Schmedemann, Nico; Kneissl, Thomas; Ivanov, Boris A.; Michael, Gregory G.; Neukum, Gerhard; Nathues, Andreas; Sierks, Holger; Wagner, Roland; Krohn, Katrin; Le Corre, Lucille; Reddy, Vishnu; Ruesch, Ottaviano; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

    2013-04-01

    .054/-0.087) Ga and 3.63 (+0.058/-0.096) Ga. We also find seismic (miniscule ejecta blanket from Rheasilvia) resurfacing events in the time frame of ~3.56 to ~3.59 Ga at several areas in the northern hemisphere, indicative for a major seismic activity probably connected to the Rheasilvia formation. An antipodal activity is also suggested by hydrocode modeling [9]. By summation of age probability curves of measurements we link to the Rheasilvia formation, we find 3.58 (+0.07/-0.12) Ga. Using a similar attempt we find 3.75 (+0.05/-0.21) Ga for the Veneneia formation. Both crater retention ages correspond within the error bars with prominent peaks of independent Ar-Ar ages of Vesta related HED meteorites [10]. Acknowledgement: This work has been supported by the German Space Agency (DLR) on behalf of the Federal Ministry of Economics and Technology, grants 50OW1101(NS,TK), 50QM1001 (GM) and 50OW1102 (OR,HH). References: [1] Russell et al. (2007): Advances in Space Research 40(2): pp193-201, 2007. [2] Neukum and Ivanov: In: Gehrels T (ed) "Hazards due to comets and asteroids". University of Arizona Press, Tucson, 359-416, 1994. [3] O'Brien and Greenberg (2005): Icarus 178(1): 179-212. [4] Nesvorny et al. (2009): Icarus 200(2): 698-701. [5] Ivanov (2001): Chronology and Evolution of Mars 96, 87-104, 2001. [6] Schmedemann et al. (2012): 43.LPSC, The Woodlands, #1659. [7] Morbidelli et al. (2003): Icarus 162, 328-336. [8] Marchi et al. (2012): Science 336, 690. [9] Bowling et al. (2012): 75th Annual Meeting of the Meteoritical Society, 2012, Cairns, Australia. Meteoritics and Planetary Science Supplement, id.5256. [10] Bogard, D. D. (2011): Chemie der Erde - Geochemistry, vol. 71, issue 3: 207-226.

  15. Homenaje de los Institutos de Derecho Constitucional y Derechos Humanos a Justino Jiménez de Aréchaga en el centenario de su nacimiento

    Directory of Open Access Journals (Sweden)

    Alberto Pérez Pérez

    2014-02-01

    Full Text Available Nació hace cien años, pero su pensamiento sigue plenamente vigente.Su gran obra – verdadero tratado de Derecho Constitucional Uruguayo aunque él no le haya dado ese nombre –terminó de publicarse hace casi seis décadas, pero sigue siendo imprescindible obra de consulta para todos los juristas de nuestro país.Falleció en 1980, pero aún hoy – y sin duda por mucho tiempo más – no hay estudio serio de su especialidad que no comience por indagar lo que él pensaba al respecto.Ése es Justino Jiménez de Aréchaga, la grande, inmensa personalidad uruguaya de cuyo nacimiento se cumplen hoy cien años.Los Institutos de Derecho Constitucional y Derechos Humanos, que me honro en dirigir, le rinden hoy un merecidísimo homenaje, que podemos sintetizar en cuatro afirmaciones:I.Justino Jiménez de Aréchaga hizo una obra maestraII.Fue un Maestro del Derecho y de la vida en democraciaIII.Como verdadero Maestro, también nos enseñó/incitó a tratar de continuar su obraIV.El homenaje que le debemos al Maestro Aréchaga consiste, precisamente, no en palabras sino en obras que lo honren.

  16. 40Ar/39Ar geochronology, paleomagnetism, and evolution of the Boring volcanic field, Oregon and Washington, USA

    Science.gov (United States)

    Fleck, Robert J.; Hagstrum, Jonathan T.; Calvert, Andrew T.; Evarts, Russell C.; Conrey, Richard M.

    2014-01-01

    The 40Ar/39Ar investigations of a large suite of fine-grained basaltic rocks of the Boring volcanic field (BVF), Oregon and Washington (USA), yielded two primary results. (1) Using age control from paleomagnetic polarity, stratigraphy, and available plateau ages, 40Ar/39Ar recoil model ages are defined that provide reliable age results in the absence of an age plateau, even in cases of significant Ar redistribution. (2) Grouping of eruptive ages either by period of activity or by composition defines a broadly northward progression of BVF volcanism during latest Pliocene and Pleistocene time that reflects rates consistent with regional plate movements. Based on the frequency distribution of measured ages, periods of greatest volcanic activity within the BVF occurred 2.7–2.2 Ma, 1.7–0.5 Ma, and 350–50 ka. Grouped by eruptive episode, geographic distributions of samples define a series of northeast-southwest–trending strips whose centers migrate from south-southeast to north-northwest at an average rate of 9.3 ± 1.6 mm/yr. Volcanic activity in the western part of the BVF migrated more rapidly than that to the east, causing trends of eruptive episodes to progress in an irregular, clockwise sense. The K2O and CaO values of dated samples exhibit well-defined temporal trends, decreasing and increasing, respectively, with age of eruption. Divided into two groups by K2O, the centers of these two distributions define a northward migration rate similar to that determined from eruptive age groups. This age and compositional migration rate of Boring volcanism is similar to the clockwise rotation rate of the Oregon Coast Range with respect to North America, and might reflect localized extension on the trailing edge of that rotating crustal block.

  17. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  18. toxicidad neuroendocrina inducida por cadmio

    Directory of Open Access Journals (Sweden)

    A Romero

    2008-01-01

    Full Text Available El cadmio es un agente químico tóxico importante debido a su creciente nivel en el medio ambiente como resultado de prácticas industriales y agrícolas. Como perturbador endocrino, el cadmio modifica la secreción de hormonas hipofisarias. Los efectos indirectos del cadmio provocan la generación de especies reactivas de oxígeno y reducen la actividad de las proteínas implicadas en las defensas antioxidantes. La melatonina es conocida como un potente antioxidante, scavenger de radicales libres y quelante de metales sintetizada en la glándula pineal. De esta manera, las acciones antioxidantes de esta indolamina protegen frente a la peroxidación lipídica y el daño oxidativo de los radicales y de sus productos tóxicos. Los trabajos recopilados en esta revisión ponen de manifiesto la capacidad antioxidante de la melatonina y, por lo tanto, su posible papel protector frente a la toxicidad del cadmio en lo que se refiere al estrés oxidativo y peroxidación lipídica inducidos por la exposición a este metal.

  19. Hipoglucemia inducida por carcinoma adrenal

    Directory of Open Access Journals (Sweden)

    Jimena Soutelo

    2013-08-01

    Full Text Available El carcinoma suprarrenal es una neoplasia maligna infrecuente y de mal pronóstico. La presentación clínica más común es originada por la producción hormonal excesiva, mientras que el desarrollo de hipoglucemia sintomática es excepcional. Presentamos el caso de una mujer de 37 años que ingresó al hospital por síntomas de hipoglucemias graves, hipertensión arterial, hipopotasemia y amenorrea secundaria. En el laboratorio se halló hipoglucemia con insulina inhibida y niveles de andrógenos en rango tumoral. La tomografía computarizada (TC de abdomen y pelvis mostró voluminosa formación heterogénea de aspecto sólido sin plano de clivaje con respecto al parénquima hepático e intenso realce con contraste. Luego de la extirpación de la masa retroperitoneal, evolucionó con valores de glucemia y potasemia normales, estabilizó la presión arterial y recuperó los ciclos menstruales.

  20. Evaluación de dos técnicas analíticas para la especiación de arsénico en aguas superficiales del sur del Perú

    Directory of Open Access Journals (Sweden)

    Manuel Chávez

    2009-01-01

    Full Text Available El arsénico es altamente tóxico, la exposición crónica a este elemento causa diversos daños en la salud de las personas, en el Perú se han reportado niveles elevados, sobre todo en ríos de la costa sur. Objetivo. Evaluar dos técnicas analíticas de especiación de las dos formas de arsénico inorgánico en agua fluvial de Tacna, en el sur del Perú. Materiales y métodos. Se desarrolló un estudio comparativo entre la técnica de separación por resina de intercambio aniónico y la cromatografía iónica para la especiación del arsénico (V y arsénico (III en muestras de agua de cuatro ríos de la vertiente del Pacífico en dos distritos de la región Tacna. La cantidad de arsénico total se determinó con el sistema de inyección de flujo asistido con absorción atómica. Resultados. Se obtuvo un buen grado de separación en ambos procedimientos, sin embargo, la técnica de resinas de intercambio aniónico tiene un límite de detección inferior que la cromatografía iónica, 2,0 μg/L y 32 μg/L, respectivamente. En cuatro de las seis muestras se obtuvieron valores superiores a los recomendados por la Agencia de Protección Ambiental de los Estados Unidos, y en ellas se logró determinar las cantidades de arsénico (III y arsénico (V. Conclusiones. La técnica de separación por resina de intercambio aniónico tiene mayor sensibilidad de detección de arsénico que la cromatografía iónica y permite un alto grado de especiación del arsénico inórganico en muestras de agua fluvial.

  1. Development of a Low-Level Ar-37 Calibration Standard

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Richard M.; Aalseth, Craig E.; Bowyer, Ted W.; Day, Anthony R.; Fuller, Erin S.; Haas, Derek A.; Hayes, James C.; Hoppe, Eric W.; Humble, Paul H.; Keillor, Martin E.; LaFerriere, Brian D.; Mace, Emily K.; McIntyre, Justin I.; Miley, Harry S.; Myers, Allan W.; Orrell, John L.; Overman, Cory T.; Panisko, Mark E.; Seifert, Allen

    2016-03-07

    Argon-37 is an important environmental signature of an underground nuclear explosion. Producing and quantifying low-level 37Ar standards is an important step in the development of sensitive field measurement instruments for use during an On-Site Inspection, a key provision of the Comprehensive Nuclear-Test-Ban Treaty. This paper describes progress at Pacific Northwest National Laboratory (PNNL) in the development of a process to generate and quantify low-level 37Ar standard material, which can then be used to calibrate sensitive field systems at activities consistent with soil background levels. The 37Ar used for our work was generated using a laboratory-scale, high-energy neutron source to irradiate powdered samples of calcium carbonate. Small aliquots of 37Ar were then extracted from the head space of the irradiated samples. The specific activity of the head space samples, mixed with P10 (90% stable argon:10% methane by mole fraction) count gas, is then derived using the accepted Length-Compensated Internal-Source Proportional Counting method. Due to the low activity of the samples, a set of three Ultra-Low Background Proportional-Counters designed and fabricated at PNNL from radio-pure electroformed copper was used to make the measurements in PNNL’s shallow underground counting laboratory. Very low background levels (<10 counts/day) have been observed in the spectral region near the 37Ar emission feature at 2.8 keV. Two separate samples from the same irradiation were measured. The first sample was counted for 12 days beginning 28 days after irradiation, the second sample was counted for 24 days beginning 70 days after irradiation (the half-life of 37Ar is 35.0 days). Both sets of measurements were analyzed and yielded very similar results for the starting activity (~0.1 Bq) and activity concentration (0.15 mBq/ccSTP argon) after P10 count gas was added. A detailed uncertainty model was developed based on the ISO Guide to the Expression of Uncertainty in

  2. Impacto do aquecimento global no cultivo do feijão-caupi, no Estado da Paraíba Impact of global warming on the cowpea cultivation in the State of Paraíba

    Directory of Open Access Journals (Sweden)

    João H. B. da C. Campos

    2010-04-01

    Full Text Available No presente estudo se avaliam os impactos da mudança do clima com base nos relatórios do Painel Intergovernamental em Mudanças do Clima (IPCC, no zoneamento agrícola de riscos climáticos para a cultura do feijão-caupi (Vigna unguiculata L. Walp cultivado em sistema de sequeiro, no Estado da Paraíba. Utilizou-se o modelo do balanço hídrico associado a técnicas de geoprocessamento, e se objetivou a identificação das regiões do Estado em que a cultura do feijão-caupi sofrerá restrições em face das mudanças climáticas. As variáveis consideradas no modelo foram precipitação pluvial, coeficientes de cultura, evapotranspiração potencial e duração das fases fenológicas da cultura. Adotou-se, como limite para o índice de satisfação da necessidade de água para a cultura (ISNA, o valor de 0,50. A data foi considerada adequada para a semeadura quando a simulação do balanço hídrico apresentou resultados de ISNA com frequência mínima de 80%, superior ao valor do critério adotado. Tendo em vista um aumento de temperatura do ar de 3 e 6 oC, como sugerido pelo IPCC, o cultivo do feijão-caupi sofrerá uma redução significativa nas áreas atualmente favoráveis ao seu cultivo no Estado da Paraíba.This study evaluates the impacts of climate change, based on the reports of the IPCC, on the agricultural zoning of climatic risk of the rainfed cowpea (Vigna unguiculata L. Walp crop grown in the Paraíba state. The water balance model combined with GIS techniques was used for identifying areas in the state where the cowpea crop will suffer yield restrictions due to climate changes. Model input variables were: rainfall, crop coefficients, potential evapotranspiration and duration of the crop cycle. The limit value of 0.5 was adopted for the water requirement satisfaction index (WRSI. The date acceptable for seeding was that when the water balance simulation presented, for at least 80% minimum frequency, WRSI value greater than

  3. Qualidade de maçãs 'Royal gala' submetidas ao dano mecânico por impacto e aplicação de 1-metilciclopropeno em dois sistemas comerciais de armazenamento

    OpenAIRE

    Marcos Vinicius Hendges; Cristiano André Steffens; Lucimara Rogéria Antoniolli; Cassandro Vidal Talamini do Amarante; Auri Brackmann

    2011-01-01

    O objetivo deste trabalho foi avaliar os efeitos do dano mecânico por impacto e da aplicação de 1-metilciclopropeno (1-MCP) sobre a qualidade de maçãs 'Royal Gala' mantidas em armazenamento refrigerado (AR) e em atmosfera controlada (AC). Os tratamentos avaliados foram dano mecânico (sem e com dano por impacto) combinado com a aplicação de 1-MCP (0 e 625 nL L-1). Os frutos foram armazenados durante quatro meses em armazenamento refrigerado (AR; 0 ºC ± 1 ºC e 92 ± 2 % de UR) (experimento 1) e ...

  4. Mortalidad intrahospitalaria por accidente cerebrovascular

    Directory of Open Access Journals (Sweden)

    Federico Rodríguez Lucci

    2013-08-01

    Full Text Available La mortalidad global por accidente cerebrovascular (ACV ha disminuido en las últimas tres décadas, probablemente debido a un mejor control de los factores de riesgo vascular. La mortalidad hospitalaria por ACV ha sido tradicionalmente estimada entre 6 y 14% en la mayoría de las series comunicadas. Sin embargo, los datos de ensayos clínicos recientes sugieren que esta cifra sería sustancialmente menor. Se revisaron datos de pacientes internados con diagnóstico de ACV del Banco de Datos de Stroke de FLENI y los registros institucionales de mortalidad entre los años 2000 y 2010. Los subtipos de ACV isquémicos se clasificaron según criterios TOAST y los ACV hemorrágicos en hematomas intrapanquimatosos, hemorragias subaracnoideas aneurismáticas, malformaciones arteriovenosas y otros hematomas intraparenquimatosos. Se analizaron 1514 pacientes, 1079 (71% con ACV isquémico (grandes vasos 39%, cardioembólicos 27%, lacunares 9%, etiología indeterminada 14%, otras etiologías 11% y 435 (29% con ACV hemorrágico (intraparenquimatosos 27%, hemorragia subaracnoidea 30%, malformaciones arteriovenosas 25% y otros hematomas espontáneos 18%. Se registraron 38 muertes intrahospitalarias (17 ACV isquémicos y 21 ACV hemorrágicos, representando una mortalidad global del 2.5% (1.7% en ACV isquémicos y 4.8% en ACV hemorrágicos. No se registraron muertes asociadas al uso de fibrinolíticos endovenosos. La mortalidad intrahospitalaria en pacientes con ACV isquémico y hemorrágico en nuestro centro fue baja. El manejo en un centro dedicado a las enfermedades neurológicas y el enfoque multidisciplinario por personal médico y no médico entrenado en el cuidado de la enfermedad cerebrovascular podrían explicar, al menos en parte, estos resultados.

  5. Un modelo de diálogo para diálogos orientados por la tarea

    OpenAIRE

    Zubizarreta Aizpuru, José Ramón

    1993-01-01

    En los sistemas de diálogo en lenguaje natural además de existir la necesidad de diseñar herramientas para la representación del conocimiento del dominio, existe también la obligación, de crear mecanismos que puedan contextualizar el enunciado generado por el locutor tratándolo en un nivel discursivo donde tanto las realizaciones precedentes como las expectativas generadas son tenidas en cuenta. Esta comunicación trata de proponer un mecanismo contextualizador de las intervenciones producidas...

  6. Gestión de recursos humanos por competencias en los proyectos de software

    OpenAIRE

    Jorge Soler; Margarita André; María G. Baldoquín

    2011-01-01

    Este trabajo tiene como objetivo contribuir a la implementación, en la industria de software, de la gestión de recursos humanos basado en el enfoque por competencias. Para ello, se realiza y fundamenta una propuesta de roles invariantes que participan tanto en proyectos de desarrollo como de implantación de software, y de competencias tanto técnicas como genéricas requeridas para desempeñar los roles propuestos. En el trabajo se fundamenta el uso del método Delphi y las variaciones requeridas...

  7. Ryoji Ikeda, Data Artist - Prix Ars Electronica Collide@CERN

    CERN Document Server

    CERN. Geneva; Koek, Ariane; Heuer, Rolf; Ikeda, Ryoji; Mr. Horst, Hoertner

    2014-01-01

    at the CERN Globe of Science and Innovation, CERN. You are very warmly invited to the opening presentation of Data Artist, Ryoji Ikeda’s residency at CERN. Ryoji Ikeda, one of the world’s leading electronic composers and visual artists, is the new Prix Ars Electronica Collide@CERN award winner. Ryoji Ikeda and his science inspiration partner, Theoretical Physicist, Dr. Tom Melia will talk about their work in arts and science. They are at the beginning of their creative journey together at CERN. A little about Ryoji Ikeda – the new Prix Ars Electronica Collide@CERN artist in residence. Ryoji Ikeda focuses on the essential characteristics of sound itself and that of visuals as light by means of both mathematical precision and mathematical aesthetics. Ikeda has gained a reputation as one of the few international artists working convincingly across both visual ...

  8. Medidas da umidade relativa do ar em um ambiente fechado

    Directory of Open Access Journals (Sweden)

    Costa Eden V.

    2003-01-01

    Full Text Available Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de preencher a lacuna dos livros de texto de física, que, em geral, negligenciam este tópico.

  9. Simulation of Carbon Nanotube Welding through Ar bombardment

    CERN Document Server

    Kucukkal, Mustafa U

    2014-01-01

    Single-walled carbon nanotubes show promise as nanoscale transistors, for nanocomputing applications. This use will require appropriate methods for creating electrical connections between distinct nanotubes, analogous to welding of metallic wires at larger length scales, but methods for performing nanoscale chemical welding are not yet sufficiently understood. This study examined the effect of Ar bombardment on the junction of two crossed single-walled carbon nanotubes, to understand the value and limitations of this method for generating connections between nanotubes. A geometric criterion was used to assess the quality of the junctions formed, with the goal of identifying the most productive conditions for experimental ion bombardment. In particular, the effects of nanotube chirality, Ar impact kinetic energy, impact particle flux and fluence, and annealing temperature were considered. The most productive bombardment conditions, leading to the most crosslinking of the tubes with the smallest loss of graphit...

  10. Constraining the alteration history of a Late Cretaceous Patagonian volcaniclastic bentonite-ash-mudstone sequence using K-Ar and 40Ar/39Ar isotopes

    Science.gov (United States)

    Warr, L. N.; Hofmann, H.; van der Pluijm, B. A.

    2016-03-01

    Smectite is typically considered unsuitable for radiometric dating, as argon (40Ar) produced from decay of exchangeable potassium (40K) located in the interlayer sites can be lost during fluid-rock interaction and/or during wet sample preparation in the laboratory. However, age analysis of Late Cretaceous Argentinian bentonites and associated volcaniclastic rocks from Lago Pellegrini, Northern Patagonia, indicates that, in the case of these very low-permeability rocks, the radioactive 40Ar was retained and thus can provide information on smectite age and the timing of rock alteration. This study presents isotopic results that indicate the ash-to-bentonite conversion and alteration of the overlying tuffaceous mudstones in Northern Patagonia was complete ~13-17 my after middle Campanian sedimentation when the system isotopically closed. The general absence of illite in these smectite-rich lithologies reflects the low activity of K and the low temperature (<60 °C) of the formation waters that altered the parent ash.

  11. arXiv in the classical Russian literature

    CERN Document Server

    Silagadze, Z K

    2012-01-01

    The creation of arXiv, a highly democratic open access repository of research papers in high-energy physics more than twenty years ago was undoubtedly the most spectacular and landmark event for the high-energy physics community. However, we report a curious observation which indicates that the general cultural significance of this event extends far beyond the boundaries assumed at the beginning.

  12. BUSINESS ETHICS: THE CASE OF AR CONSULTORIA LTD A

    Directory of Open Access Journals (Sweden)

    Fernando Fantoni Bencke

    2014-03-01

    business: the significant taxes, lack of incentives and credit available and the opportunity to “make a little extra” through informal sales. AR Consultoria’s entry to the market was marked by these and other difficulties. This case aims at presenting a real situation that can be found in some organizational sectors areas, which demands readers to take a decision and an ethical stance when faced with moral challenges.

  13. AR-based Method for ECG Classification and Patient Recognition

    OpenAIRE

    Branislav Vuksanovic; Mustafa Alhamdi

    2013-01-01

    The electrocardiogram (ECG) is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR) signal parameters used to characterise ECG signal. Extracted paramet...

  14. AR-based Method for ECG Classification and Patient Recognition

    Directory of Open Access Journals (Sweden)

    Branislav Vuksanovic

    2013-09-01

    Full Text Available The electrocardiogram (ECG is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR signal parameters used to characterise ECG signal. Extracted parameters are in this work used to accomplish two tasks. Firstly, AR features belonging to each ECG signal are classified in groups corresponding to three different heart conditions – normal, arrhythmia and ventricular arrhythmia. Obtained classification results indicate accurate, zero-error classification of patients according to their heart condition using the proposed method. Sets of extracted AR coefficients are then extended by adding an additional parameter – power of AR modelling error and a suitability of developed technique for individual patient identification is investigated. Individual feature sets for each group of detected QRS sections are classified in p clusters where p represents the number of patients in each group. Developed system has been tested using ECG signals available in MIT/BIH and Politecnico of Milano VCG/ECG database. Achieved recognition rates indicate that patient identification using ECG signals could be considered as a possible approach in some applications using the system developed in this work. Pre-processing stages, applied parameter extraction techniques and some intermediate and final classification results are described and presented in this paper.

  15. Transfer ionization of the isocharge sequence ion and Ar collisions

    Institute of Scientific and Technical Information of China (English)

    Cai Xiao-Hong; Yu De-Yang; Cao Zhu-Rong; Lu Rong-Chun; Yang Wei; Shao Cao-Jie; Chen Xi-Meng

    2004-01-01

    The ratios of transfer ionization to single capture for isocharge Cq+, Nq+, Oq+, Neq+ ions on Ar atoms are measured by using position-sensitive and time-of-flight techniques. It is found that the ratio R1 increases with nuclear charge Z in a q=4 sequence, and the ratio R1 sequences have the minimum values at Z=7 and Z=8 in q=5 and q=6 sequences, respectively, and the ratio R1 decreases with the increase in the nuclear charge Z in a q=7 sequence. The results may be explained within the frame of the statistical model. It may be concluded that the transfer ionization depends remarkably upon the electronic structure of the projectile. The projectiles used in this study have the same charge state and velocity, but different electronic structures. The dependence of the ratio R1 on q is studied for Neq+-Ar collisions. The ratio R1 is found to increase as q increases for Neq+-Ar collisions. The measured dependence of the ratio R1 on q is compared with the calculation using the molecular Coulomb over-barrier model.

  16. Electrical properties and dielectric spectroscopy of Ar+ implanted polycarbonate

    Science.gov (United States)

    Chawla, Mahak; Shekhawat, Nidhi; Aggarwal, Sanjeev; Sharma, Annu; Nair, K. G. M.

    2015-05-01

    The aim of the present paper is to study the effect of argon ion implantation on electrical and dielectric properties of polycarbonate. Specimens were implanted with 130 keV Ar+ ions in the fluence ranging from 1×1014 to 1×1016 ions cm-2. The beam current used was ˜0.40 µA cm-2. The electrical conduction behaviour of virgin and Ar+ implanted polycarbonate specimens have been studied through current-voltage (I-V characteristic) measurements. It has been observed that after implantation conductivity increases with increasing ion fluence. The dielectric spectroscopy of these specimens has been done in the frequency range of 100 kHz-100 MHz. Relaxation processes were studied by Cole-Cole plot of complex permittivity (real part of complex permittivity, ɛ' vs. imaginary part of complex permittivity, ɛ″). The Cole-Cole plots have also been used to determine static dielectric constant (ɛs), optical dielectric constant (ɛ∞), spreading factor (α), average relaxation time (τ0) and molecular relaxation time (τ). The dielectric behaviour has been found to be significantly affected due to Ar+ implantation. The possible correlation between this behaviour and the changes induced by the implantation has been discussed.

  17. Atomic data and spectral line intensities for Ar XIII

    International Nuclear Information System (INIS)

    The energy levels, oscillator strengths, spontaneous radiative decay rates, and electron impact collision strengths are calculated for Ar XIII using the recently developed Flexible Atomic Code (FAC). These data pertain to the 224 levels belonging to the following configurations: 2s22p2, 2s2p3, 2p4, 2s22p3l, 2s2p23l, 2s22p4l (l = s, p, d, f), 2s22p5s, 2s22p5p, and 2s22p5d. Effective collision strengths are obtained at five electron temperatures: log Te (K) = 5.0, 5.5, 6.0, 6.5, and 7.0 by integrating the collision strengths over a Maxwellian electron distribution. These atomic data are generated to support the interpretation of astrophysical objects as well as fusion plasmas, which frequently contain emission lines from Ar XIII. This work supplements previous work published by Bhatia by extending the calculation of effective collision strengths and radiative decay rates to n = 5 configurations. Level populations and spectral line intensities are obtained by solving the rate equations of the 224 energy levels at densities of 108, 109, 1010, 1011, and 1012 cm-3 and a temperature of 2.51 x 106 K. This temperature is typical for Ar XIII when formed at equilibrium by collisional ionization and recombination

  18. Drosophila ARSs contain the yeast ARS consensus sequence and a replication enhancer.

    OpenAIRE

    Mills, J S; Kingsman, A J; Kingsman, S M

    1986-01-01

    A number of restriction fragments that function as autonomously replicating sequences (ARSs) in yeast have been isolated from Drosophila melanogaster DNA. The behaviour in yeast of plasmids containing Drosophila ARS elements was studied and compared to that exhibited by the archetypal yeast ARS-1 plasmid. ARS functions were localised by subcloning and BAL-31 deletion analysis. These studies demonstrated the structural and functional complexity of Drosophila ARSs. Each Drosophila ARS element h...

  19. A comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas for dry etching applications

    International Nuclear Information System (INIS)

    The effect of the O2/Ar mixing ratio in CF4/O2/Ar and C4F8/O2/Ar inductively coupled plasmas with a 50% fluorocarbon gas content on plasma parameters and active species densities, which influence dry etching mechanisms, was analyzed. The investigation combined plasma diagnostics using Langmuir probes and zero-dimensional plasma modeling. It was found that, in both gas systems, the substitution of Ar for O2 results in a similar change in the ion energy flux but causes the opposite behavior for the F atom flux. The mechanisms of these phenomena are discussed with regards to plasma chemistry. - Highlights: • The goal was to conduct a comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas. • The focus was on the parameters directly influencing dry etching mechanisms. • Model-based analysis for neutral species was used in this paper

  20. Chromosomal context and replication properties of ARS plasmids in Schizosaccharomyces pombe

    Indian Academy of Sciences (India)

    Aditya S Pratihar; Vishnu P Tripathi; Mukesh P Yadav; Dharani D Dubey

    2015-12-01

    Short, specific DNA sequences called as Autonomously Replicating Sequence (ARS) elements function as plasmid as well as chromosomal replication origins in yeasts. As compared to ARSs, different chromosomal origins vary greatly in their efficiency and timing of replication probably due to their wider chromosomal context. The two Schizosaccharomyces pombe ARS elements, ars727 and ars2OO4, represent two extremities in their chromosomal origin activity - ars727 is inactive and late replicating, while ars2OO4 is a highly active, early-firing origin. To determine the effect of chromosomal context on the activity of these ARS elements, we have cloned them with their extended chromosomal context as well as in the context of each other in both orientations and analysed their replication efficiency by ARS and plasmid stability assays. We found that these ARS elements retain their origin activity in their extended/altered context. However, deletion of a 133-bp region of the previously reported ars727-associated late replication enforcing element (LRE) caused advancement in replication timing of the resulting plasmid. These results confirm the role of LRE in directing plasmid replication timing and suggest that the plasmid origin efficiency of ars2OO4 or ars727 remains unaltered by the extended chromosomal context.

  1. Bartlett correction in the stable AR(1) model with intercept and trend

    NARCIS (Netherlands)

    N.P.A. van Giersbergen

    2009-01-01

    Bartlett corrections are derived for testing hypotheses about the autoregressive parameter ρ in the stable (a) AR(1) model, (b) AR(1) model with intercept, (c) AR(1) model with intercept and linear trend. The correction is found explicitly as a function of ρ. In the models with deterministic terms,

  2. File list: Oth.ALL.20.AR.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.AR.AllCell hg19 TFs and others AR All cell types SRX595676,SRX595671,SRX...736053,SRX502068,SRX092448,SRX092447,SRX861678,SRX147604,SRX1033268 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.ALL.20.AR.AllCell.bed ...

  3. File list: Oth.Brs.05.AR.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Brs.05.AR.AllCell hg19 TFs and others AR Breast SRX1339020,SRX1339018,SRX250092...,SRX1339019,SRX1339016,SRX1339017,SRX1339015 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Brs.05.AR.AllCell.bed ...

  4. Repression of Runx2 by Androgen Receptor (AR) in Osteoblasts and Prostate Cancer Cells: AR Binds Runx2 and Abrogates Its Recruitment to DNA

    OpenAIRE

    Baniwal, Sanjeev K.; Khalid, Omar; Sir, Donna; Buchanan, Grant; Coetzee, Gerhard A.; Frenkel, Baruch

    2009-01-01

    Runx2 and androgen receptor (AR) are master transcription factors with pivotal roles in bone metabolism and prostate cancer (PCa). We dissected AR-mediated repression of Runx2 in dihydrotestosterone (DHT)-treated osteoblastic and PCa cells using reporter assays and endogenous Runx2 target genes. Repression required DHT, but not AR’s transactivation function, and was associated with nuclear colocalization of the two proteins. Runx2 and AR coimmunoprecipitated and interacted directly in glutath...

  5. Timing of gold mineralisation in the Ballarat goldfields, central Victoria: constraints from 40Ar/39Ar results

    International Nuclear Information System (INIS)

    40Ar/39Ar data for muscovite separates and hydrothermally altered whole-rock samples from the Ballarat West and the Ballarat East goldfields indicate that mesothermal gold mineralisation at Ballarat occurred during several episodic pulses, ranging in age from the Late Ordovician to the Early Devonian, initial formation of auriferous structures in the Ballarat goldfields coincided with folding and thrusting associated with the development of the western Lachlan Fold Belt between 460 and 440 Ma. Subsequent fault reactivation and magmatism resulted in remobilisation and additional mineralisation between 410 and 380 Ma, and around 370 Ma. The results presented herein are in agreement with findings for other major gold deposits in central Victoria and further constrain the history of deformation, metamorphism and mineralisation in the western subprovince of the Lachlan Fold Belt. Copyright (1999) Geological Society of Australia

  6. Emplacement of Amba Dongar Carbonatite-alkaline Complex at Cretaceous/Tertiary Boundary: Evidence from 40Ar-39Ar Chronology

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande; T R Venkatesan

    2000-03-01

    40Ar-39Ar analyses of three fresh alkaline rock samples and a phlogopite separate from a carbonatite from Amba Dongar carbonatite-alkaline complex of the Deccan Flood Basalt Province, India, yield indistinguishable precise plateau ages of 64.8 ± 0.6, 64.7 ± 0.5, 65.5 ± 0.8 and 65.3 ± 0.6 Ma, giving a mean plateau age of 65.0 ± 0.3 Ma, which is the age of emplacement of this complex. This age implies contemporaneity of Amba Dongar with several other carbonatite-alkaline activities of Chhota Udaipur subprovince and is consistent with their Reunion-Deccan plume origin hypothesis. The emplacement of these complexes at 65 Ma makes them very significant in the ongoing debate on the K/T extinctions owing to their capacity to rapidly inject a substantial amount of CO2 and SO2 into the atmosphere.

  7. 40Ar/39Ar Dating of Zn-Pb-Ag Mineralization in the Northern Brooks Range, Alaska

    Science.gov (United States)

    Werdon, Melanie B.; Layer, Paul W.; Newberry, Rainer J.

    2004-01-01

    The 40Ar/39Ar laser step-heating method potentially can be used to provide absolute ages for a number of formerly undatable, low-temperature ore deposits. This study demonstrates the use of this method by determining absolute ages for Zn-Pb-Ag sediment-hosted massive sulfide deposits and vein-breccia occurrences found throughout a 300-km-long, east-west-trending belt in the northern Brooks Range, Alaska. Massive sulfide deposits are hosted by Mississippian to Pennsylvanian(?) black carbonaceous shale, siliceous mudstone, and lesser chert and carbonate turbidites of the Kuna Formation (e.g., Red Dog, Anarraaq, Lik (Su), and Drenchwater). The vein-breccia occurrences (e.g., Husky, Story Creek, West Kivliktort Mountain, Vidlee, and Kady) are hosted by a deformed but only weakly metamorphosed package of Upper Devonian to Lower Mississippian mixed continental and marine clastic rocks (the Endicott Group) that stratigraphically underlie the Kuna Formation. The vein-breccias are mineralogically similar to, but not spatially associated with, known massive sulfide deposits. The region's largest shale-hosted massive sulfide deposit is Red Dog; it has reserves of 148 Mt grading 16.6 percent zinc, 4.5 percent lead, and 77 g of silver per tonne. Hydrothermally produced white mica in a whole-rock sample from a sulfide-bearing igneous sill within the Red Dog deposit yielded a plateau age of 314.5 Ma. The plateau age of this whole-rock sample records the time at which temperatures cooled below the argon closure temperature of the white mica and is interpreted to represent the minimum age limit for massive sulfide-related hydrothermal activity in the Red Dog deposit. Sulfide-bearing quartz veins at Drenchwater crosscut a hypabyssal intrusion with a maximum biotite age of 337.0 Ma. Despite relatively low sulfide deposition temperatures in the vein-breccia occurrences (162°-251°C), detrital white mica in sandstone immediately adjacent to large vein-breccia zones was partially to

  8. Charge-exchange, ionization and excitation in low-energy Li$^{+}-$ Ar, K$^{+}-$ Ar, and Na$^{+}-$He collisions

    CERN Document Server

    Lomsadze, Ramaz A; Kezerashvili, RomanYa; Schulz, Michael

    2016-01-01

    Absolute cross sections are measured for charge-exchange, ionization, and excitation within the same experimental setup for the Li$^{+}-$Ar, K$^{+}-$ Ar, and Na$^{+}-$ He collisions in the ion energy range $0.5-10$ keV. Results of our measurements along with existing experimental data and the schematic correlation diagrams are used to analyze and determine the mechanisms for these processes. The experimental results show that the charge-exchange processes are realized with high probabilities and electrons are predominately captured in ground states. The cross section ratio for charge exchange, ionization and excitation processes roughly attains the value $10:2:1$, respectively. The contributions of various partial inelastic channels to the total ionization cross sections are estimated and a primary mechanism for the process is defined. The energy-loss spectrum, in addition, is applied to estimate the relative contribution of different inelastic channels and to determine the mechanisms for the ionization and f...

  9. Empirical Likelihood Inference for AR(p) Model%AR(p)模型的经验似然推断

    Institute of Scientific and Technical Information of China (English)

    陈燕红; 赵世舜; 宋立新

    2008-01-01

    In this article we study the empirical likelihood inference for AR(p) model.We propose the moment restrictions, by which we get the empirical likelihood estimator of the model parametric, and we also propose an empirical log-likelihood ratio base on this estimator.Our result shows that the EL estimator is asymptotically normal, and the empirical log-likelihood ratio is proved to be asymptotically standard chi-squared.

  10. Geochemical and 40Ar/39Ar constraints on the evolution of volcanism in the Woodlark Rift, Papua New Guinea

    Science.gov (United States)

    Catalano, Joseph P.

    The tectonic mechanisms producing Pliocene to active volcanism in eastern Papua New Guinea (PNG) have been debated for decades. In order to assess mechanisms that produce volcanism in the Woodlark Rift, we evaluate the evolution of volcanism in eastern PNG using 40Ar/39Ar thermochronology and whole rock geochemistry. Active volcanism in southeastern Papua New Guinea occurs on the Papuan Peninsula (Mt. Lamington, Mt. Victory and Waiwa), in the Woodlark Rift (Dobu Island, SE Goodenough Island, and Western Fergusson Island), and in the Woodlark Basin. In the Woodlark Basin, seafloor spreading is active and decompression melting of the upper mantle is producing basaltic magmatism. However, the cause of Pliocene and younger volcanism in the Woodlark Rift is controversial. Two hypotheses for the tectonic setting have been proposed to explain Pliocene and younger volcanism in the Woodlark Rift: (1) southward subduction of Solomon Sea lithosphere beneath eastern PNG at the Trobriand Tough and (2) decompression melting of mantle, previously modified by subduction, as the lithosphere undergoes extension associated with the opening of the Woodlark Basin. A comparison of 40Ar/39Ar ages with high field strength element (HFSE) concentrations in primary magmas indicates that HFSE concentrations correlate with age in the Woodlark rift. These data support the hypothesis that Pliocene to active volcanism in the Woodlark Rise and D'Entrecasteaux Islands results from decompression melting of a relict mantle wedge. The subduction zone geochemical signatures (negative HFSE anomalies) in Woodlark Rift lavas younger than 4 m.y. are a relict from older subduction beneath eastern Papua, likely in the middle Miocene. As the lithosphere is extended ahead of the tip of the westward propagating seafloor spreading center in the Woodlark Basin, the composition of volcanism is inherited from prior arc magmatism (via flux melting) and through time evolves toward magmatism associated with a rifting

  11. Paleozoic accretionary orogenesis in the eastern Beishan orogen: constraints from zircon U-Pb and 40Ar/39Ar geochronology

    Science.gov (United States)

    Ao, Songjian; Xiao, Wenjiao; Windley, Brian; Mao, Qigui

    2016-04-01

    The continental growth mechanism of the Altaids in Central Asia is still in controversy between models of continuous subduction-accretion versus punctuated accretion by closure of multiple oceanic basins. The Beishan orogenic belt, located in the southern Altaids, is a natural laboratory to address this controversy. Key questions that are heavily debated are: the closure time and subduction polarity of former oceans, the emplacement time of ophiolites, and the styles of accretion and collision. This paper reports new structural data, zircon ages and Ar-Ar dates from the eastern Beishan Orogen that provide information on the accretion process and tectonic affiliation of various terranes. Our geochronological and structural results show that the younging direction of accretion was northwards and the subduction zone dipped southwards under the northern margin of the Shuangyingshan micro-continent. This long-lived and continuous accretion process formed the Hanshan accretionary prism. Our field investigations show that the emplacement of the Xiaohuangshan ophiolite was controlled by oceanic crust subduction beneath the forearc accretionary prism of the Shuangyingshan-Mazongshan composite arc to the south. Moreover, we address the age and terrane affiliation of lithologies in the eastern Beishan orogen through detrital zircon geochronology of meta-sedimentary rocks. We provide new information on the ages, subduction polarities, and affiliation of constituent structural units, as well as a new model of tectonic evolution of the eastern Beishan orogen. The accretionary processes and crustal growth of Central Asia were the result of multiple sequences of accretion and collision of manifold terranes. Reference: Ao, S.J., Xiao, W., Windley, B.F., Mao, Q., Han, C., Zhang, J.e., Yang, L., Geng, J., Paleozoic accretionary orogenesis in the eastern Beishan orogen: Constraints from zircon U-Pb and 40Ar/39Ar geochronology. Gondwana Research, doi: http://dx.doi.org/10.1016/j

  12. Mineralogy and Ar-Ar Age of the Tarahumara IIE Iron, with Reference to the Origin of Alkali-Rich Materials

    Science.gov (United States)

    Takeda, Hiroshi; Bogard, Donald D.; Otsuki, Mayumi; Ishii, Teruaki

    2003-01-01

    Silicate inclusions in nine known IIE irons show diversity in mineralogy, and Colomera, Kodaikanal, Elga and Miles contain alkali-rich silicate inclusions. Bogard et al. showed evidence of a complex parent body evolution for IIE irons based on Ar-39-Ar-40 ages. Colomera contained a sanidine-rich surface inclusion and the K-enrichment trends in the Na-rich inclusions are different from those of other IIEs. To elucidate the origin of K-rich materials, we studied the mineralogy and Ar-Ar age of silicate inclusions from the Tarahumara IIE iron meteorite.

  13. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii......) higher mass resolution allows hydrocarbon interferences to be pseudo resolved for the different argon isotopes; and (iv) multi-collection, allowing more data to be gathered in a fixed time in comparison with single-collector peak-switching measurements. We evaluate (i) protocols for detector inter...

  14. Producción y prueba de materiales educativos por computadora

    Directory of Open Access Journals (Sweden)

    Ma. de Lourdes Fournier

    2000-01-01

    Full Text Available En este trabajo se plantea parte de la problemática al enseñar temas de matemáticas y computación a estudiantes de demias sociales, junto con la fundamentación teórica y técnica para desarrollar y probar materiales educativos innovadores destinados a constituir apoyos adecuados para un aprendizaje significativo por parte de los estudiantes. También se presenta parte de los resultados obtenidos al efectuar pruebas, en un estudio de casos múltiples, tanto para materiales innovadores como para formas convencionales de enseñanza y algunas combinaciones. A partir de estos resultados es posible detectar importantes variables que inciden en los niveles de aprendizaje alcanzados por los alumnos.

  15. Intoxicación por metales Metal poisoning

    Directory of Open Access Journals (Sweden)

    A. Ferrer

    2003-01-01

    Full Text Available Los metales están entre los tóxicos más antiguos conocidos por el hombre. En el industrializado mundo actual las fuentes de exposición a metales son ubicuas tanto en el campo laboral como a partir de agua, los alimentos o el ambiente contaminados. Su toxicidad está caracterizada por el elemento metálico en cuestión pero se ve modificada por el tipo de compuesto, orgánico o inorgánico y sus características de hidro o liposolubilidad, que determina su toxicocinética y por tanto sus posibilidad de alcanzar sus dianas. Las biomoléculas más afectadas por los metales son las proteínas con actividad enzimática por lo que su patología es multisistema. Los principales sistemas afectados son el gastrointestinal, neurológico central y periférico, hemático y renal. Algunos de los compuestos metálicos son carcinógenos. Los metales se benefician de un tratamiento condicionado por su reactividad química. Pueden ser inactivados y eliminados mediante la administración de substancias quelantes que producen con ellos moléculas complejas, atóxicas y excretables. Los principales agentes quelantes son: BAL (British Anti-Lewisite o dimercaprol, DMPS (ácido 2,3-dimercapto-1-propanosulfonico y DMSA (ácido meso-2,3-dimercatosuccínico o Succimer, EDTA, Penicilamina (ß,ß-dimetilcisteína y Desferoxamina. Se exponen a continuación las características toxicocinéticas, mecanismo de acción, clínica y tratamiento de alguno de los metales y metaloides más relevantes: plomo, mercurio y arsénico.Metals are amongst the oldest toxic substances known to man. In today’s industrialized world the sources of exposure to metals are ubiquitous both in the field of work and from polluted water, foodstuffs and the environment. Their toxicity is characterized by the metallic element in question, but this is modified by the type of compound, whether organic or inorganic, and its characteristics of hydrosolubility and liposolubility, which determines its

  16. Miotoxicidade por organofosforados Organophosphate myotoxicity

    Directory of Open Access Journals (Sweden)

    Maria J. Cavaliere

    1996-06-01

    Full Text Available Os organofosforados são um grupo de compostos químicos amplamente utilizados em agropecuária como inseticidas, ocasionando intoxicações acidentais em animais e humanos, e mesmo sendo utilizados em tentativas de suicídio. A toxicidade desses produtos decorre sobretudo de insuficiência cárdio-respiratória por compromentimento do sistema nervoso autônomo. Sabe-se que alguns destes compostos induzem em animais de experimentação e em humanos, uma miopatia caracterizada por degeneração de células musculares, comprometendo sobretudo a musculatura respiratória. Baseado no fato de que este comprometimento contribui para a piora da função respiratória, propõe-se um protocolo de avaliação rotineira de miotoxicidade por compostos organofosforados, através de uma bateria mínima e suficiente de colorações e reações histoquímicas para quantificação da necrose muscular. Utilizaram-se como modelo experimental, grupos de ratos albinos (Wistar intoxicados com o organofosforado paraoxon, com e sem antídotos (atropina ou pralidoxima. Verificou-se nos grupos tratados com paraoxon e paraoxon mais atropina, necrose de fibras musculares no diafragma, que atingia em determinadas áreas até 15% das fibras. No grupo tratado com paraoxon mais pralidoxima, a necrose foi mínima, evidenciando o papel mioprotetor deste último antídoto.Organophosphates comprise a group of chemical compounds extensively used in farming as insecticides, which cause accidental poisoning in animals and men and are also used in suicide attempts. The toxicity of these compounds is due especially to the cardiac and respiratory impairment in consequence of autonomic nervous system disorders. However, it is known that some of these products induce a myopathy in experimental animals and humans. This myopathy is characterized by muscle cell degeneration, involving above all the respiratory muscles. Based on the fact that this involvement certainly enhances the

  17. Enseñar literatura a estudiantes de E/LE. ¿Cómo diseñar un curso de Introducción a la literatura española?

    Directory of Open Access Journals (Sweden)

    Marta Plaza Velasco

    2012-01-01

    Full Text Available La literatura es un recurso muy útil en el aula de E/LE: no solo nos permite trabajar determinados contenidos gramaticales, funcionales o léxicos, sino también acercar a nuestros alumnos y alumnas a las culturas e historias de España y Latinoamérica al mismo tiempo que ejercitan su imaginación y creatividad. Es por esto que podemos encontrar muchos materiales didácticos y estudios teóricos relacionados con la utilización de la literatura en el aula de E/LE. Pero, ¿qué ocurre cuando de lo que se trata no es de utilizar la literatura para enseñar español sino de enseñar literatura a estudiantes de E/LE? El material y los estudios teóricos que encontramos sobre esta cuestión no son tan abundantes.

  18. Enseñar con libertad en la escuela superior en México

    Directory of Open Access Journals (Sweden)

    Pablo Ayala Hernández

    2013-01-01

    Full Text Available La libertad de educar en diferentes escenarios del proceso de enseñanza ha mostrado diferentes mosaicos en relación a su intencionalidad. Desde una educación privada hasta una educación pública; donde su compromiso de educar con libertad siempre ha tenido una intencionalidad en el quehacer educativo. Por este motivo, unicamente la mera instrucción educativa nos puede cambiar el término de enseñar con libertad; creando un impulso o fuente de cambio educativo para reinventar la educación, particularmente se habla de la escuela superior en México. En los regímenes democráticos, como el nuestro, es perfectamente aceptable que los sistemas educativos tengan una intencionalidad y un concepto de libertad en la práctica docente, porque en ellos se dan las circunstancias adecuadas para que esta no resulte nociva para nadie y fomenten una educación con libertad de catedra.

  19. Audit, Control and Monitoring Design Patterns (ACMDP for Autonomous Robust Systems (ARS

    Directory of Open Access Journals (Sweden)

    C. Trad

    2008-11-01

    Full Text Available This paper proposes the Audit, Control and Monitoring Design Patterns (ACMDP for building Autonomous and Robust Systems (ARS such as Mobile Robot Systems (MRS. These patterns are also applicable to other Mission Critical and Complex Systems (MCCS. This paper presents a proposal which will help ARS project managers and engineers design, build and estimate the probability that an ARS will succeed or fail. Furthermore, this proposal offers the possibility to ARS problems with the help of audit, monitoring and controlling components, adjust the project management pathways, and define the problem sources as well as their possible solutions, in order to deliver an ARS or an MRS.

  20. High-Energy Ions Emitted from Ar Clusters Irradiated by Intense Femtosecond Laser Pulses

    Institute of Scientific and Technical Information of China (English)

    LI Zhong; LEI An-Le; NI Guo-Quan; XU Zhi-Zhan

    2000-01-01

    We have experimentally studied the energy spectra of Ar ions emitted from Ar clusters irradiated by intense femtosecond laser pulses. The Ar clusters were produced in the adiabatic expansion of Ar gas into vacuum at high backing pressures. The laser peak intensity was about 2×106 W/cm2 with a pulse duration of 45 fs. The maximum and the average energies of Ar ions are 0.2 MeV and 15kev at a backing pressure of 2. S MPa, respectively. They are almost independent of the backing pressures in the range of 0.6 to 4.5 MPa.

  1. Fluid heating system (SAF®: effects on clinical and biochemistry parameters in dogs submitted to inhalatory anesthesia Sistema de aquecimento de fluidos (SAF®: efeitos sobre parâmetros clínicos e bioquímica sérica em cadelas sob anestesia inalatória

    Directory of Open Access Journals (Sweden)

    Ingrid Bueno Atayde

    2009-04-01

    ímicas significativas, mas houve efeito de grupo sobre as variáveis PAM, uréia, ALT, ALP e tempo de hipnose. CONCLUSÃO: O uso isolado do Sistema de Aquecimento de Fluidos (SAF® não foi suficiente para evitar o estabelecimento da hipotermia em cadelas submetidas a anestesia geral inalatória, ou promover alterações clínicas e bioquímicas significativas.

  2. MICOBIOTA ASSOCIADA À MADEIRA SERRADA DE Eucalyptus grandis HILL EX MAIDEN DURANTE A SECAGEM AO AR LIVRE

    Directory of Open Access Journals (Sweden)

    Paulo Fernando Trugilho

    2006-02-01

    Full Text Available O objetivo principal deste trabalho foi o de acompanhar a secagem ao ar livre da madeira serrada de Eucalyptus grandis conduzida na região de Lavras, MG e identificar a micobiota associada à madeira em diversas fases da secagem. As tábuas foram cortadas de oito toras de 3,0 m de comprimento, oriundas de três árvores, com 27 anos de idade, plantadas em área experimental da UFLA. Dos resultados, pôde-se concluir que a secagem da madeira de Eucalyptus grandis ao ar livre, iniciada em janeiro, consumiu 158 dias até atingir umidade próxima a 12,5%. A curva de secagem foi representada por uma equação logarítmica com coeficiente de determinação (R2 igual a 98,3%. Os fungos causadores de bolores superficiais e de manchas tiveram maior ocorrência no início da secagem. As mais altas freqüências de fungos, verificadas no início da secagem, foram observadas para Penicillium spp. e Pestalotiopsis sp. O fungo Lentinus lepideus ocorreu com maior freqüência no final da secagem.

  3. Protein kinase D1 (PKD1) influences androgen receptor (AR) function in prostate cancer cells

    International Nuclear Information System (INIS)

    Protein kinase D1 (PKD1), founding member of PKD protein family, is down-regulated in advanced prostate cancer (PCa). We demonstrate that PKD1 and androgen receptor (AR) are present as a protein complex in PCa cells. PKD1 is associated with a transcriptional complex which contains AR and promoter sequence of the Prostate Specific Antigen (PSA) gene. Ectopic expression of wild type PKD1 and the kinase dead mutant PKD1 (K628W) attenuated the ligand-dependent transcriptional activation of AR in prostate cancer cells and yeast cells indicating that PKD1 can affect AR transcription activity, whereas knocking down PKD1 enhanced the ligand-dependent transcriptional activation of AR. Co-expression of kinase dead mutant with AR significantly inhibited androgen-mediated cell proliferation in both LNCaP and DU145 PC cells. Our data demonstrate for the first time that PKD1 can influence AR function in PCa cells

  4. Nueva mutación heterocigota en el gen de la proteína regulatoria aguda de la esteroideogénesis (StAR en un paciente 46,XY con hiperplasia adrenal congénita lipoidea

    Directory of Open Access Journals (Sweden)

    María Sonia Baquedano

    2013-08-01

    Full Text Available StAR forma parte del complejo multiproteico transduceosoma, encargado del transporte de colesterol y que facilita su entrada a la mitocondria. Mutaciones recesivas en el gen STAR causan formas clásicas y no clásicas de hiperplasia adrenal congénita lipoidea. Analizamos las consecuencias moleculares de una nueva mutación heterocigota en STAR en un paciente 46,XY con genitales ambiguos e insuficiencia adrenal. Hallamos un cambio heterocigota de novo, IVS1-2A>G, en el gen STAR y el polimorfismo heterocigota, pG146A, en SF1. No se detectaron mutaciones en los genes CYP11A1, FDX1 y FDXR, VDAC1 y TSPO. Por RT-PCR y secuenciación se observó un transcripto-exón2 y el transcripto normal (WT de StAR, a partir del ARN de tejido gonadal del paciente. Se detectó el precursor (37 kD y la proteína StAR madura (30 kD en células COS-7 transfectadas con el plásmido mutante y WT. Por inmunofluorescencia la observación de co-localización de la proteína mutante (p.G22_L59delStAR en mitocondrias fue casi nula. La actividad de p.G22_L59delStAR fue del 65% ± 13 respecto del WT. La co-transfección de los plásmidos p.G22_L59delStAR y WT redujo la actividad de WT en 62.0 ± 13.9%. La mutación IVS1-2A>G provocó la pérdida de los aminoácidos 22 a 59 en la secuencia mitocondrial N-terminal. Postulamos que ello conduciría a un plegamiento anormal de la proteína que alteraría su procesamiento y translocación. La proteína mutante p.G22_L59delStAR podría interferir con la acción de la proteína StAR WT bloqueando el complejo transduceosoma y causando una forma dominante de deficiencia de StAR, que explicaría el fenotipo clínico en heterocigosis.

  5. Rotational Spectrum of Ar...PROPARGYL Alcohol Complex

    Science.gov (United States)

    Mani, Devendra; Shahi, Abhishek; Arunan, E.

    2012-06-01

    Pure rotational spectrum for Ar...Propargyl alcohol complex has been observed and fitted. Fitted rotational constants for the complex are : A=4346.17307(90) MHz, B=1617.15317(19)MHz and C= 1245.42065(15) MHz. These rotational constants are very close to the ab-initio rotational constants for the geometry, in which propargyl alcohol exists in gauche conformation and Ar interacts with both, the hydroxyl group and the acetylenic group of propargyl alcohol. Rotational spectrum of deuterated isotopologue (-OD) of the complex further confirms the existence of the above mentioned geometry. In previous studies tunneling frequency corresponding to -OH tunneling motion in propargyl alocohol monomer was determined to be 652.4 GHz and for -OD tunneling motion in mono-deuterated species, it was 213.5 GHz. In Ar...Propargyl alcohol complex also, a-type and c-dipole transitions show tunneling splitting. In the parent complex, for a-type transitions, tunneling splitting was 10 KHz and for c-type transitions (c-dipole of the complex is in the same direction as in propargyl alcohol monomer, and it is antisymmetric with respect to OH tunneling motion in both monomer and the complex), it was 2.59 MHz. In deuterated complex (OD) splitting was not resolvable for a-type transitions while for c-type it reduces to 900 KHz. Search for C-13 isotopologues is in progress. Moreover, propargyl alcohol offers several possibilities for H-bonding and we are planning to study its complexes with water in near future. Results will be presented in the talk. E. Hirota,J. Mol. Spectrosc. 26 (1968) 335-350. J.C. Pearson, B.J. Drouin, J. Mol. Spectrosc. 234 (2005) 149-156.

  6. Flares and magnetic non-potentiality of NOAA AR 11158

    International Nuclear Information System (INIS)

    Magnetic non-potentiality is important for understanding flares and other solar activities in active regions (ARs). Five non-potential parameters, i.e. electric current, current helicity, source field, photospheric free energy, and angular shear, are calculated to quantify the non-potentiality of NOAA AR 11158. Benefitting from the high spatial resolution, high cadence and continuous temporal coverage of vector magnetograms from the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory, both the long-term evolution of the AR and the rapid change during flares are studied. We confirm that, compared with the magnetic flux, the magnetic non-potentiality has a closer connection with the flare, and the emerging flux regions are important for understanding the magnetic non-potentiality and flares. The main results are as follows. (1) The vortex in the source field directly displays the deflection of the horizontal magnetic field. The deflection corresponds to the fast rotating sunspot with a time delay, which suggests that the sunspot rotation leads to an increase in the non-potentiality. (2) Two areas that have evident changes in the azimuth of the vector magnetic field are found near the magnetic polarity inversion line. The change rates of the azimuth are about 1.3° h−1 and 3.6° h−1, respectively. (3) Rapid and prominent increases are found in the variation of helicity during four flares in the regions where their initial brightening occurs. The recovery of the increases takes 3–4 h for the two biggest flares (X2.2 and M6.6), but only takes about 2 h for the two other smaller flares (M2.2 and M1.6).

  7. Flares and magnetic non-potentiality of NOAA AR 11158

    Institute of Scientific and Technical Information of China (English)

    Qiao Song; Jun Zhang; Shu-Hong Yang; Yang Liu

    2013-01-01

    Magnetic non-potentiality is important for understanding flares and other solar activities in active regions (ARs).Five non-potential parameters,i.e.electric current,current helicity,source field,photospheric free energy,and angular shear,are calculated to quantify the non-potentiality of NOAA AR 11158.Benefitting from the high spatial resolution,high cadence and continuous temporal coverage of vector magnetograms from the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory,both the long-term evolution of the AR and the rapid change during flares are studied.We confirm that,compared with the magnetic flux,the magnetic non-potentiality has a closer connection with the flare,and the emerging flux regions are important for understanding the magnetic non-potentiality and flares.The main results are as follows.(1) The vortex in the source field directly displays the deflection of the horizontal magnetic field.The deflection corresponds to the fast rotating sunspot with a time delay,which suggests that the sunspot rotation leads to an increase in the non-potentiality.(2) Two areas that have evident changes in the azimuth of the vector magnetic field are found near the magnetic polarity inversion line.The change rates of the azimuth are about 1.3° h-1 and 3.6° h-1,respectively.(3) Rapid and prominent increases are found in the variation of helicity during four flares in the regions where their initial brightening occurs.The recovery of the increases takes 3-4 h for the two biggest flares (X2.2 and M6.6),but only takes about 2 h for the two other smaller flares (M2.2 and M1.6).

  8. X-ray calculations for a NLTE Ar plasma

    Institute of Scientific and Technical Information of China (English)

    WUZe-qing; PANGJin-qiao; HANGuo-xing

    2004-01-01

    A model is developed to calculate emission spectrum of non-local thermodynamic equilibrium(NLTE)plasmas. The Collisional-Radiative model is adopted for non-LTE population calculations. Configuration-averaged rate coefficients that needed in the rate equations are obtained based on the first order perturbation theory. The Hatree-Fock-Slater self-consistent-field method is used to calculate electron wave functions. The present model is applied to the calculation of emissivity from a Ar plasma. The features of the spectra are in good agreement with those calculated by other theoretical models, but the data of the integrated emissivity differ by a factor 2-8.

  9. Predication of Crane Condition Parameters Based on SVM and AR

    Science.gov (United States)

    Xiuzhong, Xu; Xiong, Hu; Congxiao, Zhou

    2011-07-01

    Through statistic analysis of vibration signals of motor on the container crane hoisting mechanism in a port, the feature vectors with vibration are obtained. Through data preprocessing and training data, Training models of condition parameters based on support vector machine (SVM) are established. The testing data of condition monitoring parameters can be predicted by the training models. During training the models, the penalty parameter and kernel function of model are optimized by cross validation. In order to analysis the accurate of SVM model, autoregressive model is used to predict the trend of vibration. The research showed the predicted results of model using SVM are better than the results by autoregressive (AR) modeling.

  10. Energy Levels of Highly Ionized Ar ⅩⅣ

    Institute of Scientific and Technical Information of China (English)

    CHENG Zhang; LI Ping; DENG Xiao-Hui

    2006-01-01

    With the Breit interaction and quantum electrodynamics corrections considered, relativistic configuration interaction calculations have been carried out in the extended optimal level scheme using multi-configuration Dirac-Fock wave functions on the 204 energy levels and electric dipole transitions of Ar ⅩⅣ. The results of electric dipole transitions are in good agreement with experiments. Among the energy levels calculated, the lowest 125 levels are in good agreement with available experimental and other theoretical ones, and the other 79 levels are new ones obtained by the present work. This wide range of atomic energy levels is useful in astrophysics and plasma physics.

  11. Tissue Characterization on Common Carotid Artery using AR Model

    Science.gov (United States)

    Koya, Yoshiharu; Mizoshiri, Isao

    This study uses one image with a echocardiography and detects arteriosclerosis on the common carotid artery by tissue characterization. The conventional methods are measurement of thickness on the vessel wall or stiffness on the common carotid artery. However, they need frames of several beats and great calculation times. But, we detect the arteriosclerosis with only one image. Our method estimate the grade of arteriosclerosis by AR model parameters fitted to the texture on the lumen-intima wall. Experimental results show the validity of the proposed method.

  12. Oscillator strengths for Ar VII, Ca IX and Fe XV

    Science.gov (United States)

    Tayal, S. S.

    1986-01-01

    The excitation energies and oscillator strengths are calculated for electric-dipole-allowed and intercombination transitions between 3s2 1S, 3s3p(1,3)P0, 3p2 3P, 1D, 1S and 3s3d(1,3)D states in Ar VII, Ca IX, and Fe XV ions of the magnesium sequence. These states are represented by the fairly large configuration-interaction expansions. The calculations have been carried out in both LS and intermediate coupling schemes. The relativistic corrections have been included through the Breit-Pauli Hamiltonian. The results are compared with previous theoretical calculations and with measurements.

  13. The readout system for the ArTeMis camera

    Science.gov (United States)

    Doumayrou, E.; Lortholary, M.; Dumaye, L.; Hamon, G.

    2014-07-01

    During ArTeMiS observations at the APEX telescope (Chajnantor, Chile), 5760 bolometric pixels from 20 arrays at 300mK, corresponding to 3 submillimeter focal planes at 450μm, 350μm and 200μm, have to be read out simultaneously at 40Hz. The read out system, made of electronics and software, is the full chain from the cryostat to the telescope. The readout electronics consists of cryogenic buffers at 4K (NABU), based on CMOS technology, and of warm electronic acquisition systems called BOLERO. The bolometric signal given by each pixel has to be amplified, sampled, converted, time stamped and formatted in data packets by the BOLERO electronics. The time stamping is obtained by the decoding of an IRIG-B signal given by APEX and is key to ensure the synchronization of the data with the telescope. Specifically developed for ArTeMiS, BOLERO is an assembly of analogue and digital FPGA boards connected directly on the top of the cryostat. Two detectors arrays (18*16 pixels), one NABU and one BOLERO interconnected by ribbon cables constitute the unit of the electronic architecture of ArTeMiS. In total, the 20 detectors for the tree focal planes are read by 10 BOLEROs. The software is working on a Linux operating system, it runs on 2 back-end computers (called BEAR) which are small and robust PCs with solid state disks. They gather the 10 BOLEROs data fluxes, and reconstruct the focal planes images. When the telescope scans the sky, the acquisitions are triggered thanks to a specific network protocol. This interface with APEX enables to synchronize the acquisition with the observations on sky: the time stamped data packets are sent during the scans to the APEX software that builds the observation FITS files. A graphical user interface enables the setting of the camera and the real time display of the focal plane images, which is essential in laboratory and commissioning phases. The software is a set of C++, Labview and Python, the qualities of which are respectively used

  14. Analyzing House Fly's Exploration Behavior with AR Methods

    CERN Document Server

    Takahashi, H; Ikegamai, T; Shimada, M; Horibe, Naoto; Ikegamai, Takahshi; Shimada, Masakazu; Takahashi, Hisanao

    2007-01-01

    This paper presents a detailed characterization of the trajectory of a single housefly freely walking in a square cage. The trajectory of the fly is recorded and transformed into time series, which is fully analyzed by the method of AR model. A main discovery is that the fly switches the styles of motion from the low dimensional regular pattern to the higher dimensional disordered pattern. In particular, the anomalous diffusion is found to well characterize the fly's exploration behavior. The exploration behavior analysis is important form both psychological and dynamical system' point of view.

  15. X-ray calculations for a NLTE Ar plasma

    Institute of Scientific and Technical Information of China (English)

    WU Ze-qing; PANG Jin-qiao; HAN Guo-xing

    2004-01-01

    A model is developed to calculate emission spectrum of non-local thermodynamic equilibrium(NLTE) plasmas. The Collisional-Radiative model is adopted for non-LTE population calculations. Configuration-averaged rate coefficients that needed in the rate equations are obtained based on the first order perturbation theory. The Hatree-Fock-Slater self-consistent-field method is used to calculate electron wave functions. The present model is applied to the calculation of emissivity from a Ar plasma. The features of the spectra are in good agreement with those calculated by other theoretical models, but the data of the integrated emissivity differ by a factor 2~8.

  16. Comportamento do óleo de soja refinado utilizado em fritura por imersão com alimentos de origem vegetal Refined soybean oil performance invegetable deep-fat frying

    Directory of Open Access Journals (Sweden)

    Roseneide C. Ferraz Cella

    2002-08-01

    Full Text Available A fritura é uma operação que confere aos alimentos características de odor, sabor, cor e textura de grande aceitabilidade sensorial. O óleo ou gordura pode, entretanto, se tornar um ingrediente capaz de introduzir alterações químicas provocadas pelo aquecimento prolongado. Neste trabalho, estudou-se o comportamento do óleo de soja refinado em fritura de imersão intermitente, em restaurante universitário, sob temperatura controlada entre 170ºC e 180ºC, por um período de 30 horas. Foram utilizados 101 litros de óleo de soja para processar 373kg de vegetais, como batata, couve-flor, abobrinha e mandioca. Analisou-se o óleo mediante determinações físicas de absortividade no u.v. (A232nm e A270nm e cor (Lovibond, e químicas (índice de acidez (IA e compostos polares (CP. Análise sensorial de aceitabilidade foi realizada nos produtos. Os parâmetros-limite que determinaram o descarte do óleo foram: 25% de compostos polares, 1% de ácidos graxos livres e média de 7,0 para o teste de aceitabilidade. Os resultados ao final do período foram: IA, 0,282; CP, 18,8%; cor Lovibond 14Y/2R; A232nm de 9,213; A270nm de 2,409 e 7,96 para o teste de aceitabilidade. Com base nos resultados obtidos, concluiu-se que, apesar do aquecimento do óleo ter levado a alterações hidrolíticas e oxidativas, os parâmetros não atingiram o nível de descarte, indicando que o óleo de soja submetido a essas condições de fritura pode ser usado por 30 horas.Deep fat frying is an important operation that imparts characteristics of flavor, color and texture in the fried products, however oil or fat becomes an ingredient that induces chemical alterations during prolonged heating periods. The performance of refined soybean oil was studied under intermittent deep fat frying conditions at a university cafeteria, at temperatures between 170ºC (338ºF and 180ºC (356ºF, for a period of 30 hours. During this period, 101 liters of soy oil were used to process

  17. Resistencia al cambio y trabajo por turnos en trabajadores de la banca

    Directory of Open Access Journals (Sweden)

    Daniel V. Valero R.

    2011-01-01

    Full Text Available Este artículo muestra los factores de resistencia al cambio ante la implementación de un esquema de trabajo por turnos para el personal del departamento de bases de datos de una institución bancaria venezolana, con el objetivo de diseñar un plan para el manejo del cambio, a través del cual la gerencia pueda intervenir y lograr superar dicha resistencia. La investigación consistió en un estudio de caso, que parte de realizar un diagnóstico que permitió identificar factores de resistencia como la disminución del ingreso económico, amenaza a hábitos familiares e intereses propios y seguridad personal; para luego diseñar un plan de manejo del cambio que le permitirá a la gerencia del área implantar el esquema de horarios de trabajo por turnos, con el menor impacto posible sobre el personal.

  18. Ultra-high precision 40Ar/39Ar ages for Fish Canyon Tuff and Alder Creek Rhyolite sanidine: New dating standards required?

    Science.gov (United States)

    Phillips, D.; Matchan, E. L.

    2013-11-01

    The 40Ar/39Ar dating technique is a high precision (ACR). Despite common usage, the ages of FCT and ACR sanidine have proven contentious, with reported values varying by >2%; well outside the ±0.1% aspiration of EARTHTIME (http://www.earth-time.org).

  19. Eruption of the Continental Flood Basalts at ~259 Ma in the Emeishan Large Igneous Province, SW China: Evidence from Laser Microprobe 40Ar/39Ar Dating

    Institute of Scientific and Technical Information of China (English)

    HOU Zengqian; CHEN Wen; LU Jiren

    2006-01-01

    A suite of continental flood basalts sampled over a vast exposure and stratigraphic thickness in the Emeishan large igneous province (LLP), SW China was investigated for laser microprobe 40Ar/39Ar dating. There are two 40Ar/39Ar age groups for these basalts, corresponding to 259-246 Ma and 177-137 Ma, respectively. A well-defined isochron gives an eruption age of huge quantities of mafic magmas at 258.9±3.4 Ma, which is identical to previous dating and paleontological data. Much younger 40Ar/39Ar ages for some basalts with low-greenschist metamorphic facies probably recorded a late thermo-tectonic event caused by collision between the Yangtze and Qiangtang continental blocks during the Mesozoic, which resulted in the reset of argon isotope system. The 40Ar/39Ar age data, we present here, combined with previous dating and paleontological data, suggest relatively short duration (about 3 Ma) of mafic volcanism, which have important implication on mantle plume genesis of the Emeishan continental flood basalts in the LIP.

  20. Constraining the age of the Matuyama-Brunhes reversal using intercalibrated 40Ar/39Ar and astronomical ages of the Bishop Tuff and Australasian Tektite

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Palike, Heiko;

    ). However, this age offset is not synchronous with a new astronomically intercalibrated 40Ar/39Ar age for the normal-polarity Quaternary Bishop Tuff, stratigraphically above the MB boundary by approximately 15 ka. In order to best constrain the age of the boundary, an astronomically calibrated radio...

  1. Noble Gases in the Monahans Chondrite and Halite: Ar-39 - Ar-40 Age, Space Exposure Age, Trapped Solar Gases, and Neutron Fluence

    Science.gov (United States)

    Garrison, Daniel H.; Bogard, Donald D.

    2000-01-01

    For the Monahans chondrite and halite, we determined Ar-39 - Ar-40 ages of silicate = 4.53 Ga, halite > 4.3 Ga; a space exposure age of approx. 5 Ma; a regolith pre-irradiation; solar gas concentrations in the dark phase; and a regolith thermal neutron fluence.

  2. Precise molybdenite Re-Os and mica Ar-Ar dating of the Mesozoic Yaogangxian tungsten deposit, central Nanling district, South China

    Science.gov (United States)

    Peng, Jiantang; Zhou, Mei-Fu; Hu, Ruizhong; Shen, Nengping; Yuan, Shunda; Bi, Xianwu; Du, Andao; Qu, Wenjun

    2006-10-01

    The Yaogangxian deposit in the central Nanling region, South China consists of vein-type ore bodies hosted in Cambrian to Jurassic strata and Mesozoic granitic intrusions. Wolframite and molybdenite are the dominant ore minerals intergrown with gangue minerals of quartz, feldspar, phlogopite, and muscovite. We have carried out molybdenite Re-Os and phlogopite and muscovite 40Ar/39Ar dating to better understand the timing and genesis of mineralization. Re-Os dating of eight molybdenite samples yielded model ages ranging from 152.0±3.5 to 161.1±4.5 Ma, with an average of 156.0 Ma. The Re-Os analyses give a well-defined 187Re/187Os isochron with an age of 154.9±2.6 Ma (MSWD=2.4). Hydrothermal phlogopite and muscovite display extremely flat 40Ar/39Ar age spectra. Phlogopite yields a 40Ar/39Ar plateau age of 153.0±1.1 Ma, whereas muscovite yields a plateau age of 155.1±1.1 Ma. Both 40Ar/39Ar ages are in good agreement with the Re-Os ages, placing the timing of tungsten mineralization at about 154 Ma. This age is consistent with the field relationships. Our new data, when combined with published geochronological results from other major deposits in this region, suggest that large scale W-Sn mineralization occurred throughout the central Nanling region in the Late Jurassic.

  3. An Early Jurassic 40Ar/39Ar Age for the Puchezh-Katunki Impact Structure (Russia) — No Causal Link to an Extinction Event

    Science.gov (United States)

    Holm-Alwmark, S.; Alwmark, C.; Lindström, S.; Ferrière, L.; Scherstén, A.; Masaitis, V. L.; Mashchak, M. S.; Naumov, M. V.

    2016-08-01

    We propose a revised age of 192.0 ± 0.8 Ma for the formation of the Puchezh-Katunki impact structure, Russia, based on 40Ar/39Ar step-heating analyses of five impact melt rock samples. This age does not correlate with any known extinction event.

  4. Calidad de servicio y recurso humano: caso estudio tienda por departamentos

    Directory of Open Access Journals (Sweden)

    Judith Hernández de Velazco

    2009-01-01

    Full Text Available Calidad de Servicio es una estrategia básica para enmarcar la estructura y funcionalidad organizativa dentro de parámetros que consideren las expectativas y necesidades clientelares, la importancia del recurso humano para dar respuesta a estas exigencias debe ser determinante para garantizar la calidad de los servicios que ofertan. Por lo tanto, el propósito del artículo es revisar resultados de una investigación preliminar que tuvo como objetivo evaluar la calidad de servicio y la importancia del recurso humano específicamente los empleados de atención al cliente en una tienda por departamentos del Estado Zulia. La investigación fue descriptiva y la muestra fue probabilística-intencional-casual escogida entre clientes de dos tiendas del grupo ubicadas en la ciudad de Maracaibo, el instrumento aplicado fue un cuestionario de elección múltiple. Se evidencia que la atención al cliente como servicio es percibida por los clientes como regular-mala por lo tanto debe ser mejorada en sus áreas críticas, también se determinaron factores de interés según preferencias clientelares todos relacionados con el recurso humano, se recomienda diseñar un programa de entrenamiento en Calidad de Servicio para los empleados.

  5. La inconstitucionalidad por omisión

    Directory of Open Access Journals (Sweden)

    Luz Bulnes Aldunate

    2006-01-01

    Full Text Available El artículo analiza la facultad de los tribunales constitucionales para determinar la inconstitucionalidad por omisión, en virtud del silencio u omisión de la autoridad de normar un principio o regla constitucional dispuesto por la Constitución explícita o implícitamente.

  6. 40Ar/39Ar Dating of the Shaxi Porphyry Cu-Au Deposit in the Southern Tan-Lu Fault Zone, Anhui Province

    Institute of Scientific and Technical Information of China (English)

    YANG Xiaoyong; ZHENG Yongfei; XIAO Yilin; DU Jianguo; SUN Weidong

    2007-01-01

    Four samples of plagioclase and biotite from the Shaxi porphyry in the lower part of the Yangtze metallogenic belt were analyzed for age determination with the 40Ar/39Ar method. The results yield reproducible ages of 126 Ma to 135 Ma with a high level of confidence according to the agreement between isochron and plateau ages. The four Ar-Ar ages are relatively consistent within the analytical error. These ages are also consistent with, but more precise than, previous K-Ar and Rb-Sr ages and thus provide better constraints on the time of porphyry formation and associated Cu-Au mineralization along the middle to lower part of the Yangtze metallogenic belt. The ages of 126 to 135 Ma are interpreted to represent the intrusive time of the Shaxi porphyry, so that the Cu-Au mineralization should have occurred later due to the post-magmatic hydrothermal event.

  7. Preservation of Sub-Microscopic Scale Structural Relics in Biotite: Implications for 40AR/39AR Geochronology

    Science.gov (United States)

    Beltrando, M.; Di Vincenzo, G.; Ferraris, C.

    2012-12-01

    Relic crystals of magmatic biotite that undewent eclogite facies metamorphism were investigated by laser step-heating and laser in-situ 40Ar/39Ar techniques, in conjunction with SEM, EMP and TEM analyses, to elucidate the influence of recrystallization on K-Ar systematics. Samples were collected from meta-granitoids of the Gran Paradiso Massif (Western Alps), emplaced at upper crustal depths (P~0.25-0.35 GPa) in the Permian and metamorphosed at P>2.0 GPa and T~500-600°C in the Middle-Late Eocene. Two different samples, which underwent different degrees of Alpine re-equilibration, were examined. Sample JT1007 still preserves the original cm-sized magmatic quartz, k-feldspar and brown biotite (Bt 1), rarely rimmed by small green biotite crystals (Bt 2) related to Alpine metamorphism. Sample JT1008, instead, is characterized by a larger degree of Alpine re-equilibration, with static re-crystallization of the original magmatic quartz into aggregates of fine-grained polygonal crystals and common green biotite rims around brown Bt 1. Compositional profiling across Bt 1 in sample JT1007 reveals a progressive decrease in Ti content towards the crystal rims, which overlap with the composition of Bt 2. Compositional profiling across Bt 1 in sample JT1008, instead, reveals a homogeneous Ti content across the grain. This compositional pattern is mirrored by TEM investigation at the sub-micron scale, revealing a systematic zoning in Bt 1 from sample JT1007, with high-temperature magmatic politypes, surrounded by 1M politypes, still preserved in crystal cores. Crystal rims, instead, are characterized by 1M politypes only. Biotites from JT1008, instead, are homogeneous, solely consisting of 1M politypes. Infrared laser step-heating experiments on mineral separates from the two samples gave contrasting results: JT1008 yielded a flat spectrum, for more than 90% of the released 39ArK, with an error-weighted mean age of 36.5±0.3 Ma; JT1007 yielded a slightly saddle-shaped profile

  8. Verdad por definición

    Directory of Open Access Journals (Sweden)

    Garrido Garrido, Julián

    1997-07-01

    Full Text Available Not available.La verdad por definición es un tipo peculiar de verdad científica, distinguible de las verdades lógicas, matemáticas y empíricas. La definición, por su parte, designa diversos procedimientos de asignación de significado, cuyas diferencias exigen una adjetivación cuidadosa: definiciones ostensivas y operacionales, definiciones de diccionario y definiciones teóricas. Pero sólo las del último tipo son verdaderas por definición. En el presente artículo se precisa el concepto formal de definición teórica, se delimita la estructura de esos enunciados, se analiza la verdad por definición, y se comparan, por último, las definiciones teóricas con los otros tipos de definición.

  9. Newly combined 40Ar/39Ar and U-Pb ages of the Upper Cretaceous timescale from Hokkaido, Japan

    Science.gov (United States)

    Gaylor, J. R.; Heredia, B. D.; Quidelleur, X.; Takashima, R.; Nishi, H.; Mezger, K.

    2011-12-01

    The main targets for GTS next project (www.gtsnext.eu) are to develop highly refined geological time scales, including the Upper Cretaceous. The Cretaceous period is characterised by numerous global anoxic events in the marine realm, rich ammonitic fossil assemblages and specialised foraminifera. However, lack of age diagnostic macro and micro fossils in the North Pacific sections has made it difficult to link these with global sections such as the Western Interior Basin (North America). Using advances with terrestrial C-isotope and planktic foraminifera records within Central Hokkaido we are able to correlate these sections globally. The Cretaceous Yezo group in Central Hokkaido comprises deep marine mudstones and turbidite sandstones interbedded with acidic volcanic tuffs. Using various sections within the Yezo group, we radiometrically dated tuffs at the main stage boundaries in the Upper Cretaceous. The samples derive from the Kotanbetsu, Shumarinai, Tiomiuchi and the Hakkin river sections, spanning the time from the Albian-Cenomanian up until the Campanian-Santonian boundaries, and were dated using 40Ar/39Ar, K/Ar and U-Pb techniques. Recent age constraints in the Hokkaido counterparts (Kotanbetsu sections) show good coherence between radiometric chronometers on the various Upper Cretaceous stage boundaries. These additional ages together with our isotope ages from the different sections around the Hokkaido basin are well linked by the various faunal assemblages and C-isotope curves. The combined radio isotope ages contribute to previous attempts (such as those focused in the Western Interior Basin) supporting the synchronicity of events such as global oceanic anoxic events. Finally, the ages obtained here also compliment the previous C-isotope and planktic foraminifera records allowing for a more precise climatic history of the Northwest Pacific during the Cretaceous. The research within the GTSnext project is funded by the European Community's Seventh

  10. The tectonic significance of pre-Scandian 40Ar/39Ar phengite cooling ages in the Caledonides of western Norway

    Science.gov (United States)

    Andersen, T.B.; Berry, H.N.; Lux, D.R.; Andresen, A.

    1998-01-01

    Pre-Silurian continental-margin deposits in western Norway, non-conformably overlying allochthonous continental orthogneisses retain Ordovician 40Ar/39Ar cooling ages for phengites, implying either rapid cooling immediately after a Late Ordovician orogenic event, or less likely, a slow cooling following an Early Ordovician or older orogeny. The Dalsfjord Suite-H??yvik Group basement-cover pair are probably a lateral equivalent to Late Proterozoic sandstones ('sparagmites') covering the Jotun Nappe gneisses of the Middle Allochthon in central-south Norway. The H??yvik Group underwent polyphase deformation, greenschist-facies metamorphism (Tmax Baltica and Laurentia. Phengitic white micas from the H??yvik Group yield cooling ages of 446.1 ?? 3.0, 449.1 ?? 2.2 and 447.5 ?? 4.0 Ma, respectively, identical within experimental error. One sample gives a plateau over 72% of the gas analysed, whereas the other samples were slightly disturbed after initial cooling, as indicated by systematically lower apparent ages at low experimental extraction temperatures. Minor 40Ar loss probably occurred during subsequent Scandian deformation and late to post-orogenic extension. The H??yvik Group rocks were unroofed before the Wenlock time (423-428 Ma) and cooled through the temperature for argon retention in phengite at c. 447 ?? 4 Ma, indicating a maximum cooling rate between 14 and 22??C/Ma-1 through Ashgill and Llandovery times before being subjected to low-grade metamorphism during the Scandian orogeny. Rapid pre-Scandian cooling, combined with peak metamorphic conditions of 450??C or less, may indicate that the Dalsfjord-H??yvik basement-cover pair were affected by an orogenic event during the Late Ordovician (Caradoc) time. The data also suggest that the Caledonian margin of Baltica may have experienced a more protracted tectonism during the Caledonian cycle than previously models focusing on Early Caledonian and Tremadoc (or older) ophiolite obduction and the Scandian

  11. INIBIÇÃO DE SALMONELLA POR EXTRATO DE ALECRIM (Rosmarinus officinalis: EFEITO DOS EXTRATOS ETANÓLICOS E AQUOSO INHIBITION OF Salmonella BY ROSEMARY EXTRACTS (Rosmarinus officinalis: EFFECT OF WATER AND ETHANOL EXTRACTS

    Directory of Open Access Journals (Sweden)

    Maria Célia Lopes Torres

    2007-09-01

    Full Text Available

    Estudou-se os efeitos inibidores do extrato etanólico e do extrato aquoso de alecrim, obtidos em Soxhlet e após aquecimento a 121°C por 10 minutos respectivamente, sobre sete espécies de Salmonella isoladas de frangos. Determinou-se a presença do princípio ativo bactericida do alecrim nos extratos aquoso e etanólico, sua concentração com efeito inibidor sobre Salmonella, “in vitro”, e a ocorrência de um possível sinergismo entre o extrato de alecrim e os componentes do meio. Verificou-se que o princípio ativo inibidor do alecrim concentra-se no extrato etanólico e que este efeito é obtido quando o extrato é esterilizado junto com o caldo de soja tríptica, ocorrendo sinergismo entre o extrato e os componentes do meio.

    Inhibitory effects presented by ethyl alcoholic and aquous extracts of rosemary were analyzed, obtained in Soxhlet and after heating at 121°C for 10 minutes, respectively, on seven species of Salmonella isolated from chicken. The presence of bactericidal active principle of rosemary in aquous and ethyl alcoholic extracts, its concentration with inhibitory effect on Salmonella, ";in vitro”, and the occurrence of a possible synergism between rosemary extract and milieu components. It was verified that inhibitory active principle of rosemary is concentrated in the ethyl alcoholic extract and that this effect is obtained when extract is sterilized together with triptyc soy broth, occurring synergism between extract and milieu components.

  12. Surface modification and biocompatible improvement of polystyrene film by Ar, O{sub 2} and Ar + O{sub 2} plasma

    Energy Technology Data Exchange (ETDEWEB)

    Chen Yashao, E-mail: yschen@snnu.edu.cn [Key Laboratory of Applied Surface and Colloid Chemistry (Shaanxi Normal University), Ministry of Education, School of Chemistry and Chemical Engineering, Xi' an 710062 (China); Gao Qiang; Wan Haiyan; Yi Jinhong; Wei Yanlin [Key Laboratory of Applied Surface and Colloid Chemistry (Shaanxi Normal University), Ministry of Education, School of Chemistry and Chemical Engineering, Xi' an 710062 (China); Liu Peng [Key Laboratory of Biorheological Science and Technology (Chongqing University), Ministry of Education, College of Bioengineering, Chongqing 400044 (China)

    2013-01-15

    Highlights: Black-Right-Pointing-Pointer NVP is successfully grafted onto the different discharge gases (Ar, O{sub 2}, and Ar + O{sub 2}) plasma-treated PS film surface by Ar plasma induced graft polymerization. Black-Right-Pointing-Pointer Compare with Ar and O{sub 2} plasma, the Ar + O{sub 2} plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. Black-Right-Pointing-Pointer According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. Black-Right-Pointing-Pointer Cellular compatibility tests indicate that Ar + O{sub 2} plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O{sub 2}, and Ar + O{sub 2}) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O{sub 2} plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  13. An industrial approach to design compelling VR and AR experience

    Science.gov (United States)

    Richir, Simon; Fuchs, Philippe; Lourdeaux, Domitile; Buche, Cédric; Querrec, Ronan

    2013-03-01

    The convergence of technologies currently observed in the field of VR, AR, robotics and consumer electronic reinforces the trend of new applications appearing every day. But when transferring knowledge acquired from research to businesses, research laboratories are often at a loss because of a lack of knowledge of the design and integration processes in creating an industrial scale product. In fact, the innovation approaches that take a good idea from the laboratory to a successful industrial product are often little known to researchers. The objective of this paper is to present the results of the work of several research teams that have finalized a working method for researchers and manufacturers that allow them to design virtual or augmented reality systems and enable their users to enjoy "a compelling VR experience". That approach, called "the I2I method", present 11 phases from "Establishing technological and competitive intelligence and industrial property" to "Improvements" through the "Definition of the Behavioral Interface, Virtual Environment and Behavioral Software Assistance". As a result of the experience gained by various research teams, this design approach benefits from contributions from current VR and AR research. Our objective is to validate and continuously move such multidisciplinary design team methods forward.

  14. Scientia sexualis versus ars erotica: Foucault, van Gulik, Needham.

    Science.gov (United States)

    Rocha, Leon Antonio

    2011-09-01

    This paper begins with a discussion of the scientia sexualis/ars erotica distinction, which Foucault first advances in History of Sexuality Vol. 1, and which has been employed by many scholars to do a variety of analytical work. Though Foucault has expressed his doubts regarding his conceptualization of the differences between Western and Eastern discourses of desire, he never entirely disowns the distinction. In fact, Foucault remains convinced that China must have an ars erotica. I will explore Foucault's sources of authority. To this end, I introduce the work of famous Dutch sinologist Robert Hans van Gulik, who published the tremendously influential Sexual Life in Ancient China in 1961, and also explore Joseph Needham's view on Chinese sex. I argue that, Foucault, in his fierce polemic against the "Repressive Hypothesis", himself imagined a utopian Other where pleasure and desire were organised differently. I end on a discuss on Orientalism and the project of "Sinography" of comparative literature scholars Haun Saussy, Eric Hayot and others.

  15. archAR: an archaeological augmented reality experience

    Science.gov (United States)

    Wiley, Bridgette; Schulze, Jürgen P.

    2015-03-01

    We present an application for Android phones or tablets called "archAR" that uses augmented reality as an alternative, portable way of viewing archaeological information from UCSD's Levantine Archaeology Laboratory. archAR provides a unique experience of flying through an archaeological dig site in the Levantine area and exploring the artifacts uncovered there. Using a Google Nexus tablet and Qualcomm's Vuforia API, we use an image target as a map and overlay a three-dimensional model of the dig site onto it, augmenting reality such that we are able to interact with the plotted artifacts. The user can physically move the Android device around the image target and see the dig site model from any perspective. The user can also move the device closer to the model in order to "zoom" into the view of a particular section of the model and its associated artifacts. This is especially useful, as the dig site model and the collection of artifacts are very detailed. The artifacts are plotted as points, colored by type. The user can touch the virtual points to trigger a popup information window that contains details of the artifact, such as photographs, material descriptions, and more.

  16. Electron capture and fragmentation in Ar11+ + CO collisions

    International Nuclear Information System (INIS)

    Collisions between 3, 10, and 50 keV/q Ar11+ ions and CO molecules have been studied using the Macdonald Lab CRYEBIS. Coincidence time of flight was used to detect all recoil ions and a position sensitive detector was used to determine final projectile charge states. Single- and double-electron capture are much larger than ionization at these collision energies. The dominant recoil channel associated with the Ar10+ final state is the CO+ molecular ion. The main ion-pair channel is the C+ + O+ dissociation of CO2+ while higher charge states of the transient COq+ fall off rapidly. Charge states up to CO4+ are formed in the collision indicating that many electrons are captured, but only one (and sometimes two) is retained by the projectile. This is due to autoionization of the highly excited states occupied by the captured electrons. In general, the fragmentation pattern of the CO molecule resembles the fragmentation associated with ionization caused by fast highly charged ions. This is as expected, since both processes happen at large impact parameters

  17. Arabic Sign Language (ArSL Recognition System Using HMM

    Directory of Open Access Journals (Sweden)

    Aliaa A. A.Youssif

    2011-11-01

    Full Text Available Hand gestures enabling deaf people to communication during their daily lives rather than by speaking. A sign language is a language which, instead of using sound, uses visually transmitted gesture signs which simultaneously combine hand shapes, orientation and movement of the hands, arms, lip-patterns, body movements and facial expressions to express the speaker's thoughts. Recognizing and documenting Arabic sign language has only been paid attention to recently. There have been few attempts to develop recognition systems to allow deaf people to interact with the rest of society. This paper introduces an automatic Arabic sign language (ArSL recognition system based on the Hidden Markov Models (HMMs. A large set of samples has been used to recognize 20 isolated words from the Standard Arabic sign language. The proposed system is signer-independent. Experiments are conducted using real ArSL videos taken for deaf people in different clothes and with different skin colors. Our system achieves an overall recognition rate reaching up to 82.22%.

  18. Ar + CO2 and He + CO2 Plasmas in ASTRAL

    Science.gov (United States)

    Boivin, R. F.; Gardner, A.; Munoz, J.; Kamar, O.; Loch, S.

    2007-11-01

    Spectroscopy study of the ASTRAL helicon plasma source running Ar + CO2 and He + CO2 gas mixes is presented. ASTRAL produces plasmas with the following parameters: ne = 10^10 - 10^13 cm-3, Te = 2 - 10 eV and Ti = 0.03 - 0.5 eV, B-field <= 1.3 kGauss, rf power <= 2 kWatt. A 0.33 m scanning monochromator is used for this study. Using Ar + CO2 gas mixes, very different plasmas are observed as the concentration of CO2 is changed. At low CO2 concentration, the bluish plasma is essentially atomic and argon transitions dominate the spectra. Weak C I and O I lines are present in the 750 - 1000 nm range. At higher CO2 concentration, the plasma becomes essentially molecular and is characterized by intense, white plasma columns. Here, spectra are filled with molecular bands (CO2, CO2^+, CO and CO^+). Limited molecular dissociative excitation processes associated with the production of C I and O I emission are also observed. On the other hand, He + CO2 plasmas are different. Here, rf matches are only possible at low CO2 concentration. Under these conditions, the spectra are characterized by strong C I and O I transitions with little or no molecular bands. Strong dissociative processes observed in these plasmas can be link to the high Te associated with He plasmas. An analysis of the spectra with possible scientific and industrial applications will be presented.

  19. Re-measurement of $^{32}$Ar to test the IMME

    CERN Multimedia

    The Isobaric Multiplet Mass Equation (IMME) has been subject to extensive studies in the low-mass region. Especially at the A = 32 quintet, the predicted quadratic form could not be confirmed, possible explanations being the insufficient accuracy of input parameters or higher-order interactions within the nucleon. For this quintet, the uncertainty on the mass-excess values of four of the five T = 2 multiplet members is extremely low: 0.6 keV for $^{32}$Cl, 0.3 keV for $^{32}$S, 0.2 keV for $^{32}$P, and 0.7 keV for $^{32}$Si. In the case of $^{32}$Ar, however, the uncertainty is as large as 1.8 keV. State-of-the-art high-precision Penning-trap mass spectrometry makes it possible to decrease this uncertainty. We propose to remeasure the mass of $^{32}$Ar at the Penning-trap mass spectrometer ISOLTRAP thus decreasing the uncertainty by a factor of 3-5. The proposed measurement is part of an experimental collaboration with JYFLTRAP, where the remaining masses of the T = 2 isospin quintet at A = 32 will be remeas...

  20. Evolution of NADPH-cytochrome P450 oxidoreductases (POR) in Apiales - POR 1 is missing

    DEFF Research Database (Denmark)

    Andersen, Trine Bundgaard; Hansen, Niels Bjørn; Laursen, Tomas;

    2016-01-01

    The NADPH-dependent cytochrome P450 oxidoreductase (POR) is the obligate electron donor to eukaryotic microsomal cytochromes P450 enzymes. The number of PORs within plant species is limited to one to four isoforms, with the most common being two PORs per plant. These enzymes provide electrons to ...