WorldWideScience

Sample records for aps transport lines

  1. High beam current shut-off systems in the APS linac and low energy transfer line

    International Nuclear Information System (INIS)

    Two independent high beam current shut-off current monitoring systems (BESOCM) have been installed in the APS linac and the low energy transport line to provide personnel safety protection in the event of acceleration of excessive beam currents. Beam current is monitored by a fast current transformer (FCT) and fully redundant supervisory circuits connected to the Access Control Interlock System (ACIS) for beam intensity related shutdowns of the linac. One FCT is located at the end of the positron linac and the other in the low energy transport line, which directs beam to the positron accumulator ring (PAR). To ensure a high degree of reliability, both systems employ a continuous self-checking function, which injects a test pulse to a single-turn test winding after each ''real'' beam pulse to verify that the system is fully functional. The system is designed to be fail-safe for all possible system faults, such as loss of power, open or shorted signal or test cables, loss of external trigger, malfunction of gated integrator, etc. The system has been successfully commissioned and is now a reliable part of the total ACIS

  2. Proton-dependent glutamine uptake by aphid bacteriocyte amino acid transporter ApGLNT1.

    Science.gov (United States)

    Price, Daniel R G; Wilson, Alex C C; Luetje, Charles W

    2015-10-01

    Aphids house large populations of the gammaproteobacterial symbiont Buchnera aphidicola in specialized bacteriocyte cells. The combined biosynthetic capability of the holobiont (Acyrthosiphon pisum and Buchnera) is sufficient for biosynthesis of all twenty protein coding amino acids, including amino acids that animals alone cannot synthesize; and that are present at low concentrations in A. pisum's plant phloem sap diet. Collaborative holobiont amino acid biosynthesis depends on glutamine import into bacteriocytes, which serves as a nitrogen-rich amino donor for biosynthesis of other amino acids. Recently, we characterized A. pisum glutamine transporter 1 (ApGLNT1), a member of the amino acid/auxin permease family, as the dominant bacteriocyte plasma membrane glutamine transporter. Here we show ApGLNT1 to be structurally and functionally related to mammalian proton-dependent amino acid transporters (PATs 1-4). Using functional expression in Xenopus laevis oocytes, combined with two-electrode voltage clamp electrophysiology we demonstrate that ApGLNT1 is electrogenic and that glutamine induces large inward currents. ApGLNT1 glutamine induced currents are dependent on external glutamine concentration, proton (H+) gradient across the membrane, and membrane potential. Based on these transport properties, ApGLNT1-mediated glutamine uptake into A. pisum bacteriocytes can be regulated by changes in either proton gradients across the plasma membrane or membrane potential. PMID:26028424

  3. Analysis and Verification of Direct Vessel Injection Line Break event tree for AP1000 reactor with TRACE code

    Energy Technology Data Exchange (ETDEWEB)

    Queral, C.; Montero-Mayorga, J.; Gonzalez-Cadelo, J.

    2013-07-01

    The AP1000 PRA thermal hydraulic simulations were performed with MAAP code, which allows simulating sequences with low computational efforts. On the other hand, the use of best estimate codes allows verifying PRA results as well as obtaining a greater knowledge of the phenomenology of such sequences. The initiating event with the greatest contribution to core damage is Direct Vessel Injection Line Break (DVILB). This paper presents a review of DVILB sequences of AP1000 with TRACE code for verifying sequences previously analyzed by Westinghouse with MAAP code. The sequences which configure the DVILB event tree during short term have been simulated. The results obtained confirm the ones obtained in AP1000 PRA.

  4. Pulsational line profile variation of the roAp star HR 3831

    CERN Document Server

    Kochukhov, O

    2005-01-01

    We report the first comprehensive investigation of the line profile variation caused by non-radial pulsation in a magnetic oscillating chemically peculiar star. Spectrum variation of the well-known roAp star HR 3831 is detected using very high-resolution high signal-to-noise spectroscopic time-series observations and are followed through the whole rotation cycle of the star. We confirm outstanding diversity of pulsational behaviour of different lines in the HR 3831 spectrum and attribute this phenomenon to an interplay between extreme vertical chemical inhomogeneity of the HR 3831 atmosphere and a running pulsation wave, propagating towards the upper photospheric layers with increasing amplitude. Rapid profile variation of the NdIII 6145 A line is characterized by measuring changes of its equivalent width and the first three moments. We demonstrate that rotational modulation of the radial velocity oscillations cannot be fully explained by an oblique axisymmetric dipole (ell=1, m=0) mode, implied by the classi...

  5. Moisture Transport Through Sprayed Concrete Tunnel Linings

    Science.gov (United States)

    Holter, Karl Gunnar; Geving, Stig

    2016-01-01

    Waterproofing of permanent sprayed concrete tunnel linings with sprayed membranes in a continuous sandwich structure has been attempted since 2000 and has seen increased use in some countries. The main function of a sprayed membrane from a waterproofing perspective is to provide crack bridging and hence prevent flow of liquid water into the tunnel through cracks and imperfections in the concrete material. However, moisture can migrate through the concrete and EVA-based membrane materials by capillary and vapor diffusion mechanisms. These moisture transport mechanisms can have an influence on the degree of saturation, and may influence the pore pressures in the concrete material as well as risk of freeze-thaw damage of the concrete and membrane. The paper describes a detailed study of moisture transport material parameters, moisture condition in tunnel linings and climatic conditions tunnels in hard rock in Norway. These data have been included in a hygrothermal simulation model in the software WUFI for moisture transport to substantiate moisture transport and long-term effects on saturation of the concrete and membrane material. The findings suggest that EVA-based membranes exhibit significant water absorption and vapor transport properties although they are impermeable to liquid water flow. State-of-the-art sprayed concrete material applied with the wet mix method exhibits very low hydraulic conductivities, lower than 10-14 m/s, thus saturated conductive water flow is a very unlikely dominant transport mechanism. Moisture transport through the lining structure by capillary flow and vapor diffusion are calculated to approximately 3 cm3/m2 per day for lining thicknesses in the range of 25-35 cm and seasonal Nordic climate variations. The calculated moisture contents in the tunnel linings from the hygrothermal simulations are largely in agreement with the measured moisture contents in the tunnel linings. The findings also indicate that the concrete material exhibits

  6. Westinghouse AP1000 internals heating rate distribution calculation using a 3D deterministic transport method

    International Nuclear Information System (INIS)

    Cost reduction and reliability increase are systematically pursued systems and components; this requires, amongst other, the availability of sophisticated computer programs and detailed analysis models. As an example, the core shroud, the structure having the function to maintain the core centered on its axis, is being designed in the Westinghouse AP1000, differently from previous plants, as a highly heterogeneous structure. Its thermal-mechanical sizing must take into due account accurately determined internal heat generation rates. The latter, if determined by combining 2D and 1D neutron and γ-ray calculations which imply the separation of spatial variables and are mainly applicable for fluxes in the reactor beltline region, may include overly conservative margins. On the other hand, Monte Carlo methods do not allow an easy quantification of the uncertainties related to overall calculation. Three-dimensional deterministic models, based on the discrete ordinate transport theory, have the potential to provide accurate design data; they can be also effective provided that the well-known difficulty to create and tune a complex geometrical model in a reasonable time is overcome and adequate computer resources are available to perform the calculation (until few years ago [Botta et al., 1996. Three-Dimensional Reactor Pressure Vessel Fast Neutron Fluence Calculations for the AP600 Using TORT, 3-D Deterministic Radiation Transport Computer Programs: Features, Applications and Perspectives, NEA/NSC/DOC, OECD/NEA. Paris, France], massive parallel computers (i.e. Cray Computers) available only to large national laboratories and selected industries had to be used). ANSALDO is acting as Westinghouse subcontractor and it supported Westinghouse in all AP1000 Licensing Process to NRC from 1999 to nowdays for the internal heating rate generation rate and RPV fluence calculations. As computer power growths up ANSALDO refined its calculation methodology in order to improve the

  7. Chloride transport in a glioma cell line

    Energy Technology Data Exchange (ETDEWEB)

    Wolpaw, E.W.

    1984-01-01

    Maintenance of the extracellular environment is a major function of central nervous system astroglia. The transport of Cl/sup -/ across the cell membrane may be an integral part of this function, since Cl/sup -/ transport has been implicated in homeostasis of cell volume, pH, and extracellular K/sup +/ concentration. The work presented here investigated Cl/sup -/ transport in the glioma cell line LRM55. Results indicate that LRM55 cells are a good model for astroglia and that these cells contain three Cl/sup -/ transporters; a Cl/sup -//HCO/sub 3//sup -/ exchanger, a K/sup +//Cl/sup -/ cotransporter, and a Cl/sup -//SO/sub 4//sup 2 -/ exchanger. Ion transport studies measured the fluxes of Cl/sup -/ (as /sup 36/Cl/sup -/), K/sup +/ (as /sup 86/Rb/sup +/), and SO/sub 4//sup 2 -/ (as /sup 35/SO/sub 4//sup 2 -/). Cl/sup -/ flux was trans-simulated by Cl/sup -/ or HCO/sub 3//sup -/ and was inhibited by SITS or furosemide. External K/sup +/ stimulated Cl/sup -/ influx and external Cl/sup -/ stimulated Rb/sup +/ influx. Furosemide, but not SITS, inhibited the K/sup +//Cl/sup -/ cotransporter. High K/sup +/ medium increased cell volume and Cl/sup -/ content. Steady-state Cl/sup -/ concentration was at least twice that predicted from passive equilibration according to the Nernst equation. SO/sub 4//sup 2 -/ flux was trans-stimulated by SO/sub 4//sup 2 -/ or by Cl/sup -/. Cl/sup -/ was a competitive inhibitor of SO/sub 4//sup 2 -/ influx, but SO/sub 4//sup 2 -/ had no detectable effect on Cl/sup -/ influx or efflux. SO/sub 4//sup 2 -/ flux was inhibited by SITS or furosemide.

  8. Intracellular transport of MHC class II and associated invariant chain in antigen presenting cells from AP-3-deficient mocha mice.

    Science.gov (United States)

    Sevilla, L M; Richter, S S; Miller, J

    2001-06-15

    MHC class II-restricted antigen presentation requires trafficking of newly synthesized class II-invariant chain complexes from the trans-Golgi network to endosomal, peptide-loading compartments. This transport is mediated by dileucine-like motifs within the cytosolic tail of the invariant chain. Although these signals have been well characterized, the cytosolic proteins that interact with these dileucine signals and mediate Golgi sorting and endosomal transport have not been identified. Recently, an adaptor complex, AP-3, has been identified that interacts with dileucine motifs and mediates endosomal/lysosomal transport in yeast, Drosophila, and mammals. In this report, we have assessed class II-invariant chain trafficking in a strain of mice (mocha) which lacks expression of AP-3. Our studies demonstrate that the lack of AP-3 does not affect the kinetics of invariant chain degradation, the route of class II-invariant chain transport, or the rate and extent of class II-peptide binding as assessed by the generation of SDS-stable dimers. The possible role of other known or unknown adaptor complexes in class II-invariant chain transport is discussed. PMID:11520080

  9. Interaction Between The Broad-lined Type Ic Supernova 2012ap and Carriers of Diffuse Interstellar Bands

    CERN Document Server

    Milisavljevic, D; Crabtree, K N; Foster, J B; Soderberg, A M; Fesen, R A; Parrent, J T; Sanders, N E; Drout, M R; Kamble, A; Chakraborti, S; Pickering, T E; Cenko, S B; Silverman, J M; Filippenko, A V; Kirshner, R P; Mazzali, P; Maeda, K; Marion, G H; Vinko, J; Wheeler, J C

    2014-01-01

    The diffuse interstellar bands (DIBs) are absorption features observed in optical and near-infrared spectra that are thought to be associated with carbon-rich polyatomic molecules in interstellar gas. However, because the central wavelengths of these bands do not correspond with electronic transitions of any known atomic or molecular species, their nature has remained uncertain since their discovery almost a century ago. Here we report on unusually strong DIBs in optical spectra of the broad-lined Type Ic supernova SN 2012ap that exhibit changes in equivalent width over short (~30 days) timescales. The 4428 and 6283 Angstrom DIB features get weaker with time, whereas the 5780 Angstrom feature shows a marginal increase. These nonuniform changes suggest that the supernova is interacting with a nearby source of the DIBs and that the DIB carriers possess high ionization potentials, such as small cations or charged fullerenes. We conclude that moderate-resolution spectra of supernovae with DIB absorptions obtained...

  10. AP1000控制棒驱动线落棒试验研究%Study on Drop Performance Test of AP1000 Control Rod Drive Line

    Institute of Scientific and Technical Information of China (English)

    顾汉洋; 张朝柱; 陈宇清; 周肖佳; 刘刚

    2015-01-01

    采用1组全尺寸AP1000控制棒驱动线进行落棒试验,研究不同纵向流和横向流以及错位和变形对落棒时间的影响,并用高速摄像图像处理技术获得落棒行程速度曲线.试验结果表明,纵向流量是影响驱动线落棒时间的主要因素;在本试验范围内横向流以及部件的错位变形对AP1000控制棒驱动线落棒时间的影响都较为有限.

  11. SPES-2, the full-height, full-pressure test facility simulating the AP600 plant comparison among 2' small break tests located on different lines

    International Nuclear Information System (INIS)

    SPES-2 is a full height, full pressure experimental test facility reproducing the Westinghouse AP600 reactor with a scaling factor of 1/395. The experimental plant, designed and operated by SIET in Piacenza, consists of a full simulation of the AP600 primary core cooling system including all the passive and active safety systems. In 1992, Westinghouse, in cooperation with ENEL, ENEA, SIET and ANSALDO developed an experimental program to test the integrated behaviour of the AP600 passive safety systems. The SPES-2 test matrix, concluded in November'94, has examined the AP600 passive safety system response for a range of small break LOCAs at different locations on the primary system and on the passive system lines; single steam generator tube ruptures with both passive and active non-safety systems, and a main steam line break transient to demonstrate the capability of passive safety systems for rapid cooldown. Each of the tests has provided detailed experimental results for verification of the capability of the analysis methods to predict the integrated passive safety system behaviour. The author will describe the results obtained during experimental test facility having the same break size (2 inches) but located in different plant positions (cold leg, Direct Vessel Injection line, cold leg-CMT balance line) in order to determine the effect of break location on the plant behaviour

  12. Comparison of curved trajectory atmospheric transport vs. assumed straight-line transport

    International Nuclear Information System (INIS)

    The Dose-To-Man program as currently being implemented at the Savannah River Laboratory provides estimates of the environmental effects of Savannah River Plant operations. These estimates utilize a polar grid structure and assume straight-line transport of materials released to the atmosphere to distances beyond grid boundaries. The assumption of straight-line transport is standard for such estimates and greatly simplifies the computations involved in providing estimates of effects. Generally, the atmospheric transport trajectory will be curved; and, for distances out to 100 km or so, the assumption may lead to significant error. Therefore, a computer code was constructed to provide an estimate of the curved trajectory transport relative to straight-line transport over an extended time period

  13. Design of the SLC damping ring to linac transport lines

    International Nuclear Information System (INIS)

    The first and second order optics for the damping ring to linac transport line are designed to preserve the damped transverse emittance while simultaneously compressing the bunch length of the beam to that length required for reinjection into the linac. This design, including provisions for future control of beam polarization, is described

  14. SPES-2, AP600 intergral system test S01007 2 inch CL to core make-up tank pressure balance line break

    Energy Technology Data Exchange (ETDEWEB)

    Bacchiani, M.; Medich, C.; Rigamonti, M. [SIET S.p.A. Piacenza (Italy)] [and others

    1995-09-01

    The SPES-2 is a full height, full pressure experimental test facility reproducing the Westinghouse AP600 reactor with a scaling factor of 1/395. The experimental plant, designed and operated by SIET in Piacenza, consists of a full simulation of the AP600 primary core cooling system including all the passive and active safety systems. In 1992, Westinghouse, in cooperation with ENEL (Ente Nazionale per l` Energia Elettrica), ENEA (Enter per le numove Technlogie, l` Energia e l` Ambient), Siet (Societa Informazioni Esperienze Termoidraulich) and ANSALDO developed an experimental program to test the integrated behaviour of the AP600 passive safety systems. The SPES-2 test matrix, concluded in November 1994, has examined the AP600 passive safety system response for a range of small break LOCAs at different locations on the primary system and on the passive system lines; single steam generator tube ruptures with passive and active safety systems and a main steam line break transient to demonstrate the boration capability of passive safety systems for rapid cooldown. Each of the tests has provided detailed experimental results for verification of the capability of the analysis methods to predict the integrated passive safety system behaviour. Cold and hot shakedown tests have been performed on the facility to check the characteristics of the plant before starting the experimental campaign. The paper first presents a description of the SPES-2 test facility then the main results of S01007 test {open_quotes}2{close_quotes} Cold Leg (CL) to Core Make-up Tank (CMT) pressure balance line break{close_quotes} are reported and compared with predictions performed using RELAP5/mod3/80 obtained by ANSALDO through agreement with U.S.N.R.C. (U.S. Nuclear Regulatory Commission). The SPES-2 nodalization and all the calculations here presented were performed by ANSALDO and sponsored by ENEL as a part of pre-test predictions for SPES-2.

  15. Phenomena identification and ranking tables for Westinghouse AP600 small break loss-of-coolant accident, main steam line break, and steam generator tube rupture scenarios

    International Nuclear Information System (INIS)

    This report revision incorporates new experimental evidence regarding AP600 behavior during small break loss-of-coolant accidents. This report documents the results of Phenomena Identification and Ranking Table (PIRT) efforts for the Westinghouse AP600 reactor. The purpose of this PIRT is to identify important phenomena so that they may be addressed in both the experimental programs and the RELAP5/MOD3 systems analysis computer code. In Revision of this report, the responses of AP600 during small break loss-of-coolant accident, main steam line break, and steam generator tube rupture accident scenarios were evaluated by a committee of thermal-hydraulic experts. Committee membership included Idaho National Engineering and Environmental Laboratory staff and recognized thermal-hydraulic experts from outside of the laboratory. Each of the accident scenarios was subdivided into separate, sequential periods or phases. Within each phase, the plant behavior is controlled by, at most, a few thermal-hydraulic processes. The committee identified the phenomena influencing those processes, and ranked ampersand influences as being of high, medium, low, or insignificant importance. The primary product of this effort is a series of tables, one for each phase of each accident scenario, describing the thermal-hydraulic phenomena judged by the committee to be important, and the relative ranking of that importance. The rationales for the phenomena selected and their rankings are provided. This document issue incorporates an update of the small break loss-of-coolant accident portion of the report. This revision is the result of the release of experimental evidence from AP600-related integral test facilities (ROSA/AP600, OSU, and SPES) and thermal-hydraulic expert review. The activities associated with this update were performed during the period from June 1995 through November 1996. 8 refs., 26 figs., 42 tabs

  16. Phenomena identification and ranking tables for Westinghouse AP600 small break loss-of-coolant accident, main steam line break, and steam generator tube rupture scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, G.E.; Fletcher, C.D.; Davis, C.B. [and others

    1997-06-01

    This report revision incorporates new experimental evidence regarding AP600 behavior during small break loss-of-coolant accidents. This report documents the results of Phenomena Identification and Ranking Table (PIRT) efforts for the Westinghouse AP600 reactor. The purpose of this PIRT is to identify important phenomena so that they may be addressed in both the experimental programs and the RELAP5/MOD3 systems analysis computer code. In Revision of this report, the responses of AP600 during small break loss-of-coolant accident, main steam line break, and steam generator tube rupture accident scenarios were evaluated by a committee of thermal-hydraulic experts. Committee membership included Idaho National Engineering and Environmental Laboratory staff and recognized thermal-hydraulic experts from outside of the laboratory. Each of the accident scenarios was subdivided into separate, sequential periods or phases. Within each phase, the plant behavior is controlled by, at most, a few thermal-hydraulic processes. The committee identified the phenomena influencing those processes, and ranked & influences as being of high, medium, low, or insignificant importance. The primary product of this effort is a series of tables, one for each phase of each accident scenario, describing the thermal-hydraulic phenomena judged by the committee to be important, and the relative ranking of that importance. The rationales for the phenomena selected and their rankings are provided. This document issue incorporates an update of the small break loss-of-coolant accident portion of the report. This revision is the result of the release of experimental evidence from AP600-related integral test facilities (ROSA/AP600, OSU, and SPES) and thermal-hydraulic expert review. The activities associated with this update were performed during the period from June 1995 through November 1996. 8 refs., 26 figs., 42 tabs.

  17. Potential formation and transport in open field line systems

    International Nuclear Information System (INIS)

    Many studies have been reported on the potential formation in tandem mirrors and in many other systems. Plasma potentials are also interested in relation to the H-mode and divertor plasma in toroidal systems. The workshops 'Potential Formation and Transport in Open Field Line Systems' were organized three times as collaboration research at the National Institute for Fusion Science from 1990 to 1992. The workshops were aimed at the study of potential formation and related transport in various plasmas with emphasis on those in open magnetic field line systems. This memo is a report of research progress during the three years and new researches presented at the workshops. These workshops were supported by NIFS for the three years. (author)

  18. Mutation in AP-3 delta in the mocha mouse links endosomal transport to storage deficiency in platelets, melanosomes, and synaptic vesicles.

    Science.gov (United States)

    Kantheti, P; Qiao, X; Diaz, M E; Peden, A A; Meyer, G E; Carskadon, S L; Kapfhamer, D; Sufalko, D; Robinson, M S; Noebels, J L; Burmeister, M

    1998-07-01

    The mouse mutant mocha, a model for the Hermansky-Pudlak storage pool deficiency syndrome, is characterized by defective platelets, coat and eye color dilution, lysosomal abnormalities, inner ear degeneration, and neurological deficits. Here, we show that mocha is a null allele of the delta subunit of the adaptor-like protein complex AP-3, which is associated with coated vesicles budding from the trans-Golgi network, and that AP-3 is missing in mocha tissues. In mocha brain, the ZnT-3 transporter is reduced, resulting in a lack of zinc-associated Timm historeactivity in hippocampal mossy fibers. Our results demonstrate that the AP-3 complex is responsible for cargo selection to lysosome-related organelles such as melanosomes and platelet dense granules as well as to neurotransmitter vesicles. PMID:9697856

  19. Development of new transport line (TL-1) for Indus facility

    International Nuclear Information System (INIS)

    Transport Line-1 (TL-1) is a part of pre-injector system of Synchrotron Radiation Sources Indus-1 and Indus-2. In order to insert more number of diagnostic devices, especially Beam Slit Monitors for observing the beam position at various locations on TL-1, and to study the angular divergence etc., one new UHV system for TL-1 was designed and developed. Total length of TL-1 is ∼ 13.6 metres. This line transports the electron beam from the Microtron to the Booster Synchrotron. TL-1 comprises of Stainless Steel (SS grade: AISI 316) chambers, with ports for pumps, gauges, bellows for mechanical flexibility, isolation valves, and different Beam Diagnostic Devices like Beam Slit Monitors (BSM), Beam Profile Monitors (BPM), Secondary Emission Wire Monitors (SEWM) and Fast Current Transformers (FCT). All the associated UHV components were fabricated and qualified for UHV, individually in the UHV Lab. Vacuum in the range of 10-9-10-8 mbar was achieved. Ultimately all the components, (including the Beam Diagnostic Devices), are assembled in a mock assembly as per their original positions and tested. The aim of this exercise is to resolve the various unforeseen minor problems, in assembly, well in advance, so that the final assembly in actual position can be completed within minimum time period, (minimum down period of Indus facility), with more efficiency. This paper describes the testing procedures and the results of this exercise. (author)

  20. New magnet transport system for the LHC beam transfer lines

    CERN Document Server

    Patrice Loïez

    2003-01-01

    The first of 700 magnets has been installed in one of the two transfer tunnels built to transfer the SPS beam into the LHC. The start of this first installation phase of the LHC transfer lines provides the opportunity to launch a new and highly original modular system for transporting and installing all kinds of magnets in very narrow tunnels. The system (pictured here in one of the tunnels) is based on very compact bogies, up to four of which can be coupled together to form a convoy. The wheels are fitted with individual motors enabling them to swivel through an angle of 90° and the convoy to move laterally. The lead vehicle is powered by an electric rail set into the roof of the tunnel. The system is backed up by electrical batteries that enable it to operate in the absence of an outside power source or in the event of power failure. Last but not least, for the long-distance transport of magnets, it can be optically guided by a line traced on the tunnel floor. The convoy moves through the particularly narr...

  1. Enhancer of garnet/deltaAP-3 is a cryptic allele of the white gene and identifies the intracellular transport system for the white protein.

    Science.gov (United States)

    Lloyd, Vett K; Sinclair, D A R; Alperyn, M; Grigliatti, T A

    2002-04-01

    The white gene encodes an ABC-type transmembrane transporter that has a role in normal eye pigment deposition. In addition, overexpression in Drosophila leads to homosexual male courtship. Its human homologue has been implicated in cholesterol transport in macrophages and in mood disorders in human males. The garnet gene is a member of a group of other Drosophila eye colour genes that have been shown, or proposed, to function in intracellular protein transport. Recent molecular analysis indicates that it encodes the delta subunit of the AP-3 adaptin complex involved in vesicle transport from the trans-Golgi network to lysosomes and related organelles, such as pigment granules. This identification revealed a novel role for intracellular vesicular transport in Drosophila pigmentation. To further analyze this intracellular transport system, we examined the genetic interactions between garnet and a second site enhancer mutation, enhancer of garnet (e(g)). We show here that e(g) is a cryptic allele of the white gene. The white-garnet interaction is highly sensitive to the levels of both gene products but also shows some allele specificity for the white gene. The additive effect on pigmentation and the predicted protein products of these genes suggest that the garnet/AP-3 transport system ensures the correct intracellular localization of the white gene product. This model is further supported by the observation of homosexual male courtship behavior in garnet mutants, similar to that seen in flies overexpressing, and presumably mis-sorting, the white gene product. The w(e(g)) allele also enhances mutations in the subset of other eye-color genes with phenotypes similar to garnet. This observation supports a role for these genes in intracellular transport and leads to a model whereby incorrect sorting of the white gene product can explain the pigmentation phenotypes of an entire group of eye-color genes. PMID:11962627

  2. The new control system of HLS linac and transport line

    Institute of Scientific and Technical Information of China (English)

    LIU Gong-Fa; LI Wei-Min; LI Jing-Yi; LI Chuan; CHEN Li-Ping; BAO Xun; WANG Ji-Gang; XUAN Ke

    2005-01-01

    The new linac and transport line control system of Hefei Light Source (HLS) is a distributed control system based on EPICS (Experimental Physics and Industrial Control System). Industrial PC (IPC) is widely used as not only Input/Output Controller (IOC) but also device controller. Besides industrial PC, PLC and microcontroller are also used as device controllers. The software for industrial PC based device controller is developed based on VxWorks real-time operating system. The software for PLC and microcontroller are written with ladder software package and assemble language, respectively. PC with Linux and SUN workstation with Solaris are used as operator interfaces (OPI). High level control is made up of some EPICS tools and Tcl/Tk scripts.

  3. Observation and analysis of self-amplified spontaneous emission at the APS low-energy undulator test line

    CERN Document Server

    Arnold, N D; Banks, G; Bechtold, R; Beczek, K; Benson, C; Berg, S; Berg, W; Biedron, S G; Biggs, J A; Boerste, K; Borland, M; Bosek, M; Brzowski, W R; Budz, J; Carwardine, J A; Castro, P; Chae, Y C; Christensen, S; Clark, C; Conde, M; Crosbie, E A; Decker, G A; Dejus, Roger J; Deleon, H; Den Hartog, P K; Deriy, B N; Dohan, D; Dombrowski, P; Donkers, D; Doose, C L; Dortwegt, R J; Edwards, G A; Eidelman, Y; Erdmann, M J; Error, J J; Ferry, R; Flood, R; Forrestal, J; Freund, H; Friedsam, H; Gagliano, J; Gai, W; Galayda, J N; Gerig, R; Gilmore, R L; Gluskin, E; Goeppner, G A; Goetzen, J; Gold, C; Grelick, A E; Hahne, M W; Hanuska, S; Harkay, K C; Harris, G; Hillman, A L; Hogrefe, R; Hoyt, J; Huang, Z; Jagger, J M; Jansma, W G; Jaski, M; Jones, S J; Keane, R T; Kelly, A L; Keyser, C; Kim, K J; Kim, S H; Kirshenbaum, M; Klick, J H; Knoerzer, K; Knott, M; Koldenhoven, R J; Labuda, S; Laird, R; Lang, J; Lenkszus, F R; Lessner, E S; Lewellen, J W; Li, Y; Lill, R M; Lumpkin, Alex H; Makarov, O A; Markovich, G M; McDowell, M; McDowell, W P; McNamara, P E; Meier, T; Meyer, D; Michalek, W; Milton, S V; Moe, H; Moog, E; Morrison, L; Nassiri, A; Noonan, J R; Otto, R; Pace, J; Pasky, S J; Penicka, J M; Pietryla, A F; Pile, G; Pitts, C; Power, J; Powers, T; Putnam, C C; Puttkammer, A J; Reigle, D; Reigle, L; Ronzhin, D; Rotela, E R; Russell, E F; Sajaev, Vadim; Sarkar, S; Scapino, J C; Schröder, K; Seglem, R A; Sereno, N S; Sharma, S K; Sidarous, J F; Singh, O; Smith, T L; Soliday, R; Sprau, G A; Stein, S J; Stejskal, B; Svirtun, V; Teng, L C; Theres, E; Thompson, K; Tieman, B J; Torres, J A; Trakhtenberg, E; Travish, G; Trento, G F; Vacca, J; Vasserman, I B; Vinokurov, N A; Walters, D R; Wang, J; Wang, X J; Warren, J; Wesling, S; Weyer, D L; Wiemerslage, G; Wilhelmi, K; Wright, R; Wyncott, D; Xu, S; Yang, B X; Yoder, W; Zabel, R B

    2001-01-01

    Exponential growth of self-amplified spontaneous emission at 530 nm was first experimentally observed at the Advanced Photon Source low-energy undulator test line in December 1999. Since then, further detailed measurements and analysis of the results have been made. Here, we present the measurements and compare these with calculations based on measured electron beam properties and theoretical expectations.

  4. Erratum: ``The Pure Rotational Line Emission of Ortho-Water Vapor in Comets. I. Radiative Transfer Model'' (ApJ, 615, 531 [2004])

    Science.gov (United States)

    Bensch, F.; Bergin, E. A.

    2007-04-01

    The comet model presented in the paper is based on the radiation transfer code ratran (M. R. Hogerheijde & F. F. S. van der Tak, ApJ, 615, 531 [2004]), an accelerated Monte Carlo code to calculate the line excitation and the emerging line intensities. For a given density profile, ratran determines the level population and, in a second step, calculates the spectral line emission for a given telescope beam, source distance, and velocity resolution. The numerical simulations for water-line emission in cometary coma show that the line excitation varies considerably on radii smaller than the projected telescope beam at the source distance for the models and telescope parameter considered in the paper. Thus, in our calculation, the water excitation in the second step was incorrectly sampled and the emission predictions were inexact, particularly for weak, optically thin lines.4 This problem also resulted from a limitation of the ratran version with respect to the spatial sampling of the intensity distribution for a convolution with a telescope beam. The relevant part of the ratran code was corrected by the authors with the May 2003 release of their software (F. F. S. van der Tak 2006, private communication). To correct this issue, we redid the numerical models presented in the original paper using the May 2003 release of the ratran software and made tests to ensure that the spatial intensity distribution used to calculate the emission detected by a given telescope beam is sampled with a sufficient spatial resolution. The corrected version of the radiation transfer model does not affect the first step, where the level population is calculated; however, the beam-averaged line intensities calculated from the level populations are generally lower than quoted in the original paper. The impact is moderate for the ground-state transitions and for the models with a water production rate of Q29=1 (M1, M6, M7), but can be substantial for the emission in weak comets and the H218O

  5. CSR effect at XFEL-to-storage ring beam transport line, SPring-8

    International Nuclear Information System (INIS)

    A 300-meter long beam transport line will be built from the XFEL C-band linac to the existing 8 GeV storage ring at the SPring-8. The beam transport line is supposed to deliver femtosecond electron bunches with high peak current, being composed of 14 bending magnets and quadrupoles. Current status of the transport line construction plan is briefly presented. Since Coherent Synchrotron Radiation (CSR) could degrade a beam quality in such a transport line with multiple bends, tracking simulation on the effect has been employed to analyze the effect in the transport line. As a result, it was found that the CSR effect would not be negligible unless some modification would be made to either an electron bunch distribution or a lattice of the beam transport line. The numerical result on the CSR effect as well as a proposal to compress femtosecond bunches by positively utilizing CSR effect is shown. (author)

  6. Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C

    International Nuclear Information System (INIS)

    The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines

  7. The Broad-Lined Type Ic SN 2012ap and the Nature of Relativistic Supernovae Lacking a Gamma-Ray Burst Detection

    Science.gov (United States)

    Milisavljevic, D.; Margutti, R.; Parrent, J. T.; Soderberg, A. M.; Fesen, R. A.; Mazzali, P.; Maeda, K.; Sanders, N. E.; Cenko, S. B.; Silverman, J. M.

    2014-01-01

    We present ultraviolet, optical, and near-infrared observations of SN2012ap, a broad-lined Type Ic supernova in the galaxy NGC 1729 that produced a relativistic and rapidly decelerating outflow without a gamma-ray burst signature. Photometry and spectroscopy follow the flux evolution from -13 to +272 days past the B-band maximum of -17.4 +/- 0.5 mag. The spectra are dominated by Fe II, O I, and Ca II absorption lines at ejecta velocities of v approx. 20,000 km s(exp. -1) that change slowly over time. Other spectral absorption lines are consistent with contributions from photospheric He I, and hydrogen may also be present at higher velocities (v approx. greater than 27,000 km s(exp. -1)). We use these observations to estimate explosion properties and derive a total ejecta mass of 2.7 Solar mass, a kinetic energy of 1.0×1052 erg, and a (56)Ni mass of 0.1-0.2 Solar mass. Nebular spectra (t > 200 d) exhibit an asymmetric double-peaked [O I] lambda lambda 6300, 6364 emission profile that we associate with absorption in the supernova interior, although toroidal ejecta geometry is an alternative explanation. SN2012ap joins SN2009bb as another exceptional supernova that shows evidence for a central engine (e.g., black-hole accretion or magnetar) capable of launching a non-negligible portion of ejecta to relativistic velocities without a coincident gamma-ray burst detection. Defining attributes of their progenitor systems may be related to notable properties including above-average environmental metallicities of Z approx. greater than Solar Z, moderate to high levels of host-galaxy extinction (E(B -V ) > 0.4 mag), detection of high-velocity helium at early epochs, and a high relative flux ratio of [Ca II]/[O I] > 1 at nebular epochs. These events support the notion that jet activity at various energy scales may be present in a wide range of supernovae.

  8. THE BROAD-LINED Type Ic SN 2012ap AND THE NATURE OF RELATIVISTIC SUPERNOVAE LACKING A GAMMA-RAY BURST DETECTION

    Energy Technology Data Exchange (ETDEWEB)

    Milisavljevic, D.; Margutti, R.; Parrent, J. T.; Soderberg, A. M.; Sanders, N. E.; Kamble, A.; Chakraborti, S.; Drout, M. R.; Kirshner, R. P. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fesen, R. A. [Department of Physics and Astronomy, Dartmouth College, 6127 Wilder Laboratory, Hanover, NH 03755 (United States); Mazzali, P. [Astrophysics Research Institute, Liverpool John Moores University, Liverpool L3 5RF (United Kingdom); Maeda, K. [Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Cenko, S. B. [Astrophysics Science Division, NASA Goddard Space Flight Center, Mail Code 661, Greenbelt, MD 20771 (United States); Silverman, J. M. [University of Texas at Austin, 1 University Station C1400, Austin, TX 78712-0259 (United States); Filippenko, A. V. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Pickering, T. E. [Southern African Large Telescope, P.O. Box 9, Observatory 7935, Cape Town (South Africa); Kawabata, K. [Hiroshima Astrophysical Science Center, Hiroshima University, Higashi-Hiroshima, Hiroshima 739-8526 (Japan); Hattori, T. [Subaru Telescope, National Astronomical Observatory of Japan, Hilo, HI 96720 (United States); Hsiao, E. Y. [Carnegie Observatories, Las Campanas Observatory, Colina El Pino, Casilla 601 (Chile); Stritzinger, M. D., E-mail: dmilisav@cfa.harvard.edu [Department of Physics and Astronomy, Aarhus University, Ny Munkegade, DK-8000 Aarhus C (Denmark); and others

    2015-01-20

    We present ultraviolet, optical, and near-infrared observations of SN 2012ap, a broad-lined Type Ic supernova in the galaxy NGC 1729 that produced a relativistic and rapidly decelerating outflow without a gamma-ray burst signature. Photometry and spectroscopy follow the flux evolution from –13 to +272 days past the B-band maximum of –17.4 ± 0.5 mag. The spectra are dominated by Fe II, O I, and Ca II absorption lines at ejecta velocities of v ≈ 20,000 km s{sup –1} that change slowly over time. Other spectral absorption lines are consistent with contributions from photospheric He I, and hydrogen may also be present at higher velocities (v ≳ 27,000 km s{sup –1}). We use these observations to estimate explosion properties and derive a total ejecta mass of ∼2.7 M {sub ☉}, a kinetic energy of ∼1.0 × 10{sup 52} erg, and a {sup 56}Ni mass of 0.1-0.2 M {sub ☉}. Nebular spectra (t > 200 days) exhibit an asymmetric double-peaked [O I] λλ6300, 6364 emission profile that we associate with absorption in the supernova interior, although toroidal ejecta geometry is an alternative explanation. SN 2012ap joins SN 2009bb as another exceptional supernova that shows evidence for a central engine (e.g., black hole accretion or magnetar) capable of launching a non-negligible portion of ejecta to relativistic velocities without a coincident gamma-ray burst detection. Defining attributes of their progenitor systems may be related to notable observed properties including environmental metallicities of Z ≳ Z {sub ☉}, moderate to high levels of host galaxy extinction (E(B – V) > 0.4 mag), detection of high-velocity helium at early epochs, and a high relative flux ratio of [Ca II]/[O I] >1 at nebular epochs. These events support the notion that jet activity at various energy scales may be present in a wide range of supernovae.

  9. Power supplies for IRFEL beam transport line magnets

    International Nuclear Information System (INIS)

    The Infrared Free Electron Laser (IRFEL) is being developed at RRCAT. Current regulated, dc power supplies are required for various electromagnets in its beam transport line. These are rated for 13 A and 15 V (maximum) with output current stability of ±100 ppm. In all, 60 power supplies have been developed, including the spare ones. In order to facilitate timely development of these power supplies, uniform power converter scheme for all power supplies has been followed and all associated low- power electronics, e.g. sensing, fault handling, auxiliary power sources, handling remote interface have been standardized. The topology used in these power supplies is two-switch forward converter operating with variable frequency PWM (VFPWM) control in the range from 20 kHz to 100 kHz. After the design, simulation studies, prototype development and rigorous testing of the prototype at RRCAT, the bulk production, testing and evaluation was carried out with the involvement of industry. This paper describes power supply design principles, highlights its salient features, shares the development experience and discusses the test results. (author)

  10. The expert system OPTRAN (Ver 1.0) and its application to beam transportation line design

    International Nuclear Information System (INIS)

    The expert system OPTRAN (Ver 1.0) used for beam transportation line design is introduced. The knowledge storage and reasoning principle, of which the intelligence part of OPTRAN are composed, have been described in detail. By using OPTRAN (Ver 1.0), the design of a beam transportation line for extracted ion beam of Cyclone 30 was completed

  11. Effects of Escherichia coli Challenge and Transport Stress on Hematology and Serum Chemistry Values of Three Genetic Lines of Turkeys

    Science.gov (United States)

    Males and females from 3 genetic lines of turkeys were compared for their response to an Escherichia coli airsac challenge followed by transport stress (Transport). The turkey lines were a slow growing line selected for increased egg production (Egg line), a fast growing line selected for increased...

  12. Transport line for beam generated by ITEP Bernas ion source

    International Nuclear Information System (INIS)

    A joint research and development program is underway to investigate beam transport systems for intense steady-state ion sources for ion implanters. Two energy extremes of MeV and hundreds of eV are investigated using a modified Bernas ion source with an indirectly heated cathode. Results are presented for simulations of electrostatic systems performed to investigate the transportation of ion beams over a wide mass range: boron to decaborane

  13. Error analysis in post linac to driver linac transport beam line of RAON

    Science.gov (United States)

    Kim, Chanmi; Kim, Eun-San

    2016-07-01

    We investigated the effects of magnet errors in the beam transport line connecting the post linac to the driver linac (P2DT) in the Rare Isotope Accelerator in Korea (RAON). The P2DT beam line is bent by 180-degree to send the radioactive Isotope Separation On-line (ISOL) beams accelerated in Linac-3 to Linac-2. This beam line transports beams with multi-charge state 132Sn45,46,47. The P2DT beam line includes 42 quadrupole, 4 dipole and 10 sextupole magnets. We evaluate the effects of errors on the trajectory of the beam by using the TRACK code, which includes the translational and the rotational errors of the quadrupole, dipole and sextupole magnets in the beam line. The purpose of this error analysis is to reduce the rate of beam loss in the P2DT beam line. The distorted beam trajectories can be corrected by using six correctors and seven monitors.

  14. Beam diagnostics and data acquisition system for ion beam transport line used in applied research

    International Nuclear Information System (INIS)

    Ion beam transport line for applied research on U-400 cyclotron, beam diagnostics and data acquisition system for condensed matter studies are described. The main features of Windows-based real time program are considered

  15. Contact sensitizer nickel sulfate activates the transcription factors NF-kB and AP-1 and increases the expression of nitric oxide synthase in a skin dendritic cell line

    OpenAIRE

    Cruz, M. Teresa; Gonçalo, Margarida; Figueiredo, Américo; Carvalho, Arsélio P.; Duarte, Carlos B.; Lopes, M. Celeste

    2004-01-01

    Nuclear factor kappa B (NF-kB) and activating protein-1 (AP-1) transcription factors are ubiquitously expressed signaling molecules known to regulate the transcription of a large number of genes involved in immune responses, namely the inducible isoform of nitric oxide synthase (iNOS). In this study, we demonstrate that a fetal skin-derived dendritic cell line (FSDC) produces nitric oxide (NO) in response to the contact sensitizer nickel sulfate (NiSO4) and increases the ...

  16. An automated system for measuring the mass flowrate of powders in transport lines

    Science.gov (United States)

    Littman, Howard; Morgan, Morris B., III; Prapas, Demetrios K.; Rubel, Glen O.

    1990-08-01

    A new automated particle transport (APT) system has been developed for studying the dissemination of bulk powders into deagglomerated aerosols. It consists of a 1.12-inch ID transport line with a spout-fluidized bed feeder. The particles are transported from an aerated annulus into the transport line and collected in a closed can or bag filter. Two separate feed lines supply the air necessary to operate the transport line and aerate the particles in order that they flow smoothly into the transport line. An IBM PC AT computer clone equipped with a data translation DT 2806 multifunction input-output board and A to D and D to A modules (DTX 311 and 328) is used for both control and data acquisition. A fluid mechanical model of the flow has been developed and the APT system will be used to verify it. Experiments will be conducted to measure the choking velocity, drag coefficient, fluid and particle flowrates, and pressure distribution in the line.

  17. CDK2-AP1基因过表达对乳腺癌MCF-7细胞增殖及周期的影响%Effect of CDK2-AP1 gene over-expression on proliferation and cell cycle regulation of breast cancer cell line MCF-7

    Institute of Scientific and Technical Information of China (English)

    关晓燕; 周卫兵; 黄隽; 王龙云; 廖遇平

    2012-01-01

    Objective: To over-express cyclin-dependent kinase 2-associated protein 1 (CDK2-AP1) gene, and investigate its effect on the proliferation and cell cycle regulation in breast cancer cell line MCF-7. Methods: CDK2-AP1 gene coding region was cloned into lentivirus vector. Lentivirus particles were infected into MCF-7 cells to upregulate the expression of CDK2-AP1 gene. The expression level of CDK2-AP1 was detected at both mRNA and protein levels by real-time PCR and Western blot. MTT assay, colony formatting assay, and flow cytometry were performed to detect the change of proliferation and cell cycle in MCF-7 cells. We examined the expression of cell cycle associated genes (CDK2, CDK4, P16Ink4A, and P2lCiP1/Wafl) followed by CDK2-AP1 over-expression by Western blot.Results: CDK2-AP1 gene was up-regulated significantly at both mRNA (6.94 folds) and protein level. MTT based growth curve, colony formatting assay and flow cytometry showed that CDK2- API over-expression lentivirus inhibited the proliferation of MCF-7 cells with statistical difference (P<0.05). In addition, with CDK2-AP1 over-expression, MCF-7 cells were arrested in G1 phase accompanied by apoptosis. Western blot showed that the expression level of P21Clpl/wafl and P16Int4A was upregulated, while the expression level of CDK2 and CDK4, members of the CDK family, was downregulated.Conclusion: CDK2-AP1 gene plays a cancer suppressor role in breast cancer. Its function includes inhibiting the proliferation of MCF-7 cells and arresting the cell cycle in G, phase.%目的:通过过表达手段上调细胞周期调节蛋白依赖性激酶2-关联蛋白1(CDK2-AP1)基因在乳腺癌细胞MCF-7中的表达,并观察其对MCF-7细胞生长和细胞周期调控的作用.方法:将CDK2-AP1基因的编码框构建于慢病毒表达载体,导入MCF-7细胞,应用实时定量PCR和Western印迹验证CDK2-AP1基因mRNA和蛋白的表达效率.利用MTT法绘制生长曲线、克隆形成实验观察CDK2-AP1

  18. Quasilinear Line Broadened Model for Energetic Particle Transport

    Science.gov (United States)

    Ghantous, Katy; Gorelenkov, Nikolai; Berk, Herbert

    2011-10-01

    We present a self-consistent quasi-linear model that describes wave-particle interaction in toroidal geometry and computes fast ion transport during TAE mode evolution. The model bridges the gap between single mode resonances, where it predicts the analytically expected saturation levels, and the case of multiple modes overlapping, where particles diffuse across phase space. Results are presented in the large aspect ratio limit where analytic expressions are used for Fourier harmonics of the power exchange between waves and particles, . Implemention of a more realistic mode structure calculated by NOVAK code are also presented. This work is funded by DOE contract DE-AC02-09CH11466.

  19. Computer control of 500 MeV beam transport line at KEK, (3)

    International Nuclear Information System (INIS)

    Tests for computer control of 500 MeV beam transport line of KEK proton synchrotron were done. Analog data of the beam transport magnets are taken by the satellite computer S-2, and the magnet currents are adjusted by the pulse train outputs from this computer. Data from profile monitors are taken by the satellite computer S-0 through a high-speed process input/output controller. These data are displayed on a graphic display terminal, and can see conditions of the beam transport line on the screen and adjust the magnet current by typing in the value to be set. (author)

  20. Spin- and valley-polarized transport across line defects in monolayer MoS2

    Science.gov (United States)

    Pulkin, Artem; Yazyev, Oleg V.

    2016-01-01

    We address the ballistic transmission of charge carriers across ordered line defects in monolayer transition metal dichalcogenides. Our study reveals the presence of a transport gap driven by spin-orbit interactions, spin and valley filtering, both stemming from a simple picture of spin and momentum conservation, as well as the electron-hole asymmetry of charge-carrier transmission. Electronic transport properties of experimentally observed ordered line defects in monolayer MoS2, in particular, the vacancy lines and inversion domain boundaries, are further investigated using first-principles Green's function methodology. Our calculations demonstrate the possibility of achieving nearly complete spin polarization of charge carriers in nanoelectronic devices based on engineered periodic line defects in monolayer transition metal dichalcogenides, thus suggesting a practical scheme for all-electric control of spin transport.

  1. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  2. APS Science 2007

    International Nuclear Information System (INIS)

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience

  3. The Booster Application Facility (BAF) Beam Transport Line of BNL-AGS Booster

    International Nuclear Information System (INIS)

    An experimental facility, to irradiate materials with energetic ion beams, has been proposed to be built at the Brookhaven National Laboratory. The BAF facility will mainly consist of the AGS-Booster slow extraction, of a beam transport line, and a target room. The beam transport line will transport the slow extracted beam of the AGS-Booster to the target location for the irradiation of various materials and specimens. A variety of ion beams like (p, 28Si, 56Fe, 63Cu, 197Au) in the energy range of 0.04 to 3.07 GeV/nucleon will be transported by the BAF line which is designed to provide variable beam spot sizes on the BAF target with sizes varying from 2.0 cm to 20.0 cm in diameter. The beam spot sizes will include 95% of the beam intensity with the beam distributed normally (Gaussian) on the target area. It is also possible by introducing magnetic octupoles at specified locations along the beam transport line, to modify the distribution on the BAF target and provide well confined beams with rectangular cross section and with uniform distribution on the target

  4. Enhancing the accelerated beam current in the booster synchrotron by optimizing the transport line beam propagation

    Indian Academy of Sciences (India)

    Saini R S; Tyagi Y; Ghodke A D; Puntambekar T A

    2016-04-01

    In this paper, we present the results of transverse beam emittance and twiss parameter measurement of an electron beam, delivered by a 20 MeV microtron which is used as a pre-injector system for a booster synchrotron in the Indus Accelerator Facility at RRCAT Indore. Based on these measured beam parameters, beam optics of a transport line was optimized and its results are alsodiscussed in this paper. This beam transport line is used to transport the electron beam from the 20MeV microtron to the booster synchrotron. The booster synchrotron works as a main injector for Indus-1 and Indus-2 synchrotron radiation facilities. To optimize the beam optics of a transport linefor proper beam transmission through the line as well as to match the beam twiss parameters at the beam injection point of another accelerator, it is necessary to know the transverse beam emittance and twiss parameters of the beam coming from the first one. A MATLAB-based GUI program has been developed to calculate the beam emittance and twiss parameters, using quadrupole scanmethod. The measured parameters have been used for beam transport line optimization and twiss parameters matching at booster injection point. After this optimization, an enhancement of ∼50% beam current has been observed in the booster synchrotron.

  5. High-Accuracy Spectral Lines for Radiation Transport in Stellar Atmospheres

    OpenAIRE

    Amit R. Sharma; Braams, Bastiaan J.; Bowman, Joel M.; Robert Warmbier; Ralf Schneider; Hauschildt, Peter H.

    2008-01-01

    The theory of radiative transfer is an important element for the understanding of the spectral signature and physical structure of stellar atmosphere. PHOENIX1 is a such, very general non-Local Thermodynamic Equilibrium(NLTE) stellar atmosphere computer code which can handle very large model atoms/molecules as well as line blanketing by hundreds of millions of atomic and molecular lines. The code is used to compute model atmospheres and synthetic spectra (solution of the radiative transport e...

  6. Contact sensitizer nickel sulfate activates the transcription factors NF-kB and AP-1 and increases the expression of nitric oxide synthase in a skin dendritic cell line

    OpenAIRE

    Cruz, MT; Gonçalo, Margarida; A. Figueiredo; Carvalho, AP; Duarte, CB

    2004-01-01

    Nuclear factor kappa B (NF-kB) and activating protein-1 (AP-1) transcription factors are ubiquitously expressed signaling molecules known to regulate the transcription of a large number of genes involved in immune responses, namely the inducible isoform of nitric oxide synthase (iNOS). In this study, we demonstrate that a fetal skin-derived dendritic cell line (FSDC) produces nitric oxide (NO) in response to the contact sensitizer nickel sulfate (NiSO(4)) and increases the expression of the i...

  7. 8 CFR 241.24 - Notice to transportation line of alien's exclusion.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's exclusion. 241.24 Section 241.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Deportation of Excluded Aliens (for...

  8. 8 CFR 241.9 - Notice to transportation line of alien's removal.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Notice to transportation line of alien's removal. 241.9 Section 241.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF ALIENS ORDERED REMOVED Post-hearing Detention and Removal §...

  9. The BY-2 Cell Line as a Tool to Study Auxin Transport

    Czech Academy of Sciences Publication Activity Database

    Petrášek, Jan; Zažímalová, Eva

    Vol. 58. Heidelberg: Springer-Verlag, 2006 - (Nagata, T.; Matsuoka, K.; Inzé, D.), s. 107-117 ISBN 3-540-32673-1 R&D Projects: GA AV ČR IAA6038303 Institutional research plan: CEZ:AV0Z50380511 Keywords : Auxin Transport * BY-2 Cell Line * cell membrane Subject RIV: ED - Physiology

  10. Postendocytic sorting of constitutively internalized dopamine transporter in cell lines and dopaminergic neurons

    DEFF Research Database (Denmark)

    Eriksen, Jacob; Bjørn-Yoshimoto, Walden Emil; Jørgensen, Trine Nygaard;

    2010-01-01

    lines, we fused the one-transmembrane segment protein Tac to DAT, thereby generating a transporter (TacDAT) with an extracellular antibody epitope suited for trafficking studies. TacDAT was functional and endocytosed constitutively in HEK293 cells. According to an ELISA-based assay, TacDAT intracellular...

  11. Transport and dosimetric solutions for the ELIMED laser-driven beam line

    Energy Technology Data Exchange (ETDEWEB)

    Cirrone, G.A.P. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Romano, F. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Medical Physics School, University of Catania, Via S. Sofia 64 - 95125 Catania (Italy); Scuderi, V. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, Na Slovance 2, 182 21 Prague (Czech Republic); Amato, A. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Candiano, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Medical Physics School, University of Catania, Via S. Sofia 64 - 95125 Catania (Italy); Cuttone, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Giove, D. [INFN Sezione di Milano, Via Celoria 16, Milano (Italy); Korn, G.; Krasa, J. [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, Na Slovance 2, 182 21 Prague (Czech Republic); Leanza, R. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Universitá degli Studi di Catania, Dipartimento di Fisica e Astronomia, Via S. Sofia 64, Catania (Italy); Manna, R. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Maggiore, M. [INFN-LNL, Viale dell' Universitá 2 - 35020 Legnaro (PD) (Italy); Marchese, V. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Margarone, D. [Institute of Physics ASCR, v.v.i. (FZU), ELI-Beamlines Project, Na Slovance 2, 182 21 Prague (Czech Republic); Milluzzo, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Universitá degli Studi di Catania, Dipartimento di Fisica e Astronomia, Via S. Sofia 64, Catania (Italy); Petringa, G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Sabini, M.G. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Azienda Ospedaliera Cannizzaro, Via Messina 829 - 95100 Catania (Italy); Schillaci, F. [INFN-LNS, Via S. Sofia 62 - 95125 Catania (Italy); Medical Physics School, University of Catania, Via S. Sofia 64 - 95125 Catania (Italy); and others

    2015-10-01

    Within 2017, the ELIMED (ELI-Beamlines MEDical applications) transport beam-line and dosimetric systems for laser-generated beams will be installed at the ELI-Beamlines facility in Prague (CZ), inside the ELIMAIA (ELI Multidisciplinary Applications of laser–Ion Acceleration) interaction room. The beam-line will be composed of two sections: one in vacuum, devoted to the collecting, focusing and energy selection of the primary beam and the second in air, where the ELIMED beam-line dosimetric devices will be located. This paper briefly describes the transport solutions that will be adopted together with the main dosimetric approaches. In particular, the description of an innovative Faraday Cup detector with its preliminary experimental tests will be reported.

  12. AP1000 status overview

    International Nuclear Information System (INIS)

    The AP1000 is a two-loop, 1000 MWe pressurized water reactor (PWR) with passive safety features and extensive plant simplifications to enhance the construction, operation, and maintenance. The AP1000 design is derived directly from the AP600, a two-loop, 600 MWe PWR. The AP600 uses proven technology, which builds on the over 30 years of operating PWR experience. The AP600 design received Final Design Approval from the U.S. NRC in September 1998 and Design Certification in December 1999. The AP600 meets all of the U.S. electric utility requirements including their cost goals. Although the AP600 is the most cost-effective plant ready for deployment, it is still more expensive than the $1000/kw needed to compete in the United States today In order to develop a cost competitive nuclear power plant Westinghouse has completed design studies which demonstrate that it is feasible to increase the power output of the AP600 to at least 1000 MWe, maintaining its current design configuration, use of proven components and licensing basis. In order to achieve these objectives the AP1000 has been designed within the space constraints of the AP600, while retaining the credibility of proven components and substantial safety margins. This paper describes the changes made to up-rate the AP600 and gives an overview of the plant design. It also summarizes the basis for the AP600 testing program and computer codes being sufficient for the AP1000. (authors)

  13. Investigation of oxygen impurity transport using the O4+ visible spectral line in the Aditya tokamak

    International Nuclear Information System (INIS)

    Intense visible lines from Be-like oxygen impurity are routinely observed in the Aditya tokamak. The spatial profile of brightness of a Be-like oxygen spectral line (2p3p 3D3–2p3d 3F4) at 650.024 nm is used to investigate oxygen impurity transport in typical discharges of the Aditya tokamak. A 1.0 m multi-track spectrometer (Czerny–Turner) capable of simultaneous measurements from eight lines of sight is used to obtain the radial profile of brightness of O4+ spectral emission. The emissivity profile of O4+ spectral emission is obtained from the spatial profile of brightness using an Abel-like matrix inversion. The oxygen transport coefficients are determined by reproducing the experimentally measured emissivity profiles of O4+, using a one-dimensional empirical impurity transport code, STRAHL. Much higher values of the diffusion coefficient compared with the neo-classical values are observed in both the high magnetic field edge region (Dinboardmax∼30 m2 s-1) and the low magnetic field edge region (Doutboardmax∼45 m2 s-1) of typical Aditya ohmic plasmas, which seems to be due to fluctuation-induced transport. The diffusion coefficient at the limiter radius in the low-field (outboard) region is typically ∼ twice as high as that at the limiter radius in the high-field (inboard) region. (paper)

  14. Railroad Lines - RAILROAD_100K_NTAD_IN: Railroad Network in Indiana (National Transportation Atlas Database, 1:100,000, Line Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — RAILROAD_NTAD_100K_SW is a 1:100,000 scale line shapefile which is a subset of the rail network. Bureau of Transportation Statistics metadata states - "The Rail...

  15. Noble internal transport barriers and radial subdiffusion of toroidal magnetic lines

    CERN Document Server

    Misguich, J H; Constantinescu, D H; Steinbrecher, G; Vlad, M; Spineanu, F; Weyssow, B; Balescu, R; Steinbrecher, Gy.

    2002-01-01

    Single trajectories of magnetic line motion indicate the persistence of a central protected plasma core, surrounded by a chaotic shell enclosed in a double-sided transport barrier : the latter is identified as being composed of two Cantori located on two successive "most-noble" numbers values of the perturbed safety factor, and forming an internal transport barrier (ITB). Magnetic lines which succeed to escape across this barrier begin to wander in a wide chaotic sea extending up to a very robust barrier (as long as L<1) which is identified mathematically as a robust KAM surface at the plasma edge. In this case the motion is shown to be intermittent, with long stages of pseudo-trapping in the chaotic shell, or of sticking around island remnants, as expected for a continuous time random walk.

  16. A Central Role for JNK/AP-1 Pathway in the Pro-Oxidant Effect of Pyrrolidine Dithiocarbamate through Superoxide Dismutase 1 Gene Repression and Reactive Oxygen Species Generation in Hematopoietic Human Cancer Cell Line U937

    Science.gov (United States)

    Collin, Pascal; Lomri, Abderrahim

    2015-01-01

    Pyrrolidine dithiocarbamate (PDTC) known as antioxidant and specific inhibitor of NF-κB was also described as pro-oxidant by inducing cell death and reactive oxygen species (ROS) accumulation in cancer. However, the mechanism by which PDTC indices its pro-oxidant effect is unknown. Therefore, we aimed to evaluate the effect of PDTC on the human Cu/Zn superoxide dismutase 1 (SOD1) gene transcription in hematopoietic human cancer cell line U937. We herein show for the first time that PDTC decreases SOD1 transcripts, protein and promoter activity. Furthermore, SOD1 repression by PDTC was associated with an increase in oxidative stress as evidenced by ROS production. Electrophoretic mobility-shift assays (EMSA) show that PDTC increased binding of activating protein-1 (AP-1) in dose dependent-manner suggesting that the MAPkinase up-stream of AP-1 is involved. Ectopic NF-κB p65 subunit overexpression had no effect on SOD1 transcription. In contrast, in the presence of JNK inhibitor (SP600125), p65 induced a marked increase of SOD1 promoter, suggesting that JNK pathway is up-stream of NF-κB signaling and controls negatively its activity. Indeed, using JNK deficient cells, PDTC effect was not observed nether on SOD1 transcription or enzymatic activity, nor on ROS production. Finally, PDTC represses SOD1 in U937 cells through JNK/c-Jun phosphorylation. Taken together, these results suggest that PDTC acts as pro-oxidant compound in JNK/AP-1 dependent-manner by repressing the superoxide dismutase 1 gene leading to intracellular ROS accumulation. PMID:25996379

  17. End Of Line: Combining Housing, Facilities and Transport Infrastructure in Brussels

    OpenAIRE

    De Clerck, Philippe; Moritz, Benoît; Stessens, Philippe

    2014-01-01

    This publication presents the results of the Brussels Master Class 2013 “End Of Line, Combining Housing, Facilities and Transport Infrastructure in Brussels”, organized from Oct. 28 to Nov. 8 by Louise (Laboratory for Urbanism, Infrastructure and Ecologies, Faculté d'Architecture de l'ULB) and Cosmopolis (Centre for Urban Research, VUB) with the support of the Secretary of State in charge of Urbanism for the Brussels-Capital Region. Architecture practice URA (BE) and consultancy agency Mobili...

  18. TNFalpha regulates sugar transporters in the human intestinal epithelial cell line Caco-2

    OpenAIRE

    Barrenetxe, J; Barber, A; Lostao, M P; Rodriguez-Yoldi, M.J. (M.J.); Gascon, S. (S.); Sanchez, O.

    2013-01-01

    PURPOSE: During intestinal inflammation TNFα levels are increased and as a consequence malabsorption of nutrients may occur. We have previously demonstrated that TNFα inhibits galactose, fructose and leucine intestinal absorption in animal models. In continuation with our work, the purpose of the present study was to investigate in the human intestinal epithelial cell line Caco-2, the effect of TNFα on sugar transport and to identify the intracellular mechanisms involved. METHODS: ...

  19. Doppler Imaging of Ap Stars

    OpenAIRE

    Kuschnig, R.

    1998-01-01

    Doppler imaging, a technique which inverts spectral line profile variations of an Ap star into a two-dimensional abundance maps, provides new observational constraints on diffusion mechanism in the presence of a global magnetic field. A programme is presented here with the aim to obtain abundance distributions of at least five elements on each star, in order to study how different diffusion processes act under influence of a stellar magnetic field. The importance of this multi-element approac...

  20. Computation of some transport theory expressions for a line source in an infinite half-space

    International Nuclear Information System (INIS)

    In a previous paper, Williams [Williams, M.M.R., 2007. The transport and diffusion theory of a line source in an infinite half-space with internal reflection. Ann. Nucl. Energy 34, 910-921] has obtained transport theory closed form expressions for the particle density for a problem in which a filamentary source is placed within a half-space, perpendicular to the surface (this 'line source' problem is closely related to the classical 'searchlight' problem of radiative transfer). Some numerical results for limiting cases (surface, z → 0), where the expressions reduce to a single integral were also reported. In this paper, we report additional numerical results for arbitrary internal positions in the medium by evaluating the closed form expressions which have required efficient and accurate evaluations of the generalized H function and subsequent two fold integrations. We have verified the accuracy of the techniques and the results through comparisons with both the limiting case (z → 0) reported in Williams [Williams, M.M.R., 2007. The transport and diffusion theory of a line source in an infinite half-space with internal reflection. Ann. Nucl. Energy 34, 910-921] and also independent results obtained by numerical solutions of the related integral equation via use of the singularity subtraction technique and quadratures. The present work should further aid in progress on related problems with Fresnel reflections and other complications, as well as to the validation of standard commercial reactor physics computer codes. For completeness, we should mention the recent book by Ganapol [Ganapol, B.D., 2008. Analytical benchmarks for nuclear engineering applications: case studies in transport theory, NEA, OECD] in which a number of three-dimensional transport problems are solved with special reference to acceleration techniques.

  1. Experimental determination of beam loss point in transport line-2 of Indus Accelerator Complex

    International Nuclear Information System (INIS)

    Radiation field in the Indus-1 SRS Experimental hall during 550 MeV electron beam injection into Transport Line-3 (TL-3)/Indus-2 was found to be higher than during 450 MeV beam injection to Transport line -2 (TL-2)/Indus-1. Experimental investigation was carried out to find out the location of beam loss. For the investigation, Ion chamber based detectors viz direct reading dosimeters (passive detectors) and beam loss monitors (active) were used. The beam loss point was observed near Sputter Ion Pump-5 (SIP-5) of TL-2, in Indus-1 area. The result was confirmed by induced activity profile measurements of the transport lines (TL-2/TL-3) during shut down. In order to reduce the radiation level in Indus-1 hall, two tenth value layers of lead shielding was put near TL2. Later on, correction in the beam optics by beam dynamics section reduced the beam losses at SIP-5 location, thereby reducing the radiation fields in Indus-1 hall substantially. The paper describes the measurement and the results in detail. (author)

  2. The AP-1A and AP-1B clathrin adaptor complexes define biochemically and functionally distinct membrane domains

    OpenAIRE

    Fölsch, Heike; Pypaert, Marc; Maday, Sandra; Pelletier, Laurence; Mellman, Ira

    2003-01-01

    Most epithelial cells contain two AP-1 clathrin adaptor complexes. AP-1A is ubiquitously expressed and involved in transport between the TGN and endosomes. AP-1B is expressed only in epithelia and mediates the polarized targeting of membrane proteins to the basolateral surface. Both AP-1 complexes are heterotetramers and differ only in their 50-kD μ1A or μ1B subunits. Here, we show that AP-1A and AP-1B, together with their respective cargoes, define physically and functionally distinct membra...

  3. The design of the public transport lines with the use of the fast genetic algorithm

    Directory of Open Access Journals (Sweden)

    Aleksander Król

    2015-09-01

    Full Text Available Background: The growing role of public transport and the pressure of economic criteria requires the new optimization tools for process of public transport planning. These problems are computationally very complex, thus it is preferable to use various approximate methods, leading to a good solution within an acceptable time. Methods: One of such method is the genetic algorithm mimicking the processes of evolution and natural selection in the nature. In this paper, the different variants of the public transport lines layout are subjected to the artificial selection. The essence of the proposed approach is a simplified method of calculating the value of the fit function for a single individual, which brings relatively short computation time even for large jobs. Results: It was shown that despite the introduced simplifications the quality of the results is not worsened. Using the data obtained from KZK GOP (Communications Municipal Association of Upper Silesian Industrial Region the described algorithm was used to optimize the layout of the network of bus lines located within the borders of Katowice. Conclusion: The proposed algorithm was applied to a real, very complex network of public transportation and a possibility of a significant improvement of its efficiency was indicated. The obtained results give hope that the presented model, after some improvements can be the basis of the scientific method, and in a consequence of a further development to find practical application.

  4. Transport line for a multi-staged laser-plasma acceleration: DACTOMUS

    Energy Technology Data Exchange (ETDEWEB)

    Chancé, Antoine, E-mail: antoine.chance@cea.fr [CEA, IRFU, SACM, Centre de Saclay, F-91191 Gif-sur-Yvette (France); Delferrière, Olivier; Schwindling, Jérôme [CEA, IRFU, SACM, Centre de Saclay, F-91191 Gif-sur-Yvette (France); Bruni, Christelle; Delerue, Nicolas [LAL, UMR9607, CNRS and Université Paris Sud, Orsay (France); Specka, Arnd [LLR, UMR7638, CNRS and Ecole Polytechnique, Palaiseau (France); Cros, Brgitte; Maynard, Gillies; Paradkar, Bhooshan S. [LPGP, UMR8578, CNRS and Université Paris Sud, Orsay (France); Mora, Patrick [CPhT, UMR7644, CNRS and Ecole Polytechnique, Palaiseau (France)

    2014-03-11

    Laser-plasma acceleration is one of the most promising techniques to reach very high acceleration gradients up to a few hundreds of GeV/m. In order to push this acceleration scheme in the domain of the very high energies, the CILEX project was launched with the laser APOLLON. One of the main topics of this project is to study multi-staged acceleration. It consists in generating and pre-accelerating electrons in a first laser-plasma stage, to transport them up to a second stage where the electrons are accelerated again thanks to another laser pulse. The DACTOMUS project, based on a collaboration CEA-IRFU, CEA-IRAMIS, LAL, LPGP, LULI and LLR, aims at the study and realization of such a transfer line between these two stages. Firstly, a prototype will be developed and tested by the groups of CEA-IRAMIS-SPAM, LPGP, and LULI on the UHI100 facility (CEA-SPAM). This collaboration must enable to realize the first acceleration stage. For the transport line prototype, the main difficulties are to realize a very compact and energy accepting line with diagnostics to characterize the electron beam. We will present here the optics of this line, its performances and the inserted diagnostics.

  5. Transport line for a multi-staged laser-plasma acceleration: DACTOMUS

    Science.gov (United States)

    Chancé, Antoine; Delferrière, Olivier; Schwindling, Jérôme; Bruni, Christelle; Delerue, Nicolas; Specka, Arnd; Cros, Brgitte; Maynard, Gillies; Paradkar, Bhooshan S.; Mora, Patrick

    2014-03-01

    Laser-plasma acceleration is one of the most promising techniques to reach very high acceleration gradients up to a few hundreds of GeV/m. In order to push this acceleration scheme in the domain of the very high energies, the CILEX project was launched with the laser APOLLON. One of the main topics of this project is to study multi-staged acceleration. It consists in generating and pre-accelerating electrons in a first laser-plasma stage, to transport them up to a second stage where the electrons are accelerated again thanks to another laser pulse. The DACTOMUS project, based on a collaboration CEA-IRFU, CEA-IRAMIS, LAL, LPGP, LULI and LLR, aims at the study and realization of such a transfer line between these two stages. Firstly, a prototype will be developed and tested by the groups of CEA-IRAMIS-SPAM, LPGP, and LULI on the UHI100 facility (CEA-SPAM). This collaboration must enable to realize the first acceleration stage. For the transport line prototype, the main difficulties are to realize a very compact and energy accepting line with diagnostics to characterize the electron beam. We will present here the optics of this line, its performances and the inserted diagnostics.

  6. An improved separability approximation for line radiative transport in nonhomogeneous media.

    Science.gov (United States)

    Boughner, R. E.

    1973-01-01

    A simple modification to the constant half-width approximation of Wilson and Greif, which is an extension of the well-known Curtis-Godson method to the treatment of temperature variations along the integration path, is introduced which permits a more accurate evaluation of line radiative transport in nonhomogeneous gases. To demonstrate the method's accuracy, comparisons are made with Wilson and Greif and numerical frequency integrated results for the line equivalent width and radiative flux in a planar slab with prescribed Planck function and line half-width spatial variations. These variations are chosen to represent typical shock layer conditions. It is found that the modified procedure reduces the inaccuracies inherent in Wilson and Greif's approximation by factors ranging from 5 to 10, while retaining the latter method's ease of application.

  7. Proliferation-dependent changes in amino acid transport and glucose metabolism in glioma cell lines

    International Nuclear Information System (INIS)

    Amino acid imaging is increasingly being used for assessment of brain tumor malignancy, extent of disease, and prognosis. This study explores the relationship between proliferative activity, amino acid transport, and glucose metabolism in three glioma cell lines (U87, Hs683, C6) at different phases of growth in culture. Growth phase was characterized by direct cell counting, proliferation index determined by flow cytometry, and [3H]thymidine (TdR) accumulation, and was compared with the uptake of two non-metabolized amino acids ([14C]aminocyclopentane carboxylic acid (ACPC) and [14C]aminoisobutyric acid (AIB)), and [18F]fluorodeoxyglucose (FDG). Highly significant relationships between cell number (density), proliferation index, and TdR accumulation rate were observed in all cell lines (r>0.99). Influx (K1) of both ACPC and AIB was directly related to cell density, and inversely related to the proliferation index and TdR accumulation in all cell lines. The volume of distribution (Vd) for ACPC and AIB was lowest during rapid growth and highest during the near-plateau growth phase in all cell lines. FDG accumulation in Hs683 and C6 cells was unaffected by proliferation rate, growth phase, and cell density, whereas FDG accumulation was correlated with TdR accumulation, growth phase, and cell density in U87 cells. This study demonstrates that proliferation rate and glucose metabolism are not necessarily co-related in all glioma cell lines. The values of K1 and Vd for ACPC and AIB under different growth conditions suggest that these tumor cell lines can up-regulate amino acid transporters in their cell membranes when their growth conditions become adverse and less than optimal. (orig.)

  8. FUZZY COMPREHENSIVE EVALUATION OF CONTAINER TRANSPORTATION MODES ALONG THE CHANGJIANG RIVER MAIN LINE AND ITS DELTA AREA

    Institute of Scientific and Technical Information of China (English)

    ZHANG Shi-yu; XIAO Han-liang

    2003-01-01

    The Changjiang River (Yangtze) is one of the fastest growth areas of container transportation in Chi-na. Rail, road and water transportation have competed against each other for container transportation in the Chang-jiang River main line and its delta area. It is of significance to assess these different transportation modes scientifi-cally in order to organize container transportation efficiently in this area and make decision for integral plan and construction of transportation system in this area. This paper outlines application of fuzzy comprehensive evaluation to appraise different modes of typical direction of containers. Twelve assessment indexes were decided. Membership functions were formulated. Evaluation results indicated that road transportation was optimal mode in the Changjiang River delta area, however water transportation was the primary way in the Changjiang River main line.

  9. Ectopic expression of FaesAP3, a Fagopyrum esculentum (Polygonaceae) AP3 orthologous gene rescues stamen development in an Arabidopsis ap3 mutant.

    Science.gov (United States)

    Fang, Zheng-wu; Qi, Rui; Li, Xiao-fang; Liu, Zhi-xiong

    2014-10-25

    Arabidopsis thaliana APETALA3 (AP3) and Antirrhinum majus DEFICIENS (DEF) MADS box genes are required to specify petal and stamen identity. AP3 and DEF are members of the euAP3 lineage, which arose by gene duplication coincident with radiation of the core eudicots. In order to investigate the molecular mechanisms underlying organ development in early diverging clades of core eudicots, we isolated and identified an AP3 homolog, FaesAP3, from Fagopyrum esculentum (buckwheat, Polygonaceae), a multi-food-use pseudocereal with healing benefits. Protein sequence alignment and phylogenetic analyses revealed that FaesAP3 grouped into the euAP3 lineage. Expression analysis showed that FaesAP3 was transcribed only in developing stamens, and differed from AP3 and DEF, which expressed in developing petals and stamens. Moreover, ectopic expression of FaesAP3 rescued stamen development without complementation of petal development in an Arabidopsis ap3 mutant. Our results suggest that FaesAP3 is involved in the development of stamens in buckwheat. These results also suggest that FaesAP3 holds some potential for biotechnical engineering to create a male sterile line of F. esculentum. PMID:25149019

  10. Poly(acrylic acid) coating induced 2-line ferrihydrite nanoparticle transport in saturated porous media

    International Nuclear Information System (INIS)

    Iron oxide and iron nanoparticles (NPs) have been used effectively for environmental remediation, but are limited in their applications by strong retention in groundwater-saturated porous media. For example, delivery of NPs to large groundwater reservoirs would require large numbers of injection wells. To address this problem, we have explored polymer coatings as a surface engineering strategy to enhance transport of oxide nanoparticles in porous media. We report here on our studies of 2-line ferrihydrite NPs and the influence of poly (acrylic acid) (PAA) polymer coatings on the colloidal stability and transport in natural sand-packed column tests simulating flow in groundwater-saturated porous media. Measurements were also made of zeta potential, hydrodynamic diameter, and polymer adsorption and desorption properties. The coated NPs have a diameter range of 30–500 nm. We found that NP transport was improved by PAA coating and that the transport properties could be tuned by adjusting the polymer concentration. Our results demonstrate that a high stability of oxide particles and improved transport can be achieved in groundwater-saturated porous media by introducing negatively charged polyelectrolytes and optimizing polymer concentrations

  11. Poly(acrylic acid) coating induced 2-line ferrihydrite nanoparticle transport in saturated porous media

    Energy Technology Data Exchange (ETDEWEB)

    Xiang, Aishuang [Princeton University, Chemical and Biological Engineering Department (United States); Yan, Weile [Texas Tech University, Civil and Environmental Engineering (United States); Koel, Bruce E., E-mail: bkoel@princeton.edu [Princeton University, Chemical and Biological Engineering Department (United States); Jaffe, Peter R., E-mail: jaffe@princeton.edu [Princeton University, Civil and Environmental Engineering Department (United States)

    2013-07-15

    Iron oxide and iron nanoparticles (NPs) have been used effectively for environmental remediation, but are limited in their applications by strong retention in groundwater-saturated porous media. For example, delivery of NPs to large groundwater reservoirs would require large numbers of injection wells. To address this problem, we have explored polymer coatings as a surface engineering strategy to enhance transport of oxide nanoparticles in porous media. We report here on our studies of 2-line ferrihydrite NPs and the influence of poly (acrylic acid) (PAA) polymer coatings on the colloidal stability and transport in natural sand-packed column tests simulating flow in groundwater-saturated porous media. Measurements were also made of zeta potential, hydrodynamic diameter, and polymer adsorption and desorption properties. The coated NPs have a diameter range of 30-500 nm. We found that NP transport was improved by PAA coating and that the transport properties could be tuned by adjusting the polymer concentration. Our results demonstrate that a high stability of oxide particles and improved transport can be achieved in groundwater-saturated porous media by introducing negatively charged polyelectrolytes and optimizing polymer concentrations.

  12. The AP1000 reactor

    International Nuclear Information System (INIS)

    The design of the AP1000 reactor began 20 years ago when Westinghouse launched the AP600 reactor project. In fact by re-assessing AP600's safety margins Westinghouse realized that the its power output could be raised without putting at risk its safety standard. The AP1000 was born, it yields 1100 MWe. The main AP1000's design features is its passive safety (particularly after the Fukushima accident) and its modularity. The passive safety of the AP1000 implies: -) no humane intervention needed for 72 hours at least after the incident; -) no necessity for redundant complex safety systems. The modularity means that the plant, the reactor and other buildings are constructed from a choice of 300 modular units. These units can be built off-site and fit together on site. The modularity allows more construction activities to be led simultaneously and more chances to cope with the construction schedule. The NRC has approved the operation license for 30 years of the first AP1000 being built in the Usa (Vogtle plant in Georgia). 4 AP1000 are being built in China (Sanmen and Haiyang sites) and 6 others are planned in the Usa. Westinghouse is convinced that the AP1000's passive safety makes it more attractive. Let us not forget that Westinghouse was at the origin of the concept of pressurized water reactors, an idea adopted for half the nuclear power stations in the world and for all the plants now active in France. (A.C.)

  13. Development of a transverse beam emittance and Twiss parameters measurement system for transport line-1

    International Nuclear Information System (INIS)

    Beam Transport Line-1 (TL-1) in Indus Accelerator Complex at Raja Ramanna Centre for Advanced Technology (RRCAT), Indore is being used to transport 20 MeV, 30 mA beam from the injector Microton exit point to the Booster Synchrotron where energy of electron beam is raised from 20 MeV to 450 MeV for injection into Indus-1 storage ring and 550 MeV to Indus-2 storage ring. It is important to measure the transverse beam emittance and Twiss parameters at Microton beam exit point for beam optics optimization in the transport line and to judge the beam quality. A transverse emittance and Twiss parameters measurement system using quadrupole scan method has been developed and tested. The system uses the electron beam images from the existing scintillator based beam profile monitor installed in TL-1 for beam size measurement. We have developed MATLAB codes that can extract transverse beam size and estimate transverse beam emittance. This paper describes the measurement method, software and some initial results obtained using this system. (author)

  14. Diffusive Heat Transport in Budyko's Energy Balance Climate Model with a Dynamic Ice Line

    CERN Document Server

    Walsh, James

    2016-01-01

    M. Budyko and W. Sellers independently introduced seminal energy balance climate models in 1969, each with a goal of investigating the role played by positive ice albedo feedback in climate dynamics. In this paper we replace the relaxation to the mean horizontal heat transport mechanism used in the models of Budyko and Sellers with diffusive heat transport. We couple the resulting surface temperature equation with an equation for movement of the edge of the ice sheet (called the ice line), recently introduced by E. Widiasih. We apply the spectral method to the temperature-ice line system and consider finite approximations. We prove there exists a stable equilibrium solution with a small ice cap, and an unstable equilibrium solution with a large ice cap, for a range of parameter values. If the diffusive transport is too efficient, however, the small ice cap disappears and an ice free Earth becomes a limiting state. In addition, we analyze a variant of the coupled diffusion equations appropriate as a model for ...

  15. On-line laser spectroscopy with a cooled He-jet transport system

    International Nuclear Information System (INIS)

    In order to make nuclear size and shape determinations for short-lived nuclei, we are using a transport system with pure, cooled helium to carry radioactive atoms produced by heavy-ion reactions from the target chamber into a laser-spectroscopy chamber. The device is attached to a beam line of the Argonne Superconducting Heavy-Ion Linac. Upon leaving the transport system, the atoms form a cooled atomic beam suitable for several high-sensitivity, high-precision spectroscopic techniques. We plan to use the photon-burst method which permits high-resolution hyperfine structure measurements with only a few atoms per second. The efficiency of the helium-jet system, the extension of the photon-burst method to slow and optically-pumped transitions, and the present status of the project are discussed

  16. Road and Street Centerlines - RAMPS_INDOT_IN: Ramp System in Indiana (Indiana Department of Transportation, Line Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — RAMPS_INDOT_IN is a line shapefile that contains all ramps in Indiana, provided by personnel of Indiana Department of Transportation (INDOT), Business Information...

  17. Line photon transport in a non-homogeneous plasma using radiative coupling coefficients

    Energy Technology Data Exchange (ETDEWEB)

    Florido, R.; Gil, J.M.; Rodriguez, R.; Rubiano, J.G.; Martel, P. [Las Palmas de Gran Canaria Univ., Dept. de Fisica (Spain); Florido, R.; Gil, J.M.; Rodriguez, R.; Rubiano, J.G.; Martel, P.; Minguez, E. [Madrid Univ. Politecnica, Instituto de Fusion Nuclear-DENIM (Spain)

    2006-06-15

    We present a steady-state collisional-radiative model for the calculation of level populations in non-homogeneous plasmas with planar geometry. The line photon transport is taken into account following an angle- and frequency-averaged escape probability model. Several models where the same approach has been used can be found in the literature, but the main difference between our model and those ones is that the details of geometry are exactly treated in the definition of coupling coefficients and a local profile is taken into account in each plasma cell. (authors)

  18. SCADA for microtron and beam transport line radio therapy machine subsystem

    International Nuclear Information System (INIS)

    Centre for Advanced Technology is developing a Radio Therapy Machine (RTM) to be used for cancer treatment. The radiotherapy machine has a Microtron consisting of a RF system, main and auxiliary magnets. It has a Beam transport line (BTL) consisting of fourteen magnets. This paper describes a PC based supervisory control and data acquisition system (SCADA) developed for controlling mainly the power supplies for the above sub systems from a remote location. It offers a graphic user interface (GUI) at the control room PC for RTM operation in engineering mode

  19. Survey and alignment of high energy physics accelerators and transport lines

    International Nuclear Information System (INIS)

    This talk summarizes the survey and alignment processes of accelerators and transport lines and discusses the propagation of errors associated with these processes. The major geodetic principles governing the survey and alignment measurement space are revisited and their relationship to a lattice coordinate system shown. The paper continues with a broad overview about the activities involved in the step by step sequence from initial absolute alignment to final smoothing. Emphasis is given to the relative alignment of components, in particular to the importance of incorporating methods to remove residual systematic effects in surveying and alignment operations

  20. Functional Coding Variation in Recombinant Inbred Mouse Lines Reveals Novel Serotonin Transporter-Associated Phenotypes

    Energy Technology Data Exchange (ETDEWEB)

    Carneiro, Ana [Vanderbilt University; Airey, David [University of Tennessee Health Science Center, Memphis; Thompson, Brent [Vanderbilt University; Zhu, C [Vanderbilt University; Rinchik, Eugene M [ORNL; Lu, Lu [University of Tennessee Health Science Center, Memphis; Chesler, Elissa J [ORNL; Erikson, Keith [University of North Carolina; Blakely, Randy [Vanderbilt University

    2009-01-01

    The human serotonin (5-hydroxytryptamine, 5-HT) transporter (hSERT, SLC6A4) figures prominently in the etiology or treatment of many prevalent neurobehavioral disorders including anxiety, alcoholism, depression, autism and obsessive-compulsive disorder (OCD). Here we utilize naturally occurring polymorphisms in recombinant inbred (RI) lines to identify novel phenotypes associated with altered SERT function. The widely used mouse strain C57BL/6J, harbors a SERT haplotype defined by two nonsynonymous coding variants (Gly39 and Lys152 (GK)). At these positions, many other mouse lines, including DBA/2J, encode Glu39 and Arg152 (ER haplotype), assignments found also in hSERT. Synaptosomal 5-HT transport studies revealed reduced uptake associated with the GK variant. Heterologous expression studies confirmed a reduced SERT turnover rate for the GK variant. Experimental and in silico approaches using RI lines (C57Bl/6J X DBA/2J=BXD) identifies multiple anatomical, biochemical and behavioral phenotypes specifically impacted by GK/ER variation. Among our findings are multiple traits associated with anxiety and alcohol consumption, as well as of the control of dopamine (DA) signaling. Further bioinformatic analysis of BXD phenotypes, combined with biochemical evaluation of SERT knockout mice, nominates SERT-dependent 5-HT signaling as a major determinant of midbrain iron homeostasis that, in turn, dictates ironregulated DA phenotypes. Our studies provide a novel example of the power of coordinated in vitro, in vivo and in silico approaches using murine RI lines to elucidate and quantify the system-level impact of gene variation.

  1. Dietary and Developmental Regulation of Nutrient Transporter Gene Expression in the Small Intestine of Two Lines of Broilers

    OpenAIRE

    Gilbert, Elizabeth Ruth

    2008-01-01

    To better understand the digestive and absorptive capacities of the chick intestine so that we may feed diets that better meet the nutritional needs of the chick, it is important to understand how expression of nutrient transporter genes changes in response to various factors. A series of feeding trials were conducted to evaluate the dietary and developmental regulation of nutrient transporter mRNA abundance in the small intestine of two lines of broilers selected on corn-based (Line A) or wh...

  2. Characterization of a murine renal distal convoluted tubule cell line for the study of transcellular calcium transport

    NARCIS (Netherlands)

    Diepens, R.J.W.; Dekker, E. den; Bens, M.; Weidema, A.F.; Walle, A. van de; Bindels, R.J.M.; Hoenderop, J.G.J.

    2004-01-01

    To unravel the molecular regulation of renal transcellular Ca(2+) transport, a murine distal convoluted tubule (mpkDCT) cell line derived from distal convoluted tubules (DCT) microdissected from a SV-PK/Tag transgenic mouse was characterized. This cell line originated from DCT only, as mRNA encoding

  3. Noble internal transport barriers and radial subdiffusion of toroidal magnetic lines

    Energy Technology Data Exchange (ETDEWEB)

    Misguich, J.H.; Reuss, J.D. [Association Euratom-CEA sur la Fusion, CEA/DSM/DRFC, 13 - Saint Paul lez Durance (France); Constantinescu, D.; Steinbrecher, G. [Association Euratom-N.A.S.T.I., Dept. of Physics, University of Craiova (Romania); Vlad, M.; Spineanu, F. [Association Euratom-N.A.S.T.I., National Institute of Laser, Plasma and Radiation Physics, Bucharest (Romania); Weyssow, B.; Balescu, R. [Association Euratom-Etat Belge sur la Fusion, Universite Libre de Bruxelles (Belgium)

    2002-02-01

    Internal transport barriers (ITB's) observed in tokamaks are described by a purely magnetic approach. Magnetic line motion in toroidal geometry with broken magnetic surfaces is studied from a previously derived Hamiltonian map in situation of incomplete chaos. This appears to reproduce in a realistic way the main features of a tokamak, for a given safety factor profile and in terms of a single parameter L representing the amplitude of the magnetic perturbation. New results are given concerning the Shafranov shift as function of L. For small values of L, closed magnetic surfaces exist (KAM tori) and island chains begin to appear on rational surfaces for higher values of L, with chaotic zones around hyperbolic points, as expected. Single trajectories of magnetic line motion indicate the persistence of a central protected plasma core, surrounded by a chaotic shell enclosed in a double-sided transport barrier. Magnetic lines which succeed to escape across this barrier begin to wander in a wide chaotic sea extending up to a very robust barrier (as long as L{<=}1). For values of L{>=}1, above the escape threshold, most magnetic lines succeed to escape out of the external barrier which has become a permeable Cantorus. Statistical analysis of a large number of trajectories, representing the evolution of a bunch of magnetic lines, indicate that the flux variable {psi} asymptotically grows in a diffuse manner as (L{sup 2}t) with a L{sup 2} scaling as expected, but that the average radial position r{sub m}(t) asymptotically grows as (L{sup 2}t){sup 1/4} while the mean square displacement around this average radius asymptotically grows in a sub-diffusive manner as (L{sup 2}t){sup 1/2}. This result shows the slower dispersion in the present incomplete chaotic regime, which is different from the usual quasilinear diffusion in completely chaotic situations. For physical times t{sub {phi}} of the order of the escape time defined by x{sub m}(t{sub {phi}}) {approx}1, the motion

  4. Noble internal transport barriers and radial subdiffusion of toroidal magnetic lines

    International Nuclear Information System (INIS)

    Internal transport barriers (ITB's) observed in tokamaks are described by a purely magnetic approach. Magnetic line motion in toroidal geometry with broken magnetic surfaces is studied from a previously derived Hamiltonian map in situation of incomplete chaos. This appears to reproduce in a realistic way the main features of a tokamak, for a given safety factor profile and in terms of a single parameter L representing the amplitude of the magnetic perturbation. New results are given concerning the Shafranov shift as function of L. For small values of L, closed magnetic surfaces exist (KAM tori) and island chains begin to appear on rational surfaces for higher values of L, with chaotic zones around hyperbolic points, as expected. Single trajectories of magnetic line motion indicate the persistence of a central protected plasma core, surrounded by a chaotic shell enclosed in a double-sided transport barrier. Magnetic lines which succeed to escape across this barrier begin to wander in a wide chaotic sea extending up to a very robust barrier (as long as L≤1). For values of L≥1, above the escape threshold, most magnetic lines succeed to escape out of the external barrier which has become a permeable Cantorus. Statistical analysis of a large number of trajectories, representing the evolution of a bunch of magnetic lines, indicate that the flux variable ψ asymptotically grows in a diffuse manner as (L2t) with a L2 scaling as expected, but that the average radial position rm(t) asymptotically grows as (L2t)1/4 while the mean square displacement around this average radius asymptotically grows in a sub-diffusive manner as (L2t)1/2. This result shows the slower dispersion in the present incomplete chaotic regime, which is different from the usual quasilinear diffusion in completely chaotic situations. For physical times tφ of the order of the escape time defined by xm(tφ) ∼1, the motion appears to be super-diffusive, however, but less dangerous than the generally

  5. In vitro evaluation on pharmacokinetics using a cell line expressing human renal transporters

    Institute of Scientific and Technical Information of China (English)

    HuanXL; EndoH

    2002-01-01

    To maintain the normal physiological ionic environment,renal transporters specialize in removing waste materials,such as toxic substances,drugs and other organic cations and anions from the blood in a process of renal secretion.The purpose of this study was focused on characterizing molecular mechanisms and pharmacokinetics in renal elimination of various compounds.In this study,the development of the proximal tubule cell (S2 cell) lines stably expressing human organicanion (hOAT1,hOAT2,hOAT3 and hOAT4) and cation (hOCT1 and hOCT2) transporters were established and specific affinity of transporter for drugs is being clarified.The drug interaction between various drugs will be evaluated by measuring time- and concentration-dependent uptake and providing an exact Km and Ki value.In this presentation,the study methodology and its application using model compounds such as [3H] riboflavin,[3H] diazepam and [3H] clonidine will be shown.

  6. Electron cyclotron resonance heating for controlling potential and transport along open field lines

    International Nuclear Information System (INIS)

    The transport of particles and energy in plasma along magnetic field lines is a matter of great interest in connection with divector operation in tori as well as in tandem mirror confinement. The contribution of electron cyclotron resonance heating (ECRH) has been recognized in heating and in controlling plasma transport. Mirror reflection is not enough to reduce the influx of colder electrons if the mirror ratio is not large or if the colder species is accelerated by potential difference. A new role of ECRH has been proposed in a concept of thermal dike as a means to enhance the mirror reflection of colder electrons by increasing their pitch angle. In this paper, the requirements to ECRH are discussed based on the analysis of single particle dynamics in an open magnetic field. A scenario of the basic experiment on the thermal dike on the GAMMA10 tandem mirror is described. The particle transport in magnetic and potential configurations is considered. The power loss reduction by thermal dike is explained. In the basic experiment program of thermal dike on GAMMA10, it can be expected to observe the clear effect of thermal dike. The wave-launching system for thermal dike is described. (K.I.)

  7. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  8. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  9. The effects of magnetic fringe fields on beam dynamics in a beam transport line of a terahertz FEL source

    Energy Technology Data Exchange (ETDEWEB)

    Zeng, Han [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, Huazhong University of Science and Technology, Wuhan 430074, Hubei (China); Xiong, Yongqian, E-mail: yqxiong@mail.hust.edu.cn [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, Huazhong University of Science and Technology, Wuhan 430074, Hubei (China); Pei, Yuanji [National Synchrotron Radiation laboratory, University of Science and Technology of China, Hefei 230029, Anhui (China)

    2014-11-11

    The transport line used in a terahertz FEL device has to transport electron beam through the entire system efficiently and meet the requirements of the beam parameters at the undulator entrance. Due to space limitations, the size of the magnets (five quadrupoles and two bending magnets) employed in the transport line was limited, and some devices were densely packed. In this paper, analyses of the effect of fringe fields and magnetic interference of magnets are presented. 3D models of these magnets are built and their linear optical properties are compared with those obtained by hard edge models. The results indicated that the effects of these factors are significant and they would cause a mismatch of the beam at the exit of the transport line under the preliminary lattice design. To solve this problem, the beam was re-matched using the particle swarm optimization algorithm.

  10. Características histomorfométricas do intestino de juvenis de tambaqui após uso de probiótico na dieta e durante transporte

    Directory of Open Access Journals (Sweden)

    Celma M. Ferreira

    2014-12-01

    Full Text Available Avaliou-se neste trabalho as características histomorfométricas da mucosa intestinal de tambaqui após uso de probiótico a base de Bacillus spp., veiculado na ração e dissolvido na água durante transporte. Foi utilizado um delineamento inteiramente casualizado com três tratamentos e sete repetições, sendo comparado um tratamento controle (peixes alimentados com ração comercial sem probiótico a dois outros tratamentos envolvendo o uso de probiótico comercial, veiculado na ração ou na água de transporte. Um total de 510 juvenis de tambaqui (peso e comprimento total médio inicial de 83,26±28,14g e 17,39±1,90cm, respectivamente foi distribuído em três tanques de alvenaria. Durante 60 dias, os peixes de dois tanques foram alimentados com ração comercial e os do terceiro tanque com ração comercial suplementada com probiótico. Após este período, os peixes de cada tanque foram divididos em sacos plásticos e transportados por 4 horas de acordo com os seguintes tratamentos: T1 = alimentação com ração comercial (controle; T2 = alimentação com ração comercial e probiótico adicionado na água durante o transporte (20mg/L; T3 = alimentação com ração comercial suplementada com probiótico (1,0g/kg de ração. Antes do transporte (basal, 24 e 96 horas após o transporte, oito peixes de cada tratamento foram submetidos a eutanásia e o intestino retirado para pesagem e mensuração do comprimento para estabelecimento da relação comprimento corporal/ intestino. Em seguida, foi realizada coleta da porção anterior e posterior do intestino, para avaliação das características morfo-histológicas da mucosa intestinal. O uso de probiótico durante o transporte não afetou o peso do intestino de juvenis de tambaqui. O comprimento do intestino do tambaqui não foi alterado pelo tratamento, sendo observada somente relação linear entre o comprimento intestinal e o comprimento corporal (CC dos peixes. A suplementação com

  11. Quantitative assessment of direct and indirect landslide risk along transportation lines in southern India

    Directory of Open Access Journals (Sweden)

    P. Jaiswal

    2010-06-01

    Full Text Available A quantitative approach for landslide risk assessment along transportation lines is presented and applied to a road and a railway alignment in the Nilgiri hills in southern India. The method allows estimating direct risk affecting the alignments, vehicles and people, and indirect risk resulting from the disruption of economic activities. The data required for the risk estimation were obtained from historical records. A total of 901 landslides were catalogued initiating from cut slopes along the railway and road alignment. The landslides were grouped into three magnitude classes based on the landslide type, volume, scar depth, run-out distance, etc and their probability of occurrence was obtained using frequency-volume distribution. Hazard, for a given return period, expressed as the number of landslides of a given magnitude class per kilometre of cut slopes, was obtained using Gumbel distribution and probability of landslide magnitude. In total 18 specific hazard scenarios were generated using the three magnitude classes and six return periods (1, 3, 5, 15, 25, and 50 years. The assessment of the vulnerability of the road and railway line was based on damage records whereas the vulnerability of different types of vehicles and people was subjectively assessed based on limited historic incidents. Direct specific loss for the alignments (railway line and road, vehicles (train, bus, lorry, car and motorbike was expressed in monetary value (US$, and direct specific loss of life of commuters was expressed in annual probability of death. Indirect specific loss (US$ derived from the traffic interruption was evaluated considering alternative driving routes, and includes losses resulting from additional fuel consumption, additional travel cost, loss of income to the local business, and loss of revenue to the railway department. The results indicate that the total loss, including both direct and indirect loss, from 1 to 50 years return period, varies from

  12. APS Science 2009

    International Nuclear Information System (INIS)

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report), the challenge

  13. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  14. Line width dependence of transport properties in graphene nanoribbon interconnects with real space edge roughness determined by Monte Carlo method

    International Nuclear Information System (INIS)

    We developed a novel Monte Carlo simulation model to investigate the line width dependence of the transport properties of multi-layered graphene nanoribbon (GNR) interconnects with edge roughness. We reported that the line width dependence of carrier mobility decreases significantly as the magnitude of the edge roughness gets smaller, which agrees well with experiments. We also discussed the influence of the inelasticity of edge roughness scatterings, inter-layer tunneling, and line width dependent band structures on the line width of the GNR interconnects. (author)

  15. Quality control and patient dosimetry in digital radiology. On line system: New features and transportability

    International Nuclear Information System (INIS)

    New features have been added to a system (QCONLINE) for auditing patient dosimetric and technical parameters 'on line', working on a digital radiology department and using the information contained in the DICOM header of some modalities. The audit of other parameters than patient doses have been included, setting alarm conditions to alert on malfunction of the X-ray system or bad operation modes, in addition to the evaluation of patient doses. A new module to analyse, collect and process the relevant information transferred by the modality performed procedure step (MPPS) service has been launched. Several examples with the exploitation of the new features are presented. The transportability of the system has been tested in two remote hospitals during several months. The new MPPS module has demonstrated to be a good tool to complement the information existing in the DICOM header. The system allows to help in the optimisation of digital radiology departments managing patient dosimetry and procedure data in real time. (authors)

  16. Lattice design of medium energy beam transport line for n spallation neutron source

    International Nuclear Information System (INIS)

    A 1 GeV H- injector linac is being designed at RRCAT for the proposed Indian Spallation Neutron Source (ISNS). The front-end of the injector linac will consist of Radiofrequency Quadrupole (RFQ) linac, which will accelerate the H- beam from 50 keV to 3 MeV. The beam will be further accelerated in superconducting Single Spoke Resonators (SSRs). A Medium Energy Beam Transport (MEBT) line will be used to transport the beam from the exit of RFQ to the input of SSR. The main purpose of MEBT is to carry out beam matching from RFQ to SSR, and beam chopping. In this paper, we describe the optimization criteria for the lattice design of MEBT. The optimized lattice element parameters are presented for zero and full (15 mA) current case. Beam dynamics studies have been carried out using an envelope tracing code Trace-3D. Required beam deflection angle due to the chopper housed inside the MEBT for beam chopping has also been estimated. (author)

  17. Analysis of the proton beam in the DESY transport lines by video readout

    CERN Document Server

    Solodovnik, F; Wittenburg, K

    2000-01-01

    Injection efficiency, beam optic matching and emittance preservation are very important parameters in achieving a high luminosity in large proton accelerators. We improved the analysing system of the phosphor screen readout of the proton transport lines in the accelerator chain of HERA with respect to the parameters above. The screens are read out by simple CCD video cameras. The signals are stored in local frame grabbers. An analogue output of the stored image is multiplexed and read-out by a fast PCI frame grabber card in a PC. The beam orbit and the beam emittance can be measured from each screen. A Visual Basic program is used to displays the trajectory and the envelope of the beam from a single transfer. The same program helps to drive bumps to achieve a proper steering through the line. The beam width can be measured from selected screens to calculate the emittance and other beam parameters including their errors. The read out and analysing system will be described and measurements will be shown.

  18. Adaptor protein complexes and intracellular transport

    OpenAIRE

    2014-01-01

    The AP (adaptor protein) complexes are heterotetrameric protein complexes that mediate intracellular membrane trafficking along endocytic and secretory transport pathways. There are five different AP complexes: AP-1, AP-2 and AP-3 are clathrin-associated complexes; whereas AP-4 and AP-5 are not. These five AP complexes localize to different intracellular compartments and mediate membrane trafficking in distinct pathways. They recognize and concentrate cargo proteins into vesicular carriers th...

  19. LINES

    Directory of Open Access Journals (Sweden)

    Minas Bakalchev

    2015-10-01

    Full Text Available The perception of elements in a system often creates their interdependence, interconditionality, and suppression. The lines from a basic geometrical element have become the model of a reductive world based on isolation according to certain criteria such as function, structure, and social organization. Their traces are experienced in the contemporary world as fragments or ruins of a system of domination of an assumed hierarchical unity. How can one release oneself from such dependence or determinism? How can the lines become less “systematic” and forms more autonomous, and less reductive? How is a form released from modernistic determinism on the new controversial ground? How can these elements or forms of representation become forms of action in the present complex world? In this paper, the meaning of lines through the ideas of Le Corbusier, Leonidov, Picasso, and Hitchcock is presented. Spatial research was made through a series of examples arising from the projects of the architectural studio “Residential Transformations”, which was a backbone for mapping the possibilities ranging from playfulness to exactness, as tactics of transformation in the different contexts of the contemporary world.

  20. Parametric study of transport beam lines for electron beams accelerated by laser-plasma interaction

    Science.gov (United States)

    Scisciò, M.; Lancia, L.; Migliorati, M.; Mostacci, A.; Palumbo, L.; Papaphilippou, Y.; Antici, P.

    2016-03-01

    In the last decade, laser-plasma acceleration of high-energy electrons has attracted strong attention in different fields. Electrons with maximum energies in the GeV range can be laser-accelerated within a few cm using multi-hundreds terawatt (TW) lasers, yielding to very high beam currents at the source (electron bunches with up to tens-hundreds of pC in a few fs). While initially the challenge was to increase the maximum achievable electron energy, today strong effort is put in the control and usability of these laser-generated beams that still lack of some features in order to be used for applications where currently conventional, radio-frequency (RF) based, electron beam lines represent the most common and efficient solution. Several improvements have been suggested for this purpose, some of them acting directly on the plasma source, some using beam shaping tools located downstream. Concerning the latter, several studies have suggested the use of conventional accelerator magnetic devices (such as quadrupoles and solenoids) as an easy implementable solution when the laser-plasma accelerated beam requires optimization. In this paper, we report on a parametric study related to the transport of electron beams accelerated by laser-plasma interaction, using conventional accelerator elements and tools. We focus on both, high energy electron beams in the GeV range, as produced on petawatt (PW) class laser systems, and on lower energy electron beams in the hundreds of MeV range, as nowadays routinely obtained on commercially available multi-hundred TW laser systems. For both scenarios, our study allows understanding what are the crucial parameters that enable laser-plasma accelerators to compete with conventional ones and allow for a beam transport. We show that suitable working points require a tradeoff-combination between low beam divergence and narrow energy spread.

  1. Correlation of CDK2-AP1 gene over-expression with proliferation and cell cycle regulation of breast cancer cell line MCF-7%乳腺癌MCF-7细胞的增殖及周期与CDK2-AP1基因的表达的相关性研究

    Institute of Scientific and Technical Information of China (English)

    高双全; 高双荣; 肖高芳; 丁宇; 王林辉; 黄伟; 李静

    2013-01-01

    目的 探讨乳腺癌MCF-7细胞的增殖及周期与CDK2-AP1基因的表达的相关性研究,为临床乳腺癌的分子治疗提供基础.方法 取我院研究所保存的人乳腺癌细胞MCF-7进行培养,并构建CDK2-AP1基因编码的病毒表达载体,应用实时定量PCR验证CDK2-AP1基因mRNA和蛋白的表达率.利用流式细胞仪检测MCF-7细胞周期的改变.结果 过表达CDK2-AP1基因的慢病毒感染MCF-7细胞可上调其mRNA表达6.87倍.MCF-7细胞过表达CDK2-AP1基因后,增殖能力显著降低,差异具有统计学意义(P<0.05).流式细胞仪检测证实MCF-7细胞过表达CDK2-AP1能够使细胞周期出现G1期阻滞.结论 CDK2-AP1基因具有抑癌基因的功能,在乳腺癌MCF-7细胞过表达该基因能够抑制细胞的生长和克隆形成能力,并且使细胞阻滞于G1期.

  2. An alternatively spliced mRNA from the AP-2 gene encodes a negative regulator of transcriptional activation by AP-2.

    OpenAIRE

    Buettner, R; Kannan, P; Imhof, A.; Bauer, R.; Yim, S O; Glockshuber, R; Van Dyke, M W; Tainsky, M A

    1993-01-01

    AP-2 is a retinoic acid-inducible and developmentally regulated activator of transcription. We have cloned an alternative AP-2 transcript (AP-2B) from the human teratocarcinoma cell line PA-1, which encodes a protein differing in the C terminus from the previously isolated AP-2 protein (AP-2A). This protein contains the activation domain of AP-2 and part of the DNA binding domain but lacks the dimerization domain which is necessary for DNA binding. Analysis of overlapping genomic clones spann...

  3. Characterization of a mutation and an alternative splicing of UDP-galactose transporter in MDCK-RCAr cell line.

    Science.gov (United States)

    Olczak, Mariusz; Guillen, Eduardo

    2006-01-01

    The UDP-galactose (UDP-Gal) transporter present in the Golgi apparatus is a member of a transporter family comprising hydrophobic proteins with multiple transmembrane domains. Co-immunoprecipitation experiments showed that the full-length UDP-Gal transporter protein forms oligomeric structures in the MDCK cell. A ricin-resistant mutant of the MDCK cell line (MDCK-RCA(r)) is deficient in galactose linked to macromolecules because of a lower UDP-Gal transport rate into the Golgi apparatus. We cloned this mutated protein and found that it contains a stop codon close to the 5' terminus of its open reading frame. We also detected a shorter splicing variant of the UDP-Gal transporter which contains a 183-nt in-frame deletion in both the wild-type and the mutant mRNA. We showed that the protein, when overexpressed, is localized in the Golgi apparatus and could partially correct the phenotype of the MDCK-RCA(r) and CHO-Lec8 mutant cell lines. The level of mRNA of the UDP-Gal transporter is much lower (25-30 copies per cell) than those of the CMP-sialic acid transporter (100 copies per cell), UDP-N-acetylglucosamine transporter (80 copies per cell), and GDP-fucose transporter (65 copies per cell). The transcript level of the shorter splicing variant of the UDP-Gal transporter is extremely rare in wild-type MDCK cells (a few copies per cell), but it is significantly increased in the mutant, RCA-resistant cells. PMID:16434112

  4. Effects of line defects on spin-dependent electronic transport of zigzag MoS2 nanoribbons

    International Nuclear Information System (INIS)

    The nonlinear spin-dependent transport properties in zigzag molybdenum-disulfide nanoribbons (ZMNRs) with line defects are investigated systematically using nonequilibrium Green’s function method combined with density functional theory. The results show that the line defects can enhance the electronic transfer ability of ZMNRs. The types and locations of the line defects are found critical in determining the spin polarization and the current-voltage (I-V) characteristics of the line defected ZMNRs. For the same defect type, the total currents of the ribbons with the line defects in the centers are lager than those on the edges. And for the same location, the total currents of the systems with the sulfur (S) line defect are larger than the according systems with the molybdenum (Mo) line defect. All the considered systems present magnetism properties. And in the S line defected systems, the spin reversal behaviors can be observed. In both the spin-up and spin-down states of the Mo line defected systems, there are obvious negative differential resistance behaviors. The mechanisms are proposed for these phenomena

  5. Effects of line defects on spin-dependent electronic transport of zigzag MoS{sub 2} nanoribbons

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xin-Mei; Yang, Kai-Wei; Zhang, Dan; Ding, Jia-Feng; Xu, Hui, E-mail: xuhui@csu.edu.cn [Institute of Super-microstructure and Ultrafast Process in Advanced Materials & Hunan Key Laboratory for Super-microstructure and Ultrafast Process, School of Physics and Electronics, Central South University, Changsha 410083 (China); Long, Meng-Qiu, E-mail: mqlong@csu.edu.cn [Institute of Super-microstructure and Ultrafast Process in Advanced Materials & Hunan Key Laboratory for Super-microstructure and Ultrafast Process, School of Physics and Electronics, Central South University, Changsha 410083 (China); Department of Physics and Materials Science, City University of Hong Kong, Hong Kong (China); Cui, Li-Ling [Institute of Super-microstructure and Ultrafast Process in Advanced Materials & Hunan Key Laboratory for Super-microstructure and Ultrafast Process, School of Physics and Electronics, Central South University, Changsha 410083 (China); School of Science, Hunan University of Technology, Zhuzhou 412007 (China)

    2016-01-15

    The nonlinear spin-dependent transport properties in zigzag molybdenum-disulfide nanoribbons (ZMNRs) with line defects are investigated systematically using nonequilibrium Green’s function method combined with density functional theory. The results show that the line defects can enhance the electronic transfer ability of ZMNRs. The types and locations of the line defects are found critical in determining the spin polarization and the current-voltage (I-V) characteristics of the line defected ZMNRs. For the same defect type, the total currents of the ribbons with the line defects in the centers are lager than those on the edges. And for the same location, the total currents of the systems with the sulfur (S) line defect are larger than the according systems with the molybdenum (Mo) line defect. All the considered systems present magnetism properties. And in the S line defected systems, the spin reversal behaviors can be observed. In both the spin-up and spin-down states of the Mo line defected systems, there are obvious negative differential resistance behaviors. The mechanisms are proposed for these phenomena.

  6. Effects of line defects on spin-dependent electronic transport of zigzag MoS2 nanoribbons

    Directory of Open Access Journals (Sweden)

    Xin-Mei Li

    2016-01-01

    Full Text Available The nonlinear spin-dependent transport properties in zigzag molybdenum-disulfide nanoribbons (ZMNRs with line defects are investigated systematically using nonequilibrium Green’s function method combined with density functional theory. The results show that the line defects can enhance the electronic transfer ability of ZMNRs. The types and locations of the line defects are found critical in determining the spin polarization and the current-voltage (I-V characteristics of the line defected ZMNRs. For the same defect type, the total currents of the ribbons with the line defects in the centers are lager than those on the edges. And for the same location, the total currents of the systems with the sulfur (S line defect are larger than the according systems with the molybdenum (Mo line defect. All the considered systems present magnetism properties. And in the S line defected systems, the spin reversal behaviors can be observed. In both the spin-up and spin-down states of the Mo line defected systems, there are obvious negative differential resistance behaviors. The mechanisms are proposed for these phenomena.

  7. Orbit Error Correction on the High Energy Beam Transport Line at the KHIMA Accelerator System

    CERN Document Server

    Park, Chawon; Hahn, Garam; An, Dong Hyun

    2016-01-01

    For the purpose of treatment of various cancer and medical research, the synchrotron based medical machine under the Korea Heavy Ion Medical Accelerator (KHIMA) project have been conducted and is going to treat the patient at the beginning of 2018. The KHIMA synchrotron is designed to accelerate and extract the carbon ion (proton) beam with various energy range, 110 up to 430 MeV/u (60 up to 230 MeV). A lattice design and beam optics studies for the High Energy Beam Transport (HEBT) line at the KHIMA accelerator system have been carried out with WinAgile and the MAD-X codes. Because the magnetic eld errors and the mis-alignments introduce to the deviations from the design parameters, these error sources should be treated explicitly and the sensitivity of the machine's lattice to di erent individual error sources is considered. Various types of errors which are static and dynamic one have been taken into account and have been consequentially corrected with a dedicated correction algorithm by using the MAD-X pr...

  8. The Device to Measure Currents in External Beam Transportation Lines of the DC-72 Cyclotron

    CERN Document Server

    Gulbekyan, G G; Gall, A; Kalagin, I V; Timoshenko, G N; Pachadzhiev, K K

    2002-01-01

    The present work is devoted to the development of a device to measure ion currents in external beam transportation lines of the DC-72 cyclotron, which is being created for the Cyclotron Centre of the Slovak Republic. The device is based on a Faraday cup. As possible constructive materials for the Faraday cup, Al, Cu, Fe, W and C were considered from the point of view of both the residual radiation and heating by the proton beam of the 3 kW power. Based on the calculations performed. It was suggested to use aluminium. The results of calculations of the temperature distribution in cylindrical and conic cups have been presented, both for a proton energy of 30 MeV at a beam power of 3 kW, and for a proton energy of 72 MeV at a beam power of 2.5 kW. Also presented are the results of calculation of the construction with permanent magnets that create sufficient magnetic field to eliminate the influence of secondary electrons emission on the current measurement accuracy. As a result, a sketch of the device constructi...

  9. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    International Nuclear Information System (INIS)

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×105 as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS

  10. The programme library for numerical simulation of charged particle dynamics in transportation lines

    International Nuclear Information System (INIS)

    The description of a PC codes library to simulate the beam transportation of charged particles is presented. The codes are realized on IBM PC in Visual Basic common interface. It is destined for the simulation and optimization of beam dynamics and based on the successive and consistent use of two methods: the momentum method of distribution functions (RMS technique) and the particle-particle method (PP-Method). The library allows to calculate the RMS parameters of electron and ion beams, passing through a set of quadrupoles, solenoids, bends, accelerating sections. The RMS code is a fast code very suitable for the first test, design and optimization of the beam line parameters. The PP code requires more time for execution but provides a high accuracy of simulation taking into account the space charge effects, aberrations and beam losses. One of the main advantages of PP code presented here is an ability to simulate a real multicomponent beam of different masses and charged states of ions from ion sources

  11. Quality control and patient dosimetry in digital radiology. On line system: new features and transportability.

    Science.gov (United States)

    Vano, E; Ten, J I; Fernandez, J M; Prieto, C; Ordiales, J M; Martinez, D

    2008-01-01

    New features have been added to a system (QCONLINE) for auditing patient dosimetric and technical parameters 'on line', working on a digital radiology department and using the information contained in the DICOM header of some modalities. The audit of other parameters than patient doses have been included, setting alarm conditions to alert on malfunction of the X-ray system or bad operation modes, in addition to the evaluation of patient doses. A new module to analyse, collect and process the relevant information transferred by the modality performed procedure step (MPPS) service has been launched. Several examples with the exploitation of the new features are presented. The transportability of the system has been tested in two remote hospitals during several months. The new MPPS module has demonstrated to be a good tool to complement the information existing in the DICOM header. The system allows to help in the optimisation of digital radiology departments managing patient dosimetry and procedure data in real time. PMID:18283057

  12. Improved design of proton source and low energy beam transport line for European Spallation Source

    Science.gov (United States)

    Neri, L.; Celona, L.; Gammino, S.; Mascali, D.; Castro, G.; Torrisi, G.; Cheymol, B.; Ponton, A.; Galatà, A.; Patti, G.; Gozzo, A.; Lega, L.; Ciavola, G.

    2014-02-01

    The design update of the European Spallation Source (ESS) accelerator is almost complete and the construction of the prototype of the microwave discharge ion source able to provide a proton beam current larger than 70 mA to the 3.6 MeV Radio Frequency Quadrupole (RFQ) started. The source named PS-ESS (Proton Source for ESS) was designed with a flexible magnetic system and an extraction system able to merge conservative solutions with significant advances. The ESS injector has taken advantage of recent theoretical updates and new plasma diagnostics tools developed at INFN-LNS (Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare). The design strategy considers the PS-ESS and the low energy beam transport line as a whole, where the proton beam behaves like an almost neutralized non-thermalized plasma. Innovative solutions have been used as hereinafter described. Thermo-mechanical optimization has been performed to withstand the chopped beam and the misaligned focused beam over the RFQ input collimator; the results are reported here.

  13. Improved design of proton source and low energy beam transport line for European Spallation Source

    Energy Technology Data Exchange (ETDEWEB)

    Neri, L., E-mail: neri@lns.infn.it; Celona, L.; Gammino, S.; Mascali, D.; Castro, G.; Ciavola, G. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Via S. Sofia 62, 95123 Catania (Italy); Torrisi, G. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Via S. Sofia 62, 95123 Catania (Italy); Dipartimento di Ingegneria dell’Informazione, delle Infrastrutture e dell’Energia Sostenibile, Università Mediterranea di Reggio Calabria, Via Graziella, 89122 Reggio Calabria (Italy); Cheymol, B.; Ponton, A. [European Spallation Source ESS AB, Lund (Sweden); Galatà, A. [Laboratori Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Viale dell' università 2, 35020 Legnaro (Italy); Patti, G. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Via S. Sofia 62, 95123 Catania (Italy); Laboratori Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Viale dell' università 2, 35020 Legnaro (Italy); Gozzo, A.; Lega, L. [Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare, Via S. Sofia 62, 95123 Catania (Italy); Dipartimento di Ingegneria Informatica e delle Telecomunicazioni, Università degli Studi di Catania, Viale Andrea Doria 6, 95123 Catania (Italy)

    2014-02-15

    The design update of the European Spallation Source (ESS) accelerator is almost complete and the construction of the prototype of the microwave discharge ion source able to provide a proton beam current larger than 70 mA to the 3.6 MeV Radio Frequency Quadrupole (RFQ) started. The source named PS-ESS (Proton Source for ESS) was designed with a flexible magnetic system and an extraction system able to merge conservative solutions with significant advances. The ESS injector has taken advantage of recent theoretical updates and new plasma diagnostics tools developed at INFN-LNS (Laboratori Nazionali del Sud, Istituto Nazionale di Fisica Nucleare). The design strategy considers the PS-ESS and the low energy beam transport line as a whole, where the proton beam behaves like an almost neutralized non-thermalized plasma. Innovative solutions have been used as hereinafter described. Thermo-mechanical optimization has been performed to withstand the chopped beam and the misaligned focused beam over the RFQ input collimator; the results are reported here.

  14. Learning about Antiphospholipid Syndrome (APS)

    Science.gov (United States)

    ... and links from the National Institutes of Health. Learning About Antiphospholipid Syndrome (APS) What is antiphospholipid syndrome ( ... with APS include : Systemic Vascular Thrombosis While the deep veins of the legs are the most frequent ...

  15. Contactless transport of matter in the first five resonance modes of a line-focused acoustic manipulator.

    Science.gov (United States)

    Foresti, Daniele; Nabavi, Majid; Poulikakos, Dimos

    2012-02-01

    The first five resonance modes for transport of matter in a line-focused acoustic levitation system are investigated. Contactless transport was achieved by varying the height between the radiating plate and the reflector. Transport and levitation of droplets in particular involve two limits of the acoustic forces. The lower limit corresponds to the minimum force required to overcome the gravitational force. The upper limit corresponds to the maximum acoustic pressure beyond which atomization of the droplet occurs. As the droplet size increases, the lower limit increases and the upper limit decreases. Therefore to have large droplets levitated, relatively flat radiation pressure amplitude during the translation is needed. In this study, using a finite element model, the Gor'kov potential was calculated for different heights between the reflector and the radiating plate. The application of the Gor'kov potential was extended to study the range of droplet sizes for which the droplets can be levitated and transported without atomization. It was found that the third resonant mode (H(3)-mode) represents the best compromise between high levitation force and smooth pattern transition, and water droplets of millimeter radius can be levitated and transported. The H(3)-mode also allows for three translation lines in parallel. PMID:22352478

  16. A demonstration of a transportable radio interferometric surveying system with 3-cm accuracy on a 307-m base line

    Science.gov (United States)

    Ong, K. M.; Macdoran, P. F.; Thomas, J. B.; Fliegel, H. F.; Skjerve, L. J.; Spitzmesser, D. J.; Batelaan, P. D.; Paine, S. R.; Newsted, M. G.

    1976-01-01

    A precision geodetic measurement system (Aries, for Astronomical Radio Interferometric Earth Surveying) based on the technique of very long base line interferometry has been designed and implemented through the use of a 9-m transportable antenna and the NASA 64-m antenna of the Deep Space Communications Complex at Goldstone, California. A series of experiments designed to demonstrate the inherent accuracy of a transportable interferometer was performed on a 307-m base line during the period from December 1973 to June 1974. This short base line was chosen in order to obtain a comparison with a conventional survey with a few-centimeter accuracy and to minimize Aries errors due to transmission media effects, source locations, and earth orientation parameters. The base-line vector derived from a weighted average of the measurements, representing approximately 24 h of data, possessed a formal uncertainty of about 3 cm in all components. This average interferometry base-line vector was in good agreement with the conventional survey vector within the statistical range allowed by the combined uncertainties (3-4 cm) of the two techniques.

  17. High-resolution mass separator and 60 m beam transport line for the radioactive nuclear beam facility at INS

    International Nuclear Information System (INIS)

    A high resolution on-line isotope separator (ISOL) followed by a long beam transport line is under testing at INS, as a pilot radioactive beam facility for the E-arena of the Japanese Hadron Project. The ISOL has a unique feature in its high voltage potential configuration; it has two separation stages and both are electrically insulated from the ground. This feature is effective to eliminate impurities as well as to perform high resolution mass separation while keeping the injection beam velocity to the post accelerator constant. The design concept and present status of performance tests are reported. (author)

  18. Stress responses of juvenile matrinxã (Brycon amazonicus after transport in a closed system under different loading densities Respostas de estresse de matrinxã (Brycon amazonicus juvenil após transporte em sistema fechado sob diferentes densidades de carga

    Directory of Open Access Journals (Sweden)

    Janessa Sampaio de Abreu

    2008-08-01

    Full Text Available Optimum loading density for the transport of matrinxã juveniles was investigated in a closed system with plastic bags. Transport was conducted for 4 h with fish (23.5± 0.4g and 11.6 (0.08cm starved for 24h at loading densities of 83g L-1 (D1, 125g L-1 (D2, 168g L-1 (D3 and 206g L-1 (D4. Fish were sampled before transport (BT, after transport (AT and 24h AT. The water quality was monitored before capturing fish in depuration tanks, after transport in plastic bags and in recovery tanks. Water oxygen decreased to values below 4mg L-1 in D2, D3 and D4, temperature was around 32°C, pH 6.5-6.78, total ammonia 1.09-1.7mg L-1, un-ionized ammonia 3.58-9.33x10³mg L-1 and alkalinity 134-165mg CaCO3 L-1. Blood cortisol and glucose concentrations increased in fish of all densities AT and recovered the BT levels 24h after arrival. Osmolality did not change AT but increased 24h AT in fish of all densities whereas plasma chloride decreased inversely to the loading densities after the procedure. Hematocrit decreased 24h AT in fish of all densities but no differences were verified in the number of erythrocytes. No mortality was registered in any treatment during the next week after transport. Matrinxã demonstrated to be a crowding tolerant-species in transport operations besides tolerating low levels of oxygen in the water.Neste estudo, foram investigadas as densidades de carga adequadas para transporte de matrinxãs juvenis em sistema fechado com sacos plásticos. O transporte de 4h foi feito com peixes (23,5±0,4g; 11,6 (0,08cm em jejum por 24h, em densidades de 83g L-1 (D1, 125g L-1 (D2, 168g L-1 (D3 e 206g L-1 (D4. Os peixes foram amostrados antes do transporte (AT, logo após o transporte (chegada (DT e 24h depois. A qualidade da água foi monitorada antes da captura dos peixes nos tanques de depuração, após o transporte nos sacos plásticos e nos tanques de recuperação. O oxigênio da água diminuiu para valores inferiores a 4mg L-1 em D2, D3 e D4

  19. Design and commissioning of the APS beam charge and current monitor

    International Nuclear Information System (INIS)

    The non-intercepting charge and current monitors suitable for a wide range of beam parameters have been developed and installed in the Advanced Photon Source (APS) low energy transport lines, positron accumulator ring (PAR), and injector synchrotron. The positron or electron beam pulse in the APS has charge ranging from 100pC to l0nC with pulse width varying from 30ps to 30ns. The beam charge and current are measured with a current transformer and subsequent current monitoring electronics based on an ultrafast, high precision gated integrator. The signal processing electronics, data acquisition, and communication with the control system are managed by a VME-based system. This paper summarizes the hardware and software features of the systems. The results of recent operations are presented

  20. Sea-level rise impacts on transport infrastructure: The notorious case of the coastal railway line at Dawlish, England

    OpenAIRE

    Dawson, DA; Shaw, J; Gehrels, WR

    2016-01-01

    Future climate change is likely to increase the frequency of coastal storms and floods, with major consequences for coastal transport infrastructure. This paper assesses the extent to which projected sea-level rise is likely to impact upon the functioning of the Dawlish to Teignmouth stretch of the London to Penzance railway line, in England. Using a semi-empirical modelling approach, we identify a relationship between sea-level change and rail incidents over the last 150 years and then use m...

  1. Upgrade of the beam transport lines and the beam-abort system and development of a tune compensator in KEKB

    Science.gov (United States)

    Iida, Naoko; Kikuchi, Mitsuo; Mimashi, Toshihiro; Nakayama, Hisayoshi; Sakamoto, Yutaka; Satoh, Kotaro; Takasaki, Seiji; Tawada, Masafumi

    2013-03-01

    The KEKB collider achieved a maximum peak luminosity of 2.1×1034 cm-2 s-1 and an integrated luminosity of 1 ab-1 in its ten-year operation. Behind these glorious records there have been uncountable improvements in every subsystem. This paper describes the improvements in the beam transport line, injection kickers, septum magnets, the beam-abort system, and a newly developed pulsed-quadrupole system in detail.

  2. The switch interface and the interlock protection of the magnet power system of the beam current transport line

    International Nuclear Information System (INIS)

    The synchrotron radiation facility, constructed by the Hefei National Synchrotron Radiation Laboratory, University of Science and Technology of China, had passed the normal check by the state. The facility will be open to the users inside and outside the country. In this paper, the switch interface and the interlock protection of the magnet power system of the beam current transport line, one of the main components of this facility, are described

  3. PolyADP-ribose polymerase is a coactivator for AP-2-mediated transcriptional activation.

    OpenAIRE

    Kannan, P; Yu, Y; Wankhade, S; Tainsky, M A

    1999-01-01

    Overexpression of transcription factor AP-2 has been implicated in the tumorigenicity of the human teratocarcinoma cell lines PA-1 that contain an activated ras oncogene. Here we show evidence that overexpression of AP-2 sequesters transcriptional coactivators which results in self-inhibition. We identified AP-2-interacting proteins and determined whether these proteins were coactivators for AP-2-mediated transcription. One such interacting protein is polyADP-ribose polymerase (PARP). PARP su...

  4. In-situ characterization of wastewater flow and transport from at-grade line sources to shallow groundwater

    Science.gov (United States)

    Weldeyohannes, A. O.; Kachanoski, R. G.; Dyck, M. F.

    2011-12-01

    A better understanding of multidimensional unsaturated and saturated flow and transport under boundary conditions typical of on-site wastewater disposal systems is required to assess the risk to groundwater contamination. The main objective of this research is to characterize in-situ wastewater flow and transport from at-grade line sources on a shallow groundwater conditions. The research site was conducted at Wetaskiwin Rest Stop, Alberta, Canada, where ultraviolet disinfected wastewater has been disposed off to the ground via pressurized at-grade line sources since 2007. The site was characterized for wastewater plume and temporal groundwater fluctuation by using Electromagnetic induction (EM31) and (EM38); and by grid of 74 water table wells, 14 piezometers and 11 transducers. Groundwater was analyzed for selected tracers (pH, EC and Cl) and some microbiology (e.g. E. coli). From the results wastewater plume was identified; and wastewater plume center of mass and average flow direction were estimated. Along the horizontal plume center of mass, 30 monitoring wells in 10 nests and 31 temperature sensors in 5 nests were installed to get vertical resolution of the wastewater plume and to track contaminant transport over time. Results, implications and plans for future investigations will be presented. The research output will benefit future research on contaminant fate and transport and groundwater risk assessment plans. Key words: On-site wastewater treatment/disposal system, Wastewater plume, Groundwater contamination.

  5. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  6. Human L-type amino acid transporter 1 (LAT1): characterization of function and expression in tumor cell lines.

    Science.gov (United States)

    Yanagida, O; Kanai, Y; Chairoungdua, A; Kim, D K; Segawa, H; Nii, T; Cha, S H; Matsuo, H; Fukushima, J; Fukasawa, Y; Tani, Y; Taketani, Y; Uchino, H; Kim, J Y; Inatomi, J; Okayasu, I; Miyamoto, K; Takeda, E; Goya, T; Endou, H

    2001-10-01

    System L is a major nutrient transport system responsible for the transport of large neutral amino acids including several essential amino acids. We previously identified a transporter (L-type amino acid transporter 1: LAT1) subserving system L in C6 rat glioma cells and demonstrated that LAT1 requires 4F2 heavy chain (4F2hc) for its functional expression. Since its oncofetal expression was suggested in the rat liver, it has been proposed that LAT1 plays a critical role in cell growth and proliferation. In the present study, we have examined the function of human LAT1 (hLAT1) and its expression in human tissues and tumor cell lines. When expressed in Xenopus oocytes with human 4F2hc (h4F2hc), hLAT1 transports large neutral amino acids with high affinity (K(m)= approximately 15- approximately 50 microM) and L-glutamine and L-asparagine with low affinity (K(m)= approximately 1.5- approximately 2 mM). hLAT1 also transports D-amino acids such as D-leucine and D-phenylalanine. In addition, we show that hLAT1 accepts an amino acid-related anti-cancer agent melphalan. When loaded intracellularly, L-leucine and L-glutamine but not L-alanine are effluxed by extracellular substrates, confirming that hLAT1 mediates an amino acid exchange. hLAT1 mRNA is highly expressed in the human fetal liver, bone marrow, placenta, testis and brain. We have found that, while all the tumor cell lines examined express hLAT1 messages, the expression of h4F2hc is varied particularly in leukemia cell lines. In Western blot analysis, hLAT1 and h4F2hc have been confirmed to be linked to each other via a disulfide bond in T24 human bladder carcinoma cells. Finally, in in vitro translation, we show that hLAT1 is not a glycosylated protein even though an N-glycosylation site has been predicted in its extracellular loop, consistent with the property of the classical 4F2 light chain. The properties of the hLAT1/h4F2hc complex would support the roles of this transporter in providing cells with essential

  7. Westinghouse AP1000 containment design

    International Nuclear Information System (INIS)

    The Westinghouse AP1000 Program is aimed at making available a nuclear power plant that is economical in the U.S deregulated electrical power industry in the near-term. The AP1000 is two-loop 1000 MWe pressurizer water reactor (PWR). It is an up rated version of the AP600. The AP1000 uses passive safety systems to provide significant and measurable improvements in plant simplification, safety, reliability, investment protection and plant costs. The AP1000 uses proven technology, which builds on 50 years of operating PWR experience. The AP1000 received Final Design Approval by the Nuclear Regulatory Commission in September 2004. The AP1000 is provided with a high integrity containment using a substantial steel pressure vessel. The steel surface is used to remove decay heat during design basis accidents. One of the other advantages of the AP1000 containment design over evolutionary PWRs, is improved containment isolation. This has been accomplished by reducing the number of penetrations by ∼50% and improving the isolation valves. As a result, the AP1000 will have fewer difficulties during containment leak testing. The AP1000 containment design meets the Advanced Light Water Reactor Utility Requirements Document (URD) requirements and has been reviewed and approved by the NRC, as was the AP600 containment design. Furthermore, the containment design has also been recognized as meeting the EUR containment requirements by the European utilities. This paper reviews the AP1000 containment vessel design, construction, post accident behavior, and severe accident performance. In addition, the radiation release models, assumptions and both short and long-term performance are also discussed. (authors)

  8. AP physics B crash course

    CERN Document Server

    Howell, Rebecca

    2012-01-01

    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  9. Cell kinetics of differentiation of Na+-dependent hexose transport in a cultured renal epithelial cell line

    International Nuclear Information System (INIS)

    Fully differentiated cells of the renal proximal tubule have the capability of taking up hexoses across their apical borders by transport coupled to the Na+-electrochemical gradient. This property is also found in postconfluent cultures of the cloned cell line LLC-PK1, a morphologically polarized line of renal cells. Postconfluent cells develop the Na+-dependent capacity to transport hexoses at their apical surface. This function is not observable during the growth phase of the cultures. To analyze the developmental process at the cellular level a method has been derived to separate transporting cells, expressing the differentiated function, from nontransporting cells. The method is based on the swelling of the cells accompanying the uptake of the nonmetabolizable glucose analog alpha methylglucoside. The swollen cells have a lower buoyant density than the undifferentiated cells and may be separated from them on density gradients. Analysis of the distribution of cells on such gradients shows that after the cells reach confluence the undifferentiated subpopulation is recruited onto the differentiation pathway with a rate constant of 0.2 per day, that 5 to 7 days are required for a cell to traverse this pathway to the fully differentiated state, and that once the maximum uptake capacity is achieved the cells do not develop further

  10. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  11. Simulation of the transport of Rn222 using on-line and off-line global models at different horizontal resolutions: a detailed comparison with measurements

    Science.gov (United States)

    Dentener, Frank; Feichter, Johann; Jeuken, Ad

    1999-07-01

    The short-lived radionuclide Rn222 is emitted at a fairly constant rate from the continents and is a good surrogate for studying the transport of "air pollution" from polluted continental areas to clean, remote regions. The large concentration gradients of 2 3 orders of magnitude which exist between the continents and the remote atmosphere present a major challenge to the modelling of horizontal and vertical atmospheric transport. We use the global off-line tracer transport model TM3 at 3 different resolutions. Input to the model consists of meteorological data for the year 1993 obtained from the European Centre for Medium Range Weather Forecasts (ECMWF). The same meteorological data is used to constrain the climate model ECHAM4-T42-L19. Using these meteorological data, Rn222 simulations are used to evaluate and document model performance and associated uncertainties. High time-resolution measurements made at 2 continental stations, 2 stations under continental influence and 4 remote sites, and aircraft measurements obtained during the NARE aircraft campaign are used for a detailed comparison.Although in specific regions there are inter-model differences of up to a factor of 2 in the calculated boundary layer concentrations, these differences are not translated into a better performance of either model for the stations used for comparison. We generally obtain high correlations of model results and measurements; these range from r= 0.6 0.8 for the continental and coastal stations and 0.5 0.6 for the remote sites. Calculated mean concentrations and corresponding standard deviations generally agree favourably with observations, lending credibility to the usefulness of our models for evaluating transport of air pollutants from continental sources to remote regions. The main cause of model deviations is probably related to uncertainties in the meteorological input data set provided by the ECMWF model and to a lesser extent by our knowledge of the spatial distribution of

  12. Organizing transportation on a double-track line under conditions of major overhaul on one track

    Directory of Open Access Journals (Sweden)

    Bošković Branislav

    2006-01-01

    Full Text Available The problem of traffic organization on a railway line during the execution of civil works on super and sub-structures maintenance under the present conditions is becoming more and more difficult to solve, above all, due to the increased traffic intensity. In order to make decisions on indispensable measures to be taken under such circumstances, one needs information on train compositions and their delays, line capacity, facilities, etc. In order to obtain such information, it is necessary to use a computer simulation which significantly enhances the range of the problem to be solved and offers answers to the questions that cannot be solved by analytical models alone. The paper presents a simulation model of the trains’ movement on a double-track line when one track is closed to traffic due to the work executions. Such model will provide a better quality of decision-making in the process of traffic organization under given circumstances.

  13. Regulation of membrane transport and metabolism in the HT29 human colonic adenocarcinoma cell line

    International Nuclear Information System (INIS)

    The effects of insulin on glucose transport and metabolism were examined in cultured HT29 human colonic adenocarcinoma cells. The presence of glucose transporters was verified by D-glucose displaceable [3H] cytochalasin B binding. Moreover, two classes of insulin binding sites were detected in radioligand binding experiments. Despite the presence of both glucose transporters and insulin receptors, insulin failed to stimulate glucose transport. However, insulin was found to activate glycolysis. These findings suggest that insulin directly influences substrate utilization through the glycolytic pathway in HT29 cells without activating the glucose transport pathway. A Na+/K+/Cl- cotransport pathway was also detected in HT29 cells using 86Rb+ as a K+ congener. The identity of this pathway as a Na+/K+/Cl- cotransporter has been deduced from the following findings: (1) 86Rb+ influx was inhibited by loop diuretics, (2) 86Rb+ influx ceased in the absence of any one of the transported ions, and (3) cotransport exhibited a stoichiometry approaching 1Na+:1K+:2Cl-. Na+/K+/Cl- cotransport was found to be exquisitely sensitive to cellular ATP and cyclic AMP levels. These results suggest that HT29 cells contain a Na+/K+/Cl- cotransport pathway that can be regulated by the second messenger cyclic AMP and is highly sensitive to the metabolic state of the cell. The involvement of protein kinase C in the regulation of Na+/K+/Cl- cotransport was also investigated. Phorbol 12-myristate 13-acetate (PMA), which stimulated protein kinase C activity, produced a transient increase in cotransport followed by a near abolition of cotransport by 2 h

  14. Evaluation of procedures to delimit services lines of urban transport areas with GIS

    Directory of Open Access Journals (Sweden)

    Antonio Moreno

    2003-01-01

    Full Text Available This paper addresses the evaluation of several procedures for delimiting service areas of urban transport facilities and computing the served population. To this end, detailed data of a local case study and a geographical information system are used. Adopting two different georeferencing methods and two spatial metrics, the tested approaches reveal disparate results and errors, which allow to appreciate the advantages and limitations of each one. It is expected that the conclusions will contribute to increase the accuracy of analysis focused to urban public transport planning and decision taking.

  15. Autosomal recessive spastic tetraplegia caused by AP4M1 and AP4B1 gene mutation: expansion of the facial and neuroimaging features.

    Science.gov (United States)

    Tüysüz, Beyhan; Bilguvar, Kaya; Koçer, Naci; Yalçınkaya, Cengiz; Çağlayan, Okay; Gül, Ece; Sahin, Sezgin; Çomu, Sinan; Günel, Murat

    2014-07-01

    Adaptor protein complex-4 (AP4) is a component of intracellular transportation of proteins, which is thought to have a unique role in neurons. Recently, mutations affecting all four subunits of AP4 (AP4M1, AP4E1, AP4S1, and AP4B1) have been found to cause similar autosomal recessive phenotype consisting of tetraplegic cerebral palsy and intellectual disability. The aim of this study was analyzing AP4 genes in three new families with this phenotype, and discussing their clinical findings with an emphasis on neuroimaging and facial features. Using homozygosity mapping followed by whole-exome sequencing, we identified two novel homozygous mutations in AP4M1 and a homozygous deletion in AP4B1 in three pairs of siblings. Spastic tetraplegia, microcephaly, severe intellectual disability, limited speech, and stereotypic laughter were common findings in our patients. All patients also had similar facial features consisting of coarse and hypotonic face, bitemporal narrowing, bulbous nose with broad nasal ridge, and short philtrum which were not described in patients with AP4M1 and AP4B1 mutations previously. The patients presented here and previously with AP4M1, AP4B1, and AP4E1 mutations shared brain abnormalities including asymmetrical ventriculomegaly, thin splenium of the corpus callosum, and reduced white matter volume. The patients also had hippocampal globoid formation and thin hippocampus. In conclusion, disorders due to mutations in AP4 complex have similar neurological, facial, and cranial imaging findings. Thus, these four genes encoding AP4 subunits should be screened in patients with autosomal recessive spastic tetraplegic cerebral palsy, severe intellectual disability, and stereotypic laughter, especially with the described facial and cranial MRI features. PMID:24700674

  16. Design of a beam transport line between the RFQ and the DTL for the 1-GeV proton linac

    International Nuclear Information System (INIS)

    A beam transport line between the RFQ and the drift tube linac (DTL) for the 1-GeV proton linac was designed using four computer codes, MAGIC, BTSCF, BTFIT, and LEBT. The last three codes include the effects of the space-charge. The calculated results show no increase in the transverse emittance and about a 20%-increase in the longitudinal emittance for a 20-mA bunched proton beam. Properties of the beam line are studied in connection with the effects on the final beam qualities after a long acceleration with the 1-GeV proton linac. The effects of transverse mismatch at the DTL injection, arising from the difference in the calculation method between the code BTSCF and LEBT, are discussed. (author)

  17. Li-7 and Be-7 de-excitation lines - Probes for accelerated particle transport models in solar flares

    International Nuclear Information System (INIS)

    The photon energy spectrum of a spectral feature composed of the 429 and 478 keV gamma-ray lines from Be-7 and Li-7 (produced by interactions of flare-accelerated alpha particles with ambient He in the solar atmosphere) depends on the angular distribution of the interacting accelerated particles. This spectrum is calculated for limb and disk-centered flares using a loop model for the transport of the ions. The resulting spectra are compared with data from the April 27, 1981 limb flare obtained with the gamma-ray spectrometer on SMM, providing convincing evidence for the existence of the (Li-7)-(Be-7) feature in this flare. By comparing the fluence of this feature with that of the 511 keV line, it is shown that the accelerated alpha particle abundance or the ambient He abundance, or both, must be enhanced. 26 refs

  18. The transport and diffusion theory of a line source in an infinite half-space with internal reflection

    International Nuclear Information System (INIS)

    A closed form analytical solution is obtained for a three-dimensional transport theory problem, namely that of a line source in a half-space in one-speed transport theory with an internally reflecting surface. The theory is developed by using Fourier transforms in the transverse directions and a Laplace transform in the axial direction, together with the Wiener-Hopf technique. Both specular and diffuse internal reflection are considered and it is shown that a closed form solution is not available for the specular case but is available for the diffuse case. The surface particle scalar intensity and current are obtained and their sensitivity to absorption and the reflection coefficient are assessed. We also obtain a number of analytic asymptotic estimates for the intensity valid at large distances from the source. Diffusion theory is also employed and compared numerically with the transport solution. In general, diffusion theory gives very satisfactory results within its regions of limitation. We also offer this paper as an exercise in analytical transport theory; an aspect of reactor physics which is not often seen in recent times

  19. A single-passage beam-position monitor system for the TRISTAN AR-to-MR transport lines

    International Nuclear Information System (INIS)

    A beam-position monitor (BPM) system has been installed in the transport lines between the Accumulation Ring (AR) and the Main Ring (MR) of TRISTAN. This system comprises stripline and button electrodes, detectors and charge-sensitive ADCs. The detector is a homodyne type synchronous-receiver at 70 MHz with four channels corresponding to four electrodes. Operation software automatically displays the detected beam position and its charge on a TV screen after each passage of the beam. The system is stable and is used to monitor the drift of the beam position. (author)

  20. Regulation of taurine transport by Escherichia coli heat-stable enterotoxin and guanylin in human intestinal cell lines.

    OpenAIRE

    Brandsch, M; Ramamoorthy, S.; Marczin, N; Catravas, J. D.; Leibach, J W; Ganapathy, V.; Leibach, F H

    1995-01-01

    The human colon carcinoma cell lines Caco-2 and HT-29 take up taurine actively. Treatment of Caco-2 cells with Escherichia coli heat-stable enterotoxin (STa) or with guanylin inhibited taurine uptake by approximately 40%. In contrast, neither STa nor guanylin changed the uptake of taurine in HT-29 cells. The inhibition in Caco-2 cells was associated with a decrease in the maximal velocity as well as in the affinity of the transporter. STa caused a 21-fold increase in guanosine 3',5'-cyclic mo...

  1. Different Behavioral and Physiological Response in two Genetic Lines of Laying Hens Following Transportation

    Science.gov (United States)

    Physiological and behavioral response to transportation stress were examined in chickens selected for high group productivity and survivability (HGPS) resulting from reduced cannibalism and flightiness in colony cages and in chickens from Dekalb XL (DXL) commercial strain. At 13 wks of age, 96 pulle...

  2. Reversal of resistance by GF120918 in cell lines expressing the ABC half-transporter, MXR

    DEFF Research Database (Denmark)

    de Bruin, M; Miyake, K; Litman, Thomas;

    1999-01-01

    in S1-B1-20 and S1-M1-80 cells when incubated in the presence of GF120918 than when incubated with mitoxantrone alone. Thus, GF120918 appears to fit the paradigm of a multispecific blocker and is able to block rhodamine and mitoxantrone efflux by the newly identified mitoxantrone transporter. Further...

  3. Structural model of FeoB, the iron transporter from Pseudomonas aeruginosa, predicts a cysteine lined, GTP-gated pore

    Science.gov (United States)

    Seyedmohammad, Saeed; Fuentealba, Natalia Alveal; Marriott, Robert A.J.; Goetze, Tom A.; Edwardson, J. Michael; Barrera, Nelson P.; Venter, Henrietta

    2016-01-01

    Iron is essential for the survival and virulence of pathogenic bacteria. The FeoB transporter allows the bacterial cell to acquire ferrous iron from its environment, making it an excellent drug target in intractable pathogens. The protein consists of an N-terminal GTP-binding domain and a C-terminal membrane domain. Despite the availability of X-ray crystal structures of the N-terminal domain, many aspects of the structure and function of FeoB remain unclear, such as the structure of the membrane domain, the oligomeric state of the protein, the molecular mechanism of iron transport, and how this is coupled to GTP hydrolysis at the N-terminal domain. In the present study, we describe the first homology model of FeoB. Due to the lack of sequence homology between FeoB and other transporters, the structures of four different proteins were used as templates to generate the homology model of full-length FeoB, which predicts a trimeric structure. We confirmed this trimeric structure by both blue-native-PAGE (BN-PAGE) and AFM. According to our model, the membrane domain of the trimeric protein forms a central pore lined by highly conserved cysteine residues. This pore aligns with a central pore in the N-terminal GTPase domain (G-domain) lined by aspartate residues. Biochemical analysis of FeoB from Pseudomonas aeruginosa further reveals a putative iron sensor domain that could connect GTP binding/hydrolysis to the opening of the pore. These results indicate that FeoB might not act as a transporter, but rather as a GTP-gated channel. PMID:26934982

  4. Structural model of FeoB, the iron transporter from Pseudomonas aeruginosa, predicts a cysteine lined, GTP-gated pore.

    Science.gov (United States)

    Seyedmohammad, Saeed; Fuentealba, Natalia Alveal; Marriott, Robert A J; Goetze, Tom A; Edwardson, J Michael; Barrera, Nelson P; Venter, Henrietta

    2016-04-01

    Iron is essential for the survival and virulence of pathogenic bacteria. The FeoB transporter allows the bacterial cell to acquire ferrous iron from its environment, making it an excellent drug target in intractable pathogens. The protein consists of an N-terminal GTP-binding domain and a C-terminal membrane domain. Despite the availability of X-ray crystal structures of the N-terminal domain, many aspects of the structure and function of FeoB remain unclear, such as the structure of the membrane domain, the oligomeric state of the protein, the molecular mechanism of iron transport, and how this is coupled to GTP hydrolysis at the N-terminal domain. In the present study, we describe the first homology model of FeoB. Due to the lack of sequence homology between FeoB and other transporters, the structures of four different proteins were used as templates to generate the homology model of full-length FeoB, which predicts a trimeric structure. We confirmed this trimeric structure by both blue-native-PAGE (BN-PAGE) and AFM. According to our model, the membrane domain of the trimeric protein forms a central pore lined by highly conserved cysteine residues. This pore aligns with a central pore in the N-terminal GTPase domain (G-domain) lined by aspartate residues. Biochemical analysis of FeoB from Pseudomonas aeruginosa further reveals a putative iron sensor domain that could connect GTP binding/hydrolysis to the opening of the pore. These results indicate that FeoB might not act as a transporter, but rather as a GTP-gated channel. PMID:26934982

  5. Multidrug resistance mediated by ABC transporters in osteosarcoma cell lines: mRNA analysis and functional radiotracer studies

    Energy Technology Data Exchange (ETDEWEB)

    Gomes, Celia Maria Freitas [Department of Pathology, Leiden University Medical Center, 2300 RC Leiden (Netherlands); Faculty of Medicine, Institute of Biophysics/Biomathematics, IBILI, 3000-354 Coimbra (Portugal)]. E-mail: cgomes@ibili.uc.pt; van Paassen, Heidi [Department of Pathology, Leiden University Medical Center, 2300 RC Leiden (Netherlands); Romeo, Salvatore [Department of Pathology, Leiden University Medical Center, 2300 RC Leiden (Netherlands); Welling, Mick M. [Department of Radiology, Section of Nuclear Medicine, Leiden University Medical Center, 2300 RC Leiden (Netherlands); Feitsma, R.I.J. [Department of Radiology, Section of Nuclear Medicine, Leiden University Medical Center, 2300 RC Leiden (Netherlands); Abrunhosa, Antero J. [Faculty of Medicine, Institute of Biophysics/Biomathematics, IBILI, 3000-354 Coimbra (Portugal); Botelho, M. Filomena [Faculty of Medicine, Institute of Biophysics/Biomathematics, IBILI, 3000-354 Coimbra (Portugal); Hogendoorn, Pancras C.W. [Department of Pathology, Leiden University Medical Center, 2300 RC Leiden (Netherlands); Pauwels, Ernest [Department of Radiology, Section of Nuclear Medicine, Leiden University Medical Center, 2300 RC Leiden (Netherlands); Cleton-Jansen, Anne Marie [Department of Pathology, Leiden University Medical Center, 2300 RC Leiden (Netherlands)

    2006-10-15

    Drug resistance remains a significant impediment to successful chemotherapy and constitutes a major prognostic factor in osteosarcoma (OS) patients. This study was designed to identify the role and prognostic significance of multidrug-resistance (MDR)-related transporters, such as multidrug resistance protein 1 (MDR1), multidrug-resistance-associated protein (MRP1) and breast-cancer-related protein (BCRP), in OS using cationic lipophilic radiotracers. We evaluated the chemosensitivity of four OS cell lines (Saos-2, 143B, MNNG/HOS and U-2OS) to doxorubicin (DOX), cisplatin (CIS) and methotrexate. The expression of MDR-related transporters was analyzed at mRNA level by quantitative polymerase chain reaction and at functional level by {sup 99m}Tc sestamibi and {sup 99m}Tc tetrofosmin. The effectiveness of MDR modulators [cyclosporin A (CsA) and imatinib] on transporter inhibition and on the reversal of resistance was also assessed. MNNG/HOS and U-2OS cells expressing high levels of MDR1 were highly resistant to DOX and showed reduced accumulation and higher efflux for radiotracers. Although MRP1 was uniformly expressed in all cells, only U-2OS was resistant to CIS. CsA restored sensitivity to DOX and CIS, and enhanced the accumulation and efflux half-life of radiotracers in MDR1-expressing cell lines. The chemosensitivity of OS cells to DOX was strongly dependent on mRNA MDR1 expression and could be circumvented by adding CsA. The kinetic parameters of radiotracers correlated with MDR1 expression levels, hence predicting DOX resistance. We concluded that sensitivity to chemotherapy is strongly dependent on the expression of MDR1 transporter and that radiotracer studies could prove clinically useful in predicting chemotherapy response and in evaluating the efficacy of MDR-reversing agents.

  6. AP-42 REVISION: COKE OVENS

    Science.gov (United States)

    The document "Compilation of Air Pollutant Emission Factors" (AP-42) has been published by the U. S. Environmental Protection Agency (EPA) since 1972. Supplements to AP-42 have been routinely published to add new emission source categories and to update existing emission factor...

  7. AP1000. The PWR revisited

    International Nuclear Information System (INIS)

    The distinguishing features of Westinghouse's AP1000 advanced passive pressurized water reactor are highlighted. In particular, the AP1000's passive safety features are described as well as their implications for simplifying the design, construction, and operation of this design compared to currently operating plants, and significantly increasing safety margins over current plants as well. The AP1000 design specifically incorporates the knowledge acquired from the substantial accumulation of power reactor operating experience and benefits from the application of the Probabilistic Risk Assessment in the design process itself. The AP1000 design has been certified by the US Nuclear Regulatory Commission under its new rules for licensing new nuclear plants, 10 CFR Part 52, and is the subject of six combined Construction and Operating License applications now being developed. Currently the AP1000 design is being assessed against the EUR Rev C requirements for new nuclear power plants in Europe. (author)

  8. AP600 Shield building

    International Nuclear Information System (INIS)

    In order to minimize capital costs and save time in the global construction time schedule for the AP600 Nuclear Power Plant, planned in 36 months from excavation up to the fuel charging, ANSALDO has developed an innovative Shield Building Conical Roof design having the following basic characteristics: i) can be erected approximately in less than two months; ii) allows the functionality of the Passive Containment Cooling System (PCSS) located in the PCCS tank and in the Valve Room anchored directly to the conical roof itself; iii) satisfies the structural loads design as Safe Shutdown Earthquake, or the Aircraft Crash and both integrated with the sloshing analysis for the tank located at the top of the conical roof. The most important aspects of this new roof are: a) use of prefabricated precast panels; b) address the erection of the formworks using temporary structures having the capability of becoming final elements; c) develop a modular rebars sizing and design in order to perform the most important portion of the job in the workshop; d) second pouring construction sequence assuring full integration with the formwork function; e) modular construction of the PCSS tank at the top of the conical roof. An interesting evaluation has been also performed in calculating sloshing phenomenon in the PCSS tank by comparing detailed 3D Finite Element Model approach and simplified qualified formulas dedicated to this phenomenon. (author). 2 figs

  9. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    International Nuclear Information System (INIS)

    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP

  10. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-03-04

    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP.

  11. Space charge compensation in the Linac4 low energy beam transport line with negative hydrogen ions

    Energy Technology Data Exchange (ETDEWEB)

    Valerio-Lizarraga, Cristhian A., E-mail: cristhian.alfonso.valerio.lizarraga@cern.ch [CERN, Geneva (Switzerland); Departamento de Investigación en Física, Universidad de Sonora, Hermosillo (Mexico); Lallement, Jean-Baptiste; Lettry, Jacques; Scrivens, Richard [CERN, Geneva (Switzerland); Leon-Monzon, Ildefonso [Facultad de Ciencias Fisico-Matematicas, Universidad Autónoma de Sinaloa, Culiacan (Mexico); Midttun, Øystein [CERN, Geneva (Switzerland); University of Oslo, Oslo (Norway)

    2014-02-15

    The space charge effect of low energy, unbunched ion beams can be compensated by the trapping of ions or electrons into the beam potential. This has been studied for the 45 keV negative hydrogen ion beam in the CERN Linac4 Low Energy Beam Transport using the package IBSimu [T. Kalvas et al., Rev. Sci. Instrum. 81, 02B703 (2010)], which allows the space charge calculation of the particle trajectories. The results of the beam simulations will be compared to emittance measurements of an H{sup −} beam at the CERN Linac4 3 MeV test stand, where the injection of hydrogen gas directly into the beam transport region has been used to modify the space charge compensation degree.

  12. Appraisal of increased public transport capacity: the case of a new metro line to Nacka, Sweden

    OpenAIRE

    Cats , Oded; West , Jens; ELIASSON, Jonas

    2015-01-01

    One of the most common motivations for public transport investments is increased capacity. However, appraisal methodologies for projects meant to increase capacity are relatively less well developed compared to methodologies for projects aiming to reduce travel times. Each of the consequences of capacity limitations - crowding, risk for denied boarding and unreliable waiting and travel times - can increase the generalized travel costs. The appraisal of capacity improvements requires supply an...

  13. Going below the line: creating transportable brands for Australia's dark market

    Science.gov (United States)

    Carter, S

    2003-01-01

    Objective: To investigate non-point-of-sale cigarette marketing in Australia, one of the "darkest" markets in the world. Design: Analysis of 172 tobacco industry documents. Results: The tobacco industry has continued to market their products despite severe restrictions on legal marketing activity. They made careful plans to circumvent regulation well in advance. In preparation for bans, they chose and strengthened existing brands to enable their continued success in a dark market and prepared the consumer for bans by increasing their spending on below the line activities. Bans reduced the industry's effectiveness and efficiency. After bans new brand launches stopped: instead key existing brands were strengthened via alterations to the product, line extensions, and stretching loopholes in the legislation as far as possible. In line with the general trend towards integrated marketing, a range of activities have been used in combination, including guerrilla marketing, advertising in imported international magazines, altering the pack, sponsorships, brand stretching, event promotions, lifestyle premiums, and the development of corporate websites. Conclusions: The tobacco industry acknowledges that marketing restrictions have an impact, validating their continued use in tobacco control. The industry is extremely creative in circumventing these marketing restrictions, requiring tobacco marketing regulations to be informed by marketing expertise, regularly updated, and to adopt the broadest possible scope. Tobacco control advocates, particularly those communicating with young people, could learn from the creativity of the tobacco industry. PMID:14645953

  14. The Dopamine Transporter Constitutively Internalizes and Recycles in a Protein Kinase C-regulated Manner in Stably Transfected PC12 Cell Lines*

    OpenAIRE

    Loder, Merewyn K; Melikian, Haley E.

    2003-01-01

    The dopamine transporter (DAT) removes dopamine from the extracellular milieu and is potently inhibited by number of psychoactive drugs, including cocaine, amphetamines, and methylphenidate (Ritalin). Multiple lines of evidence demonstrate that protein kinase C (PKC) down-regulates dopamine transport, primarily by redistributing DAT from the plasma membrane to endosomal compartments, although the mechanisms facilitating transporter sequestration are not defined. Here, we demonstrate that DAT ...

  15. High intensity proton beam transportation through fringe field of 70 MeV compact cyclotron to beam line targets

    Science.gov (United States)

    Zhang, Xu; Li, Ming; Wei, Sumin; Xing, Jiansheng; Hu, Yueming; Johnson, Richard R.; Piazza, Leandro; Ryjkov, Vladimir

    2016-06-01

    From the stripping points, the high intensity proton beam of a compact cyclotron travels through the fringe field area of the machine to the combination magnet. Starting from there the beams with various energy is transferred to the switching magnet for distribution to the beam line targets. In the design of the extraction and transport system for the compact proton cyclotron facilities, such as the 70 MeV in France and the 100 MeV in China, the space charge effect as the beam crosses the fringe field has not been previously considered; neither has the impact on transverse beam envelope coupled from the longitudinal direction. Those have been concerned much more with the higher beam-power because of the beam loss problem. In this paper, based on the mapping data of 70 MeV cyclotron including the fringe field by BEST Cyclotron Inc (BEST) and combination magnet field by China Institute of Atomic Energy (CIAE), the beam extraction and transport are investigated for the 70 MeV cyclotron used on the SPES project at Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro (INFN-LNL). The study includes the space charge effect and longitudinal and transverse coupling mentioned above, as well as the matching of beam optics using the beam line for medical isotope production as an example. In addition, the designs of the ±45° switching magnets and the 60° bending magnet for the extracted beam with the energy from 35 MeV to 70 MeV have been made. Parts of the construction and field measurements of those magnets have been done as well. The current result shows that, the design considers the complexity of the compact cyclotron extraction area and fits the requirements of the extraction and transport for high intensity proton beam, especially at mA intensity levels.

  16. Accelerator and detector physics at the Bern medical cyclotron and its beam transport line

    Directory of Open Access Journals (Sweden)

    Auger Martin

    2016-03-01

    Full Text Available The cyclotron laboratory for radioisotope production and multi-disciplinary research at the Bern University Hospital (Inselspital is based on an 18-MeV proton accelerator, equipped with a specifically conceived 6-m long external beam line, ending in a separate bunker. This facility allows performing daily positron emission tomography (PET radioisotope production and research activities running in parallel. Some of the latest developments on accelerator and detector physics are reported. They encompass novel detectors for beam monitoring and studies of low current beams.

  17. Electromagnetic design and development of a combined function horizontal and vertical dipole steerer magnet for medium energy beam transport line

    International Nuclear Information System (INIS)

    Medium Energy Beam Transport (MEBT) line is required to match the optical functions between the RFQ and SRF cavities/DTL cavities.The primary function of the MEBT lines is to keep the emittance growth of the output beam as low as possible in a highly space charge environment at low energies. The transverse focusing of the beam is achieved by strong focusing quadrupoles and the longitudinal dynamics is achieved by the buncher cavities. The Dipole Steerers serve the function of a control element to achieve the desired transverse beam position. To minimize the emittance growth high magnetic field rigidity is required in a highly constrained longitudinal space for these corrector magnets. The design and development of an air-cooled dipole steerer magnet has been done for an integral dipole field of 2.1mT-m in a Good Field Region (GFR) of 23 mm diameter with Integral Field homogeneity better than 0.5%. Electromagnetic field simulations were done using 3D-FEM simulation software OPERA. Error sensitivity studies have been carried out to specify the manufacturing tolerances to estimate and minimize the beam transmission loss due to likely misalignments and rotation of the magnet. A combined function dipole corrector magnet has been designed and fabricated at the Control Instrumentation Division, BARC. This paper discusses measurement results of a combined function dipole steerer for MEBT line for Proton (H+) beam at 2.5 MeV. (author)

  18. Quantitative Kα line spectroscopy for energy transport in ultra-intense laser plasma interaction

    Science.gov (United States)

    Zhang, Z.; Nishimura, H.; Fujioka, S.; Arikawa, Y.; Nakai, M.; Chen, H.; Park, J.; Williams, G. J.; Ozaki, T.; Shiraga, H.; Kojima, S.; Johzaki, T.; Sunahara, A.; Miyanaga, N.; Kawanaka, J.; Nakata, Y.; Jitsuno, T.; Azechi, H.

    2016-03-01

    Absolute Ka line spectroscopy is proposed for studying laser-plasma interactions taking place in the cone-guided fast ignition targets. X-ray spectra ranging from 20 to 100 keV were quantitatively measured with a Laue spectrometer. The absolute sensitivities of the Laue spectrometer system were calibrated using pre-characterized laser-produced x-ray sources and radioisotopes. The integrated reflectivity for the crystal is in good agreement with predictions by an open code for x-ray diffraction. The energy transfer efficiency from incident laser beams to hot electrons, as the energy transfer agency, is derived as a consequence of this work. The absolute yield of Au and Ta Ka lines were measured in the fast ignition experimental campaign performed at Institute of Laser Engineering, Osaka University. Applying the hot electron spectrum information from the electron spectrometer, an energy transfer efficiency of the incident LFEX [1], a kJ-class PW laser, to hot electrons was derived for a planar and cone-guided geometry.

  19. Electron beam optics design of variable energy beam transport line for a tunable infra-red free electron laser at RRCAT

    International Nuclear Information System (INIS)

    A variable energy electron beam transport line has been designed to transport a 15-25 MeV electron beam from the injector linac to the undulator of a tuneable infra-red free electron laser (IR-FEL) being built at the Raja Ramanna Centre for Advanced Technology ( RRCAT). Beam optics of this transport line, which uses a dog-leg type bend, has been designed to match the twiss parameters of the beam to that of the undulator as per FEL design requirements and keep the beam envelop within acceptable limits through out the transport line. In this paper, we discuss the evolution of design of electron beam optics from the linac to the undulator. (author)

  20. Westinghouse AP 1000 program status

    International Nuclear Information System (INIS)

    The project 1000 is presented and features are discussed in the paper. Design maturity is characterized by 1300 man-year / $400 million design and testing effort, more than 12 000 design documents completed; 3D computer model developed. It includes structures, equipment, small / large pipe, cable trays, ducts etc. Licensing Maturity is determined by a very thorough and complete NRC review of AP600; 110 man-year effort (NRC) over 6 years, $30 million; independent, confirmatory plant analysis; independent, confirmatory plant testing (ROSA, OSU); over 7400 questions answered, no open items; over 380 meeting with NRC, 43 meetings with ACRS. NRC Design Certification is issued in December 1999. Reasons for developing AP 1000 and design changes are presented. Economic analysis shows an expectation for payback within 20 years. AP1000 provides 75% power uprate for 15% increment in capital cost. AP1000 meets new plant economic targets in the near term

  1. Meet the APS Journal Editors

    Science.gov (United States)

    2016-05-01

    The Editors of the APS journals invite you to join them for conversation. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  2. Study of beam transport lines for a biomedical research facility at CERN based on LEIR

    CERN Document Server

    Abler, D; Garonna, A; Peach, K

    2014-01-01

    The Low Energy Ion Ring (LEIR) at CERN has been proposed to provide ion beams with magnetic rigidities up to 6.7 T.m for biomedical research, in parallel to its continued operation for LHC and SPS fixed target physics experiments. In the context of this project, two beamlines are proposed for transporting the extracted beam to future experimental end-stations: a vertical beamline for specific low-energy radiobiological research, and a horizontal beamline for radiobiology and medical physics experimentation. This study presents a first linear-optics design for the delivery of 1–5mm FWHM pencil beams and 5 cm 5 cm homogeneous broad beams to both endstations. High field uniformity is achieved by selection of the central part of a strongly defocused Gaussian beam, resulting in low beam utilisation.

  3. Design of the Prototype Low Energy Beam Transport Line for the Spallation Neutron Source

    International Nuclear Information System (INIS)

    The design of the Spallation Neutron Source (SNS) prototype low-energy beam transport (LEBT) system is discussed. This LEBT must transfer 35 mA of H- current from the ion source outlet aperture to the entrance of the radio-frequency quadrupole (RFQ). The plasma generator is a radio frequency-driven multicusp source, operated at 6% duty factor (1 ms, 60 Hz). The entire LEBT configuration is electrostatic, with a high-voltage extraction gap followed by two sets of einzel lenses. The second einzel lens will be split into four quadrants to permit the application of transverse steering and beam chopping fields. The H- ion source emits a gas flow into the LEBT that must be efficiently pumped to reduce stripping losses of the H- ions. Therefore, an efficient electrode design is incorporated to reduce the gas pressure between the electrodes. Alignment requirements and related issues will also be discussed

  4. Transport and dosimetric solutions for the ELIMED laser-driven beam line

    Czech Academy of Sciences Publication Activity Database

    Cirrone, G.A.P.; Romano, F.; Scuderi, Valentina; Amato, A.; Candiano, G.; Cuttone, G.; Giove, d.; Korn, Georg; Krása, Josef; Leanza, R.; Manna, R.; Maggiore, M.; Marchese, V.; Margarone, Daniele; Milluzzo, G.; Petringa, G.; Sabini, M.G.; Schillaci, F.; Tramontana, A.; Valastro, L.; Velyhan, Andriy

    2015-01-01

    Roč. 796, Oct (2015), s. 99-103. ISSN 0168-9002 R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk EE2.3.20.0279; GA MŠk EE2.3.30.0057 Grant ostatní: ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; Laser Zdroj (OP VK 3)(XE) CZ.1.07/2.3.00/20.0279; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : laser -driven ion * beam-transport * Faraday cup dosimetry * absolute dosimetry Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.216, year: 2014

  5. The West African Squall Line Observed on 23 June 1981 during COPT 81: Mesoscale Structure and Transports.

    Science.gov (United States)

    Chalon, J. P.; Jaubert, G.; Lafore, J. P.; Roux, F.

    1988-10-01

    Durirg the night of 23/24 June 1981, new Korhogo, Ivory Coast, a squall line passed over the instrumented area of the COPT 81 experiment. Observations were obtained with a dual-Doppler radar system, a sounding station and 22 automatic meteorological surface stations. Data from these instruments and from satellite pictures were analyzed to depict the kinematic and thermodynamic structure of the squall line. Composite analysis techniques were used to obtain a vertical cross section of the reflectivity structure and of the wind field relative to the line. The redistributions of air, moisture and thermodynamic energy by the convection wet calculated through averaged two-dimensional wind fields from a dual-Doppler radar system. The method also allowed the evaluation of the exchanges that were occurring between the convective and the stratiform regions.This squall line had many similarities with tropical squall lines previously described by others. The leading convective part, composed of intense updrafts and downdrafts, and the trailing part, containing weak mesoscale updraft and downdraft, were separated by a reflectivity trough. A notable feature of this line was the presence of a leading anvil induced by intense easterly environmental winds in the upper troposphere. Observations of the evolution of the system at different scales indicated that the mesoalpha-scale (following the classification of Orlanski) and the mosobeta-scale patterns combined to allow the system to have optimum conditions for maximum strength and a maximum lifetime.A rear-to-front flow was found at midlevels in the stratiform region. The flow sloped downward to the surface and took on the characteristics of a density current in the forward half of the squall lice. Entering the convective region, this flow was supplied with cold air by the convective downdrafts and played an important role in forcing upward the less dense monsoon flow entering at the leading edge.Calculations of mass, moisture and

  6. Epidermal growth factor decreases PEPT2 transport capacity and expression in the rat kidney proximal tubule cell line SKPT0193 cl.2

    DEFF Research Database (Denmark)

    Bravo, Silvina A; Nielsen, Carsten Uhd; Amstrup, Jan; Frokjaer, Sven; Brodin, Birger

    2004-01-01

    suggests that this might be disadvantageous when studying PEPT2-mediated transport phenomena. These findings demonstrate for the first time EGF-mediated regulation of PEPT2 expression in a kidney cell line. The relevance for kidney regulation of peptide transport activity in physiological and......The renal peptide transporter PEPT2 plays an important role in absorption of di- and tripetides in the proximal tubule; however, knowledge of regulation of PEPT2 by growth factors and hormones is limited. In the present study, we examined the effects of epidermal growth factor (EGF) on PEPT2...... transport capacity and expression in the rat proximal tubule cell line SKPT0193 cl.2 (SKPT), which expresses rat PEPT2 (rPEPT2) in the apical membrane. Treatment of SKPT cells with EGF during cell culture growth caused a dose-dependent decrease in rPEPT2 transport capacity and expression, as determined by...

  7. Transcription factor AP-2gamma is a developmentally regulated marker of testicular carcinoma in situ and germ cell tumors

    DEFF Research Database (Denmark)

    Hoei-Hansen, Christina E; Nielsen, John E; Almstrup, Kristian;

    2004-01-01

    . CONCLUSIONS: AP-2gamma is developmentally regulated and associated with the undifferentiated phenotype in germ cells. This transcription factor may be involved in self-renewal and survival of immature germ cells and tissue-specific stem cells. AP-2gamma is a novel marker of testicular CIS and CIS-derived...... protein level in normal human tissues and a panel of tumors and tumor-derived cell lines. In the gonads, we established the ontogeny of expression of AP-2gamma in normal and dysgenetic samples. We also investigated the regulation of AP-2gamma by steroids and retinoic acid. RESULTS: We detected abundant AP......-2gamma in testicular CIS and in testicular germ cell tumors of young adults and confirmed differential expression of AP-2gamma in somatic tumors. We found that AP-2gamma expression was regulated by retinoic acid in an embryonal carcinoma cell line (NT2). The investigation of ontogeny of AP-2gamma...

  8. Beam halo monitoring at J-PARC 3-50 beam transport line using long air ionization chamber

    International Nuclear Information System (INIS)

    3 long-type Air Ionization Chambers (AICs) have been installed along 350BT which is the beam transport from the 3GeV Rapid Cycling Synchrotron (RCS) to the Main Ring synchrotron (MR) to monitor beam losses. 3-50BT collimators are used to remove beam halo components outside the emittance larger than 54[πmm · mrad] for horizontal and 60[πmm · mrad] for vertical plane, at present operations. By measuring the beam loss induced radiations from the 3-50BT collimators, the beam halo components have been monitoring on line. Details of the system, calibration results, and resolution of the system will be described in this paper. (author)

  9. Gas Transport and Density Control in the HYLIFE Heavy-Ion Beam Lines

    International Nuclear Information System (INIS)

    The effective propagation and focusing of heavy-ion beams in the final-focus magnet region of inertial fusion target chambers require controlling the background gas density and pressure in the beam tubes. Liquid vortexes will coat the inside of the tubes next to the beam ports and will help eliminate the need for mechanical shutters to mitigate the venting of target chamber background gas into the final-focus magnet region. Before the neutralizing region, the beam space charge is high, and ablation and target debris deposition in the final-focus magnet region may cause voltage breakdown. Previous studies focused on evaluating the amount of target chamber debris reaching the entrance of the beam ports. The TSUNAMI code has now been used to assess the density, temperature, and velocity of the vortex debris transported ∼3 m up the beam tubes and reaching the final-focus magnet region, assuming that the liquid vortexes are perfectly absorbing surfaces. To further mitigate debris deposition in the final-focus magnet region, and prevent voltage breakdown, a 'magnetic shutter' has been envisaged to divert the debris out of the final-focus region. This shutter will prevent the hot ablation debris from reaching the magnet region and, coupled to some ionizing scheme, will conveniently suppress early ingression of debris into the final-focus magnet region

  10. A transverse emittance and acceptance measurement system in a low-energy beam transport line

    Energy Technology Data Exchange (ETDEWEB)

    Kashiwagi, H., E-mail: kashiwagi.hirotsugu@jaea.go.jp; Miyawaki, N.; Kurashima, S.; Okumura, S. [Department of Advanced Radiation Technology, Japan Atomic Energy Agency, 1233 Watanuki, Takasaki, Gunma 370-1292 (Japan)

    2014-02-15

    A transverse beam emittance and acceptance measurement system has been developed to visualize the relationship between the injected beam emittance and the acceptance of a cyclotron. The system is composed of a steering magnet, two pairs of slits to limit the horizontal and vertical phase-space, a beam intensity detector just behind the slits for the emittance measurement, and a beam intensity detector in the cyclotron for the acceptance measurement. The emittance is obtained by scanning the slits and measuring the beam intensity distribution. The acceptance is obtained by measuring the distribution of relative beam transmission by injecting small emittance beams at various positions in a transverse phase-space using the slits. In the acceptance measurement, the beam from an ion source is deflected to the defined region by the slits using the steering magnet so that measurable acceptance area covers a region outside the injection beam emittance. Measurement tests were carried out under the condition of accelerating a beam of {sup 16}O{sup 6+} from 50.2 keV to 160 MeV. The emittance of the injected beam and the acceptance for accelerating and transporting the beam to the entrance of the extraction deflector were successfully measured. The relationship between the emittance and acceptance is visualized by displaying the results in the same phase-plane.

  11. Railroad Lines - RAIL_SYSTEM_ACTIVE_ABANDONED_INDOT_IN: Active and Abandoned Rail System in Indiana, 2005 (Indiana Department of Transportation, 1:1200, Line Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — RAIL_SYSTEM_ACTIVE_ABANDONED_INDOT_IN is a line shapefile that contains all active and abandoned rail lines in Indiana, provided by personnel of Indiana Department...

  12. Conductive Na+ transport in an epithelial cell line (LLC-PK1) with characteristics of proximal tubular cells

    International Nuclear Information System (INIS)

    22Na influx and efflux from confluent monolayers of an epithelial cell line with multiple differentiated characteristics of the straight segment of the renal proximal tubule were studied in the presence and absence of a pH gradient. The results show that 22Na+ influx in the absence of a pH gradient is inhibited by amiloride as well as by complete replacement of Cl- by an impermeable anion, such as isethionate. Dissipation of cell membrane potential by increasing the potassium concentration of the extracellular medium in the presence of valinomycin also inhibited Na+ influx, whereas sodium influx induced by an H+ gradient was not affected. Inhibition of Na+ influx by different maneuvers produced hyperpolarization of the plasma cell membrane, as would be expected if the sodium movement involved net displacement of charges. Calcium and other divalent and trivalent cations also inhibited Na+ influx measured in the absence of an H+ gradient. Na+ influx induced by a pH gradient, however, was not affected. Like the Na+-H+-exchange system, the conductive Na+ pathway is localized in the apical membrane of the epithelial cells. From these results, the authors conclude that at least a fraction of transepithelial Na+ transport in LLC-PK1 monolayers occurs through a simple rheogenic transport system

  13. Theoretical insights on the electro-thermal transport properties of monolayer MoS2 with line defects

    Science.gov (United States)

    Saha, Dipankar; Mahapatra, Santanu

    2016-04-01

    Two dimensional (2D) materials demonstrate several novel electrical, mechanical, and thermal properties which are quite distinctive to those of their bulk form. Among many others, one important potential application of the 2D material is its use in the field of energy harvesting. Owing to that, here we present a detailed study on electrical as well as thermal transport of monolayer MoS2, in quasi ballistic regime. Besides the perfect monolayer in its pristine form, we also consider various line defects which have been experimentally observed in mechanically exfoliated MoS2 samples. For calculating various parameters related to the electrical transmission, we employ the non-equilibrium Green's function-density functional theory combination. However, to obtain the phonon transmission, we take help of the parametrized Stillinger-Weber potential which can accurately delineate the inter-atomic interactions for the monolayer MoS2. Due to the presence of line defects, we observed significant reductions in both the charge carrier and the phonon transmissions through a monolayer MoS2 flake. Moreover, we also report a comparative analysis showing the temperature dependency of the thermoelectric figure of merit values, as obtained for the perfect as well as the other defective 2D samples.

  14. Design of the medium energy beam transport (MEBT) line for the rare ion beam project at VECC

    International Nuclear Information System (INIS)

    The design of a 24 m long MEBT line connecting the accelerator LINAC 3 with LINAC 4 of the VECC-RIB project is presented. The design goal is to achieve a optimal solution for the transport of heavy ion beams, emerging from LINAC 3 with the mean energy of 414 KeV/u and q/A ≥ 1/14 so that the beam is well matched both in transverse and longitudinal direction at the entry of the LINAC 4. A charge stripper is placed before LINAC 4 in order to achieve higher charge to mass ratio (q/A ≥ 1/7). The presence of the charge stripper requires that the alpha and beta parameters of the beam both in X and Y plane should be very small at the charge stripper so that emittance blow up is less. The restrictions of space in the site compel us to make the line about 14 m long before it can be bent in a 90 degree achromatic bend. As we are using a charge stripper, mass dispersion must be high at the intermediate focal point between the two dipole magnets of the achromatic bend to select the desired ion species for acceleration in the subsequent acceleration stages. This rather long length (∼ 24 m) of the beam line requires two rebunchers to match the beam longitudinally at the entry of the LINAC 4. In this paper, the step by step procedure of achieving various requirements, viz, minimization of alpha and beta at the stripper, achromatic bend with appreciable mass dispersion in between the bending magnets and beam matching at LINAC 4 could be effectively met. (author)

  15. 一种新的小檗碱衍生物CPU-86017在人小肠上皮细胞(Caco-2细胞)中的转运与摄取特性%Transport and uptake characteristics of a new derivative of berberine (CPU-86017) by human intestinal epithelial cell line: Caco-2

    Institute of Scientific and Technical Information of China (English)

    杨海涛; 王广基

    2003-01-01

    AIM: The characteristics of transepithelial transport and uptake of CPU-86017 {[7-(4-chlorbenzyl)-7,8,13,13α tetrahydroberberine chloride, CTHB] }, a new antiarrhythmia agent and a new derivative of berberine, were investi gated on epithelial cell line (Caco-2) to further understand the absorption mechanism of berberine and its derivatives. METHODS: Caco-2 cell was used. RESULTS: 1) The permeability coefficient from the apical (AP) to basolateral (BL) of CPU-86017 was approximately 5 times higher than that from BL-to-AP transport. The effects of a P-glycoprotein (P-gp) inhibitor-cyclosporin A, some surfactants, and lower pH on the transepithelial transport of CPU-86017 were also observed. Cyclosporine A at 7.5 mg/L had no effect on the transepithelial electrical resistance (TEER); an about 4-fold enhancement on the transepithlial transport of CPU-86017 was observed. Some surfac tants (sodium citrate, sodium deoxycholate, and sodium dodecyl sulfate) at 100 μmol/L and low pH (pH=6.0) induced a reversible decrease of TEER; enhancements of the transepithelial transport of CPU-86017 were also observed with some surfactants; 2) In the process of uptake of CPU-86017, the initial uptake rates of CPU-86017 were saturable with a Vmax of (250+39) μg.min-1.g-1 (protein) and Km of (0.90+0.12) mmol/L. This process was enhanced by cyclosporine A (7.5 mg/L) with a Vmax of (588+49) μg.min-1.g-1 (protein) and Km (0.42+0.08) mmol/L. CONCLUSION: Some surfactants and P-gp inhibitors can be considered as enhancers of its transepithelial trans port and uptake.

  16. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  17. Charged-particle beam diagnostics for the Advanced Photon Source (APS)

    International Nuclear Information System (INIS)

    Plans, prototypes, and initial test results for the charged-particle beam (e-, e+) diagnostic systems on the injector rings, their transport lines, and the storage ring for the Advanced Photon Source (APS) are presented. The APS will be a synchrotron radiation user facility with one of the world's brightest x-ray sources in the 10-keV to 100-keV regime. Its 200-MeV electron linac, 450-MeV positron linac, positron accumulator ring, 7-GeV booster synchrotron, 7-GeV storage ring, and undulator test lines will also demand the development and demonstration of key particle-beam characterization techniques over a wide range of parameter space. Some of these parameter values overlap or approach those projected for fourth generation light sources (linac-driven FELs and high brightness storage rings) as described at a recent workshop. Initial results from the diagnostics prototypes on the linac test stand operating at 45-MeV include current monitor data, beam loss monitor data, and video digitization using VME architecture

  18. Overview of charged-particle beam diagnostics for the advanced photon source (APS)

    International Nuclear Information System (INIS)

    Plans, prototypes, and initial test results for the charged-particle beam (e-,e+) diagnostic systems on the injector rings, their transport lines, and the storage ring for the Advanced Photon Source (APS) are presented. The APS will be a synchrotron radiation user facility with one of the world's brightest x-ray sources in the 10-keV to 100-keV regime. Its 200-MeV electron linac, 450-MeV positron linac, positron accumulator ring, 7-GeV booster synchrotron, 7-GeV storage ring, and undulator test lines will also demand the development and demonstration of key particle-beam characterization techniques over a wide range of parameter space. Some of these parameter values overlap or approach those projected for fourth generation light sources (linac-driven FELs and high brightness storage rings) as described at a recent workshop. Initial results from the diagnostics prototypes on the linac test stand operating at 45-MeV include current monitor data, beam loss monitor data, and video digitization using VME architecture

  19. Transport

    International Nuclear Information System (INIS)

    Transport is one of the major causes of environmental damage in Austria. Energy consumption, pollutants emissions, noise emissions, use of surfaces, sealing of surfaces, dissection of ecosystems and impact on landscape are the most significant environmental impacts caused by it. An overview of the transport development of passengers and freight in Austria is presented. Especially the energy consumption growth, carbon dioxide and nitrogen oxide emissions by type of transport, and the emissions development (HC, particle and carbon monoxide) of goods and passengers transport are analyzed covering the years 1980 - 1999. The health cost resulting from transport-related air pollution in Austria is given and measures to be taken for an effective control of the transport sector are mentioned. Figs. 8, Table 1. (nevyjel)

  20. Pirt/scaling assessment for AP1000

    International Nuclear Information System (INIS)

    The AP1000 is an up-rated version of the AP600 passive plant design that recently received final design certification from the US NRC. Like AP600, the AP1000 is a two-loop, pressurized water reactor featuring passive core cooling and passive containment safety systems. As the AP1000 design is essentially a scaled-up version of the AP600, it is expected that the AP600 Phenomena Identification and Ranking Tables (PIRTs) and much of the AP600 test database should be applicable in applying for design certification for the AP1000. In an effort to confirm this for pursuit of a license, the PIRTs and test facility scaling are re-assessed in view of AP1000. (author)

  1. Expression, localization, and inducibility by bile acids of hepatobiliary transporters in the new polarized rat hepatic cell lines, Can 3-1 and Can 10.

    OpenAIRE

    Cassio, Doris; Macias, Rocio,; Grosse, Brigitte; Marin, Jose,; Monte, Maria,

    2007-01-01

    International audience Sinusoidal and apical transporters are responsible for the uptake and biliary elimination of many compounds by hepatocytes. Few in vitro models are however available for analyzing such functions. The expression and bile-acid inducibility of 13 transporters and two nuclear receptors were investigated in the new rat polarized lines, Can 3-1 and Can 10, and in their unpolarized parent, Fao. The relative abundance of mRNA, the protein level, and their localization were e...

  2. TRANSFECTED MDCK CELL LINE WITH ENHANCED EXPRESSION OF CYP3A4 AND P-GLYCOPROTEIN AS A MODEL TO STUDY THEIR ROLE IN DRUG TRANSPORT AND METABOLISM

    OpenAIRE

    Kwatra, Deep; Budda, Balasubramanyam; Vadlapudi, Aswani Dutt; Vadlapatla, Ramya Krishna; Pal, Dhananjay; Ashim K. Mitra

    2012-01-01

    The aim of this study was to characterize and utilize MDCK cell line expressing CYP3A4 and P-glycoprotein as an in vitro model for evaluating drug-herb and drug-drugs of abuse interactions. MDCK cell line simultaneously expressing P-gp and CYP3A4 (MMC) was developed and characterized by using expression and activity studies. Cellular transport study of 200 μM cortisol was performed to determine their combined activity. The study was carried across MDCK-WT, MDCK-MDR1 and MMC cell lines. Simila...

  3. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  4. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  5. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  6. MERCURE: a 3D industrial code for gamma rays transport by straight line attenuation method. Shielding applications

    International Nuclear Information System (INIS)

    The M.E.R.C.U.R.E. calculation code (version 6.3) simulate the photons transport from 15 keV to 10 MeV in three dimensional geometries between volume sources and calculation points. It is based in the integration of attenuation punctual nuclei in straight line with accumulation factors. The accumulation factors take into account the following physical phenomena: photoelectric effect, coherent diffusion, incoherent diffusion, pairs production, radiation secondary sources coming from Bremsstrahlung and fluorescence. The code determines the accumulation factor of a succession of several screens with an innovative iterative method. M.E.R.C.U.R.E. -6.3 integers the punctual nuclei by a Monte Carlo method for which it automatically determines the importance distributions. The results of this code are compared with these ones of the Sn T.W.O.D.A.N.T. code in two one-dimensional configurations. One includes five screens composed of four different materials and the other one three screens. In the configuration with three screens, the second screen is of an infinitesimal thickness. (N.C.)

  7. Beam profile analysis using the CCD camera with cameralink in the SPring-8 booster ring and beam transport line

    International Nuclear Information System (INIS)

    We had measured a beam position and beam size by the analog video camera system with the fluorescence plate in the SPring-8 booster ring and beam transport line. It was difficult to estimate the seasonal change of the beam position and size quantitatively. We started building up the digital beam profile acquisition system which used a digital CCD camera with the external trigger synchronous capturing function in 2007. In the accelerator parameter tuning between operation cycles, it is necessary to understand the change of a beam orbit and shape from latest cycle quickly in limited tuning time. Thus, we need both information of real-time picture images for visual confirmation and computing real-time analysis results of beam position and size. In this case, the LED light for reading the scale on the fluorescence plate becomes a background noise for a calculation of the beam profile analysis. We improved the analysis program of beam position and size in order to separates the LED light and beam light from a captured image. By this improvement, the reproducibility and adjustment accuracy of orbital steering have been improved. We will report the program flow and the details from an image capture to a beam profile analysis. (author)

  8. The new Cyclone 18/9 beam transport line at the CNA (Sevilla) for high energy PIXE applications

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Lopez, J. [Centro Nacional de Aceleradores, Avda. Thomas A. Edison No. 7, E-41092 Sevilla (Spain)], E-mail: fjgl@us.es; Ortega-Feliu, I.; Morilla, Y.; Ferrero, A. [Centro Nacional de Aceleradores, Avda. Thomas A. Edison No. 7, E-41092 Sevilla (Spain)

    2008-04-15

    The Cyclone 18/9 cyclotron system at the Centro Nacional de Aceleradores (Sevilla, Spain) is commonly used to create short life radioisotopes for PET applications. Besides, an external beam transport line has been recently installed in one of the target ports with two major purposes: to study the effects of 18 MeV protons irradiation on the behaviour of electronic devices for space applications and to complement the analysis of materials using our 3 MV tandem accelerator with the PIXE measurements at high energy. In this work, the main elements of our beamline will be briefly described and the first PIXE application will be presented. The usual PIXE, in the analysis of archaeological metallic objects, using around 3 MeV protons requires having a shiny area. Our purpose is to obtain a deeper determination of the bulk composition bombarding with 18 MeV protons through the corroded samples surfaces, without polishing the ancient object. To check this methodology high energy PIXE has been performed on two fibulae of the Later Bronze Age and First Iron Age, coming from the area around Sevilla.

  9. The new Cyclone 18/9 beam transport line at the CNA (Sevilla) for high energy PIXE applications

    International Nuclear Information System (INIS)

    The Cyclone 18/9 cyclotron system at the Centro Nacional de Aceleradores (Sevilla, Spain) is commonly used to create short life radioisotopes for PET applications. Besides, an external beam transport line has been recently installed in one of the target ports with two major purposes: to study the effects of 18 MeV protons irradiation on the behaviour of electronic devices for space applications and to complement the analysis of materials using our 3 MV tandem accelerator with the PIXE measurements at high energy. In this work, the main elements of our beamline will be briefly described and the first PIXE application will be presented. The usual PIXE, in the analysis of archaeological metallic objects, using around 3 MeV protons requires having a shiny area. Our purpose is to obtain a deeper determination of the bulk composition bombarding with 18 MeV protons through the corroded samples surfaces, without polishing the ancient object. To check this methodology high energy PIXE has been performed on two fibulae of the Later Bronze Age and First Iron Age, coming from the area around Sevilla

  10. Containment integrity analysis for the Westinghouse Advanced AP600

    International Nuclear Information System (INIS)

    Since 1987, Westinghouse has been performing containment cooling analyses in support of the advanced AP600 plant design. This analysis effort was intended to verify the feasibility of the passive containment cooling system (PCCS) features of the AP600 design, which is being jointly developed by Westinghouse, Burns and Roe Company, and Avondale Industries. To support this goal, the response of the AP600 containment has been analyzed for a large-break loss-of-coolant-accident (LOCA) and for a large steam line break (SLB). These cases were chosen based on the characteristic mass and energy releases each scenario would impose on the containment, with LOCA releases taxing the long-term heat-removal aspects while the SLB release typically defines the limiting short-term response. The transient results indicate that the PCCS design is feasible and capable of removing sufficient heat to limit containment pressure to within acceptable limits

  11. The AP-2 family of transcription factors

    OpenAIRE

    Eckert, Dawid; Buhl, Sandra; Weber, Susanne; Jäger, Richard; Schorle, Hubert

    2005-01-01

    The AP-2 family of transcription factors consists of five different proteins in humans and mice: AP-2α, AP-2β, AP-2γ, AP-2δ and AP-2ε. Frogs and fish have known orthologs of some but not all of these proteins, and homologs of the family are also found in protochordates, insects and nematodes. The proteins have a characteristic helix-span-helix motif at the carboxyl terminus, which, together with a central basic region, mediates dimerization and DNA binding. The amino terminus contains the tra...

  12. Design of medium energy beam transport line between the RFQ and the Linac in the radioactive ion beam facility at VECC, Kolkata

    Indian Academy of Sciences (India)

    S Dechoudhury; Vaishali Naik; Manas Mondal; Hemendra Kumar Pandey; Avik Chatterjee; Dirtha Sanyal; Debasis Bhowmick; Alok Chakrabarti

    2010-09-01

    The design of a medium energy beam transport (MEBT) line comprising of a re-buncher and four quadrupoles, two upstream and the other two downstream of the re-buncher, has been presented. The design was done to ensure almost 100% transport of heavy-ion beams of about 99 keV/u energy from RFQ having a / not less than 1/14 through the re-buncher and then through IH Linac of about 0.6 m length in which beam would be accelerated to about 185 keV/u. The re-buncher has been designed to operate at 37.8 MHz, the resonating frequency of both the RFQ and the IH Linac. The entire beam line has been installed and recently O5+ beam from RFQ has been transported through the re-buncher and subsequently accelerated in the IH Linac successfully.

  13. Design of a high-current low-energy beam transport line for an intense D-T/D-D neutron generator

    Science.gov (United States)

    Lu, Xiaolong; Wang, Junrun; Zhang, Yu; Li, Jianyi; Xia, Li; Zhang, Jie; Ding, Yanyan; Jiang, Bing; Huang, Zhiwu; Ma, Zhanwen; Wei, Zheng; Qian, Xiangping; Xu, Dapeng; Lan, Changlin; Yao, Zeen

    2016-03-01

    An intense D-T/D-D neutron generator is currently being developed at the Lanzhou University. The Cockcroft-Walton accelerator, as a part of the neutron generator, will be used to accelerate and transport the high-current low-energy beam from the duoplasmatron ion source to the rotating target. The design of a high-current low-energy beam transport (LEBT) line and the dynamics simulations of the mixed beam were carried out using the TRACK code. The results illustrate that the designed beam line facilitates smooth transportation of a deuteron beam of 40 mA, and the number of undesired ions can be reduced effectively using two apertures.

  14. Learning through delivery, Westinghouse AP1000 plant construction

    International Nuclear Information System (INIS)

    The AP1000 plant, which is a 1100 MWe class pressurized water reactor with passive safety features, is designed around a conventional 2 loop, 2 steam generator primary system configuration with 2 hot legs, 4 reactor coolant pumps directly mounted in the steam generator lower head and 4 cold legs. A particular feature of AP1000 is its modular construction to minimize the time and cost of construction. Modular construction allows activities to be run in parallel, it allows more activities to be performed in a controlled factory instead of in the field, and it provides a better level of quality. The AP1000 plant design includes 106 structural modules and 52 mechanical modules. Structural modules include all penetrations for piping, cable trays, HVAC duct runs, and all reinforcement for pipe, equipment hangers, and supports. Structural modules are shipped in sub-modules to support transportation by rail or truck or barge. Mechanical modules contain equipment such as pumps, tanks, heat exchangers, air-handling units, and filters along with interconnecting pipes, valves, instruments, wiring and support services. Modular construction requires strong coordination between engineering, supply chain and construction. A total of 8 AP1000 units are currently under construction in China and in the United States. The lessons learned and best practices of each new AP1000 construction are systematically incorporated into the standard design. (A.C.)

  15. Differential recognition of a dileucine-based sorting signal by AP-1 and AP-3 reveals a requirement for both BLOC-1 and AP-3 in delivery of OCA2 to melanosomes

    OpenAIRE

    Sitaram, Anand; Dennis, Megan K.; Chaudhuri, Rittik; De Jesus-Rojas, Wilfredo; Tenza, Danièle; Setty, Subba Rao Gangi; Wood, Christopher S.; Sviderskaya, Elena V.; Bennett, Dorothy C.; Raposo, Graça; Bonifacino, Juan S.; Marks, Michael S.

    2012-01-01

    Cell types that generate unique lysosome-related organelles (LROs), such as melanosomes in melanocytes, populate nascent LROs with cargoes that are diverted from endosomes. Cargo sorting toward melanosomes correlates with binding via cytoplasmically exposed sorting signals to either heterotetrameric adaptor AP-1 or AP-3. Some cargoes bind both adaptors, but the relative contribution of each adaptor to cargo recognition and their functional interactions with other effectors during transport to...

  16. Ectopic expression of Jatropha curcas APETALA1 (JcAP1) caused early flowering in Arabidopsis, but not in Jatropha

    Science.gov (United States)

    Tang, Mingyong; Tao, Yan-Bin

    2016-01-01

    Jatropha curcas is a promising feedstock for biofuel production because Jatropha oil is highly suitable for the production of biodiesel and bio-jet fuels. However, Jatropha exhibits a low seed yield as a result of unreliable and poor flowering. APETALA1 (AP1) is a floral meristem and organ identity gene in higher plants. The flower meristem identity genes of Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an AP1 homolog (JcAP1) was isolated from Jatropha. An amino acid sequence analysis of JcAP1 revealed a high similarity to the AP1 proteins of other perennial plants. JcAP1 was expressed in inflorescence buds, flower buds, sepals and petals. The highest expression level was observed during the early developmental stage of the flower buds. The overexpression of JcAP1 using the cauliflower mosaic virus (CaMV) 35S promoter resulted in extremely early flowering and abnormal flowers in transgenic Arabidopsis plants. Several flowering genes downstream of AP1 were up-regulated in the JcAP1-overexpressing transgenic plant lines. Furthermore, JcAP1 overexpression rescued the phenotype caused by the Arabidopsis AP1 loss-of-function mutant ap1-11. Therefore, JcAP1 is an ortholog of AtAP1, which plays a similar role in the regulation of flowering in Arabidopsis. However, the overexpression of JcAP1 in Jatropha using the same promoter resulted in little variation in the flowering time and floral organs, indicating that JcAP1 may be insufficient to regulate flowering by itself in Jatropha. This study helps to elucidate the function of JcAP1 and contributes to the understanding of the molecular mechanisms of flower development in Jatropha. PMID:27168978

  17. Ectopic expression of Jatropha curcas APETALA1 (JcAP1) caused early flowering in Arabidopsis, but not in Jatropha.

    Science.gov (United States)

    Tang, Mingyong; Tao, Yan-Bin; Xu, Zeng-Fu

    2016-01-01

    Jatropha curcas is a promising feedstock for biofuel production because Jatropha oil is highly suitable for the production of biodiesel and bio-jet fuels. However, Jatropha exhibits a low seed yield as a result of unreliable and poor flowering. APETALA1 (AP1) is a floral meristem and organ identity gene in higher plants. The flower meristem identity genes of Jatropha have not yet been identified or characterized. To better understand the genetic control of flowering in Jatropha, an AP1 homolog (JcAP1) was isolated from Jatropha. An amino acid sequence analysis of JcAP1 revealed a high similarity to the AP1 proteins of other perennial plants. JcAP1 was expressed in inflorescence buds, flower buds, sepals and petals. The highest expression level was observed during the early developmental stage of the flower buds. The overexpression of JcAP1 using the cauliflower mosaic virus (CaMV) 35S promoter resulted in extremely early flowering and abnormal flowers in transgenic Arabidopsis plants. Several flowering genes downstream of AP1 were up-regulated in the JcAP1-overexpressing transgenic plant lines. Furthermore, JcAP1 overexpression rescued the phenotype caused by the Arabidopsis AP1 loss-of-function mutant ap1-11. Therefore, JcAP1 is an ortholog of AtAP1, which plays a similar role in the regulation of flowering in Arabidopsis. However, the overexpression of JcAP1 in Jatropha using the same promoter resulted in little variation in the flowering time and floral organs, indicating that JcAP1 may be insufficient to regulate flowering by itself in Jatropha. This study helps to elucidate the function of JcAP1 and contributes to the understanding of the molecular mechanisms of flower development in Jatropha. PMID:27168978

  18. The Role of the Clathrin Adaptor AP-1: Polarized Sorting and Beyond

    Directory of Open Access Journals (Sweden)

    Fubito Nakatsu

    2014-11-01

    Full Text Available The selective transport of proteins or lipids by vesicular transport is a fundamental process supporting cellular physiology. The budding process involves cargo sorting and vesicle formation at the donor membrane and constitutes an important process in vesicular transport. This process is particularly important for the polarized sorting in epithelial cells, in which the cargo molecules need to be selectively sorted and transported to two distinct destinations, the apical or basolateral plasma membrane. Adaptor protein (AP-1, a member of the AP complex family, which includes the ubiquitously expressed AP-1A and the epithelium-specific AP-1B, regulates polarized sorting at the trans-Golgi network and/or at the recycling endosomes. A growing body of evidence, especially from studies using model organisms and animals, demonstrates that the AP-1-mediated polarized sorting supports the development and physiology of multi-cellular units as functional organs and tissues (e.g., cell fate determination, inflammation and gut immune homeostasis. Furthermore, a possible involvement of AP-1B in the pathogenesis of human diseases, such as Crohn’s disease and cancer, is now becoming evident. These data highlight the significant contribution of AP-1 complexes to the physiology of multicellular organisms, as master regulators of polarized sorting in epithelial cells.

  19. The APS control system network

    International Nuclear Information System (INIS)

    The APS accelerator control system is a distributed system consisting of operator interfaces, a network, and computer-controlled interfaces to hardware. This implementation of a control system has come to be called the open-quotes Standard Model.close quotes The operator interface is a UNDC-based workstation with an X-windows graphical user interface. The workstation may be located at any point on the facility network and maintain full functionality. The function of the network is to provide a generalized communication path between the host computers, operator workstations, input/output crates, and other hardware that comprise the control system. The crate or input/output controller (IOC) provides direct control and input/output interfaces for each accelerator subsystem. The network is an integral part of all modem control systems and network performance will determine many characteristics of a control system. This paper will describe the overall APS network and examine the APS control system network in detail. Metrics are provided on the performance of the system under various conditions

  20. Preparing Students for the AP Psychology Exam

    Science.gov (United States)

    Whitlock, Kristin

    2013-01-01

    The Advanced Placement Psychology exam is one of the fastest growing exams offered by the College Board. The average percent of change in the number of students taking this exam over the past five years is 12.4%. With 238,962 students taking the exam in 2013, the AP Psychology exam is the sixth largest exam, surpassing AP Biology and AP World…

  1. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  2. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  3. Development and UHV qualification of aluminium alloy vacuum chambers for transport line-2 of CTF-3, CERN

    International Nuclear Information System (INIS)

    CLIC Test Facility (CTF-3) at CERN is a project to demonstrate the concept of high frequency RF generation for the particle acceleration using a drive electron beam. 63 numbers of Aluminium alloy A6061T6 vacuum chambers for transport line-2 (TL-2) of CTF-3 were developed in RRCAT under joint collaboration between RRCAT and CERN. These chambers have Race Track (RT) and Cylindrical (CY) cross section. RT and CY, both type straight chambers as well as bent chambers (for the dipole magnets) were required for the TL-2. There were 22 numbers RT straight chamber, 31 numbers CY straight chamber, 5 numbers RT Bent chamber, 3 numbers CY bent chambers and 2 numbers CY Bent spare chambers. UHV Section was responsible for the qualification of demountable joints made of A6061T6 and also responsible for exhaustive UHV testing of these chambers. During the development, 5 numbers of different type of prototype chambers were fabricated and rigorously tested for leak tightness, qualification of demountable joints and desired ultimate vacuum using number of baking cycles. Helium mass spectrometer leak detector was utilised for leak detection at various stages for insuring the leak tightness better than1x10-10 mbar-l/s. For ultimate vacuum testing three setups were developed for the three types of different vacuum chambers. Each test setup consisted of Sputter Ion Pump, Turbo Molecular Pump, BA Gauge and Residual Gas Analyser. All these UHV setups were qualified for their ultimate vacuum in 10-10 mbar range. The arrangements were made such that, 4 to 8 straight chambers could be assembled and tested together in single cycle on each setup. Similar chambers were assembled with special Diamond shaped Aluminium seals with optimised sealing torque and leak tightness of -11 mbar-l/s was ensured. The aluminium chambers were baked at 150℃ where as the SS setups were baked at 250℃ for 24 hours and ultimate vacuum in the range of 10-10 mbar was achieved in all the sixteen test cycles

  4. AP1000 Features Prevent Potential Containment Recirculation Screen Plugging

    International Nuclear Information System (INIS)

    This paper presents the results of plant design development and evaluations that demonstrate that the AP1000 plant is not subject to potential containment recirculation screen plugging following a loss-of-coolant-accident (LOCA). Following a LOCA in a pressurized water reactor, it is necessary to recirculate water from the containment back into the reactor to maintain long term core cooling. The AP1000 utilizes passive safety systems to provide containment recirculation for long term core cooling following a LOCA. The AP1000 also has non-safety pumps which provide a backup means of providing recirculation. Screens are provided around the recirculation pipes to prevent debris from blocking recirculation flow and core cooling passages. Debris may be generated by the LOCA blowdown from insulation and coatings used inside containment. Even with effective cleanliness programs, there may be some resident debris such as dust and dirt. The potential for plugging the recirculation screens is a current PWR licensing issue. The AP1000 design provides inherent advantages with respect to the potential plugging of containment recirculation screens. These characteristics include prevention of fibrous debris generation, improved debris settling and improved recirculation screen design. Debris settling analysis demonstrates that failure of coatings does not result in debris being transported to the screens before it settles to the floor. Additional analysis also shows that the plant can tolerate conservative amounts of resident debris being transported to the screens. The AP1000 significantly reduces the probability of plugging the containment recirculation screens and significantly reduces inspection and maintenance of coatings used inside containment. (authors)

  5. Design of a medium-energy beam-transport line with an anti-chopper for the JAERI/KEK project

    International Nuclear Information System (INIS)

    The medium-energy beam-transport line (MEBT) plays an important role in reducing beam loss in the JAERI/KEK project. A MEBT was designed two years ago, with good beam matching and lower beam loss. To further reduce beam loss during the transient time of the chopper to meet the new requirement from the DTL, a medium-energy beam-transport line with an anti-chopper has been designed. The 3.5 m long transport line consists of nine quadrupole magnets, three bunchers and four chopper/anti-chopper cavities. It accomplishes two tasks: matching the beam from the RFQ to the acceptance of the DTL and chopping the beam to produce gaps for injection into the rapid-cycling ring, which follows the linac. A RF Chopper and an anti-chopper have been adopted in the lattice, resulting in a clean chopping effect and no beam losses during the transient time. Details of the beam dynamics analysis are given

  6. Construction of the beam profile monitor system with CameraLink in the SPring-8 booster ring and beam transport line

    International Nuclear Information System (INIS)

    We had measured the beam position and size in the SPring-8 booster ring and beam transport line by the monitor system that consists of analog video camera and fluorescent plate. It was difficult to estimate the seasonal change of the beam position and beam size between user operation cycles. In order to keep the high injection efficiency to SPring-8 storage ring, we need to achieve the tuning reproducibility of the accelerator parameter in the booster ring and beam transport line by using the quantitative data. The newly constructed beam profile monitor system consists of the digital CCD camera with external trigger synchronous capturing function, camera selectors, and server computers. Each camera system placed on the booster ring and beam transport line are managed by the UNIX server computer setup for each area. This system is connected by the cameralink configuration devices with cameralink cables or optical fiber cables. It became possible to capture image of beam profile synchronous with a beam trigger with a high resolution and a fast capturing time as same as it by using the analog video system. We will report the detail of beam profile monitor system with cameralink and the system operation. (author)

  7. Design of a medium-energy beam-transport line with an anti-chopper for the JAERI/KEK project

    International Nuclear Information System (INIS)

    The medium-energy beam-transport line (MEBT) plays an important role in reducing beam loss in the JAERI/KEK project. A MEBT was designed two years ago, with good beam matching and lower beam loss. To further reduce beam loss during the transient time of the chopper to meet the new requirement from the DTL, a medium-energy beam-transport line with an anti-chopper has been designed. The 3.5 m long transport line consists of nine quadrupole magnets, three bunchers and four chopper/anti-chopper cavities. It accomplishes two tasks: matching the beam from the RFQ to the acceptance of the DTL and chopping the beam to produce gaps for injection into the rapid-cycling ring, which follows the linac. An RF Chopper and an anti-chopper have been adopted in the lattice, resulting in a clean chopping effect, and no beam losses during the transient time. Details of the beam dynamics analysis are given. (author)

  8. Transport inhibition of digoxin using several common P-gp expressing cell lines is not necessarily reporting only on inhibitor binding to P-gp.

    Directory of Open Access Journals (Sweden)

    Annie Albin Lumen

    Full Text Available We have reported that the P-gp substrate digoxin required basolateral and apical uptake transport in excess of that allowed by digoxin passive permeability (as measured in the presence of GF120918 to achieve the observed efflux kinetics across MDCK-MDR1-NKI (The Netherlands Cancer Institute confluent cell monolayers. That is, GF120918 inhibitable uptake transport was kinetically required. Therefore, IC50 measurements using digoxin as a probe substrate in this cell line could be due to inhibition of P-gp, of digoxin uptake transport, or both. This kinetic analysis is now extended to include three additional cell lines: MDCK-MDR1-NIH (National Institute of Health, Caco-2 and CPT-B2 (Caco-2 cells with BCRP knockdown. These cells similarly exhibit GF120918 inhibitable uptake transport of digoxin. We demonstrate that inhibition of digoxin transport across these cell lines by GF120918, cyclosporine, ketoconazole and verapamil is greater than can be explained by inhibition of P-gp alone. We examined three hypotheses for this non-P-gp inhibition. The inhibitors can: (1 bind to a basolateral digoxin uptake transporter, thereby inhibiting digoxin's cellular uptake; (2 partition into the basolateral membrane and directly reduce membrane permeability; (3 aggregate with digoxin in the donor chamber, thereby reducing the free concentration of digoxin, with concomitant reduction in digoxin uptake. Data and simulations show that hypothesis 1 was found to be uniformly acceptable. Hypothesis 2 was found to be uniformly unlikely. Hypothesis 3 was unlikely for GF120918 and cyclosporine, but further studies are needed to completely adjudicate whether hetero-dimerization contributes to the non-P-gp inhibition for ketoconazole and verapamil. We also find that P-gp substrates with relatively low passive permeability such as digoxin, loperamide and vinblastine kinetically require basolateral uptake transport over that allowed by +GF120918 passive permeability, while

  9. Berberine inhibits cyclin D1 expression via suppressed binding of AP-1 transcription factors to CCND1 AP-1 motif

    Institute of Scientific and Technical Information of China (English)

    Ye LUO; Yu HAO; Tai-ping SHI; Wei-wei DENG; Na LI

    2008-01-01

    Aim: To verify the suppressive effect of berberine on the proliferation of the human pulmonary giant cell carcinoma cell line PG and to demonstrate the mecha-nisms behind the antitumoral effects of berberine. Methods: The proliferative effects of PG cells were detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide colorimetry. The cell cycle was examined by flow cytometry. The expression level of cyclin D1 was detected by RT-PCR. The activities of the activating protein-1 (AP-1) and NF-κB signaling pathways related to cyclin D1 were examined by luciferase assay. The cytoplasmic level of c-Jun was detected by Western blot analysis. An electrophoretic mobility shift assay was used to examiae the binding of transcription factors to the cyclin D1 gene (CCNDl) AP-1 motif. Results: The results showed that the proliferation of PG cells treated with different concentrations (10, 20, and 40 μg/mL) of berberine for 24 and 48 h was suppressed significantly compared to the control group. After treatment with berberine, the proportion of PG cells at the G0/G1 phase increased, while cells at the S and G2/M phases decreased. Berberine could inhibit the expression of cyclin D1 in PG cells. Berberine inhibited the activity of the AP-1 signaling pathway, but had no significant effect on the NF-κB signaling pathway. Berberine suppressed the expression of c-Jun and decreased the binding of tran-scription factors to the CCND1 AP-1 motif. Conclusion: Berberine suppresses the activity of the AP-1 signaling pathway and decreases the binding of transcrip-tion factors to the CCND1 AP-1 motif. This is one of the important mechanisms behind the antitumoral effects of berberine as a regulator of cyclin D1.

  10. APS high heat load monochromator

    Energy Technology Data Exchange (ETDEWEB)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach.

  11. APS high heat load monochromator

    International Nuclear Information System (INIS)

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  12. A simple, inexpensive tape system for on-line studies of short-lived nuclei transported by He-jet

    International Nuclear Information System (INIS)

    A simple tape transport system is described which is used for the collection of short-lived nuclides emerging from a He-jet recoil transport system. It is based on pistons driven by compressed air and is both inexpensive and reliable, and allows accurate and reproducible positioning of the radioactive sources at the counting position. (author)

  13. 77 FR 11192 - Fannin Rural Rail Transportation District-Lease and Operation Exemption-Line of Texas Department...

    Science.gov (United States)

    2012-02-24

    ... Paris to milepost 128.78 in Bonham, Tex. The line has been a part of Union Pacific Railroad Company's... extending between milepost 94.0, near Paris, and milepost 127.5, east of Bonham, in Lamar and Fannin Counties, Tex.\\1\\ After an agreement had been reached with UP for sale of the line but before...

  14. Discovery of the longest-period rapidly oscillating Ap star HD177765

    CERN Document Server

    Alentiev, D; Ryabchikova, T; Cunha, M; Tsymbal, V; Weiss, W

    2011-01-01

    We present the discovery of a long-period, rapidly oscillating Ap star, HD177765. Using high-resolution time-series observations obtained with UVES at the ESO VLT telescope, we found radial velocity variations with amplitudes 7-150 m/s and a period of 23.6 min, exceeding that of any previously known roAp star. The largest pulsation amplitudes are observed for Eu III, Ce III and for the narrow core of Halpha. We derived the atmospheric parameters and chemical composition of HD177765, showing this star to be similar to other long-period roAp stars. Comparison with theoretical pulsational models indicates an advanced evolutionary state for HD177765. Abundance analyses of this and other roAp stars suggest a systematic variation with age of the rare-earth line anomalies seen in cool Ap stars.

  15. Transcellular transport of radioiodinated 3-iodo-α-methyl-L-tyrosine across monolayers of kidney epithelial cell line LLC-PK1

    International Nuclear Information System (INIS)

    3-[123I]iodo-α-methyl-L-tyrosine ([123I]IMT) is an imaging agent for amino acid transport. In order to obtain fundamental data related to tumor imaging with [123I]IMT and renal physiological accumulation of [123I]IMT, we investigated the transport characteristics of [125I]IMT in porcine kidney epithelial cell line LLC-PK1 using cell monolayers grown on microporous membrane filters. LLC-PK1 monolayers were created on a collagen-coated microporous (3 μm) membrane (4.7 cm2). To examine transcellular transport (secretion and reabsorption) and accumulation, the monolayers were incubated for up to 90 min at 37 deg C with 18.5 kBq [125I]IMT in Dulbecco's phosphate-buffered saline (pH 7.4) as an uptake solution. After incubation, transcellular transport was assessed by quantifying the radioactivity of the solutions on each side of the monolayer. For the accumulation experiment, the cells were solubilized in NaOH solution, and the radioactivity was quantified. For the inhibition experiment, the inhibitor was added at a final concentration of 1 mM. For the pH dependence experiment, the pH of the apical-side uptake solution was varied from pH 5 to pH 8. Transport of [14C]Tyr was examined for comparison. Bi-directional transcellular transport of [125I]IMT was observed, corresponding to secretion and reabsorption in proximal tubule. Accumulation of [125I]IMT from the basolateral side (1.62±0.15%) and the apical side (2.62±0.35%) was observed at 90 min. 2-Amino-bicyclo[2,2,1]heptane-2-carboxylic acid (a specific inhibitor of system L), L-Tyr (mother compound of [125I]IMT) and 2-aminoisobutyric acid (an inhibitor of system L and A) inhibited both directional transport (p125I]IMT from both sides (p125I]IMT transport is system L, rather than Na+-dependent transport, in both apical and basolateral membrane. [125I]IMT was transported by the system that transported L-Tyr, but the observed pH dependence of transport suggests that different mechanisms are involved in accumulation of

  16. Tank 241AP104 Grab Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    TEMPLETON, A.M.

    2000-11-09

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AP-104. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AP-104 required to provide sample material to the Waste Treatment Contractor. Grab samples will be obtained from riser 001 to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives and ICD-23. The 222-S Laboratory will receive samples; composite the samples; perform chemical analyses on composite samples; and provide samples to the Waste Treatment Contractor and the Process Chemistry Laboratory. The Process Chemistry Laboratory at the 222-S Laboratory Complex will perform process tests to evaluate the behavior of the 241-AP-104 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. The Waste Treatment Contractor will perform process verification and waste form qualification tests. Requirements for analyses of samples originating in the L & H DQO process tests will be documented in the corresponding test plan (Person 2000) and are not within the scope of this SAP. This report provides the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from grab samples retrieved from tank 241-AP-104.

  17. Intermediate-break LOCA analyses for the AP600 design

    International Nuclear Information System (INIS)

    A postulated double-ended guillotine break of a direct-vessel-injection line in an AP600 plant has been analyzed. This event is characterized as an intermediate break loss-of-coolant accident (IBLOCA). Most of the insights regarding the response of the AP600 safety systems to the postulated accident are derived from calculations performed with the TRAC-PFl/MOD2 code. However, complementary insights derived from a scaled experiment conducted in the ROSA facility, as well as insights based upon calculations by other codes, are also presented. The key processes occurring in an AP600 during a IBLOCA are primary coolant system depressurization, inventory depletion, inventory replacement via emergency core coolant injection, continuous core cooling, and long-term decay heat rejection to the atmosphere. Based upon the calculated and experimental results, the AP600 will not experience a core heat up and will reach a safe shutdown state using only safety-class equipment. Only the early part of the long-term cooling period initiated by In-containment Refueling Water Storage Tank injection was evaluated Thus, the observation that the core is continuously cooled should be verified for the latter phase of the long-term cooling period, the interval when sump injection and containment cooling processes are important

  18. Mutations in AP3D1 associated with immunodeficiency and seizures define a new type of Hermansky-Pudlak syndrome.

    Science.gov (United States)

    Ammann, Sandra; Schulz, Ansgar; Krägeloh-Mann, Ingeborg; Dieckmann, Nele M G; Niethammer, Klaus; Fuchs, Sebastian; Eckl, Katja Martina; Plank, Roswitha; Werner, Roland; Altmüller, Janine; Thiele, Holger; Nürnberg, Peter; Bank, Julia; Strauss, Anne; von Bernuth, Horst; Zur Stadt, Udo; Grieve, Samantha; Griffiths, Gillian M; Lehmberg, Kai; Hennies, Hans Christian; Ehl, Stephan

    2016-02-25

    Genetic disorders affecting biogenesis and transport of lysosome-related organelles are heterogeneous diseases frequently associated with albinism. We studied a patient with albinism, neutropenia, immunodeficiency, neurodevelopmental delay, generalized seizures, and impaired hearing but with no mutation in genes so far associated with albinism and immunodeficiency. Whole exome sequencing identified a homozygous mutation in AP3D1 that leads to destabilization of the adaptor protein 3 (AP3) complex. AP3 complex formation and the degranulation defect in patient T cells were restored by retroviral reconstitution. A previously described hypopigmented mouse mutant with an Ap3d1 null mutation (mocha strain) shares the neurologic phenotype with our patient and shows a platelet storage pool deficiency characteristic of Hermansky-Pudlak syndrome (HPS) that was not studied in our patient because of a lack of bleeding. HPS2 caused by mutations in AP3B1A leads to a highly overlapping phenotype without the neurologic symptoms. The AP3 complex exists in a ubiquitous and a neuronal form. AP3D1 codes for the AP3δ subunit of the complex, which is essential for both forms. In contrast, the AP3β3A subunit, affected in HPS2 patients, is substituted by AP3β3B in the neuron-specific heterotetramer. AP3δ deficiency thus causes a severe neurologic disorder with immunodeficiency and albinism that we propose to classify as HPS10. PMID:26744459

  19. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document

  20. Railroad Lines - RAIL_CROSSINGS_INDOT_IN: Railroad Crossings in Indiana (Indiana Department of Transportation, 1:1200, Point Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — RAIL_CROSSINGS_INDOT_IN is a point shapefile that contains locations of rail crossings in Indiana, provided by personnel of Indiana Department of Transportation...

  1. Effect of radiation on the regulation of sodium-dependent glucose transport in LLC-PK1 epithelial cell line: possible model for gene expression

    International Nuclear Information System (INIS)

    Low concentrations of glucose induce cultured kidney epithelial cells (LLC-PK1) to produce hexose transport proteins. We have investigated the effects of ionizing radiation on this induction process in plateau-phase cultures. The induced production of hexose transporters, requiring approximately 6 to 9 days for complete expression, can be inhibited by irradiation during the first 4 days. After the fourth postinduction day, radiation sensitivity decreases with almost no radiation effect on the induction of hexose transport apparent by the sixth day of the induction period. The D0 value associated with the induction block is approximately 25 Gy, a value which is considerably greater than that necessary to inhibit cell replication. Hexose transport, itself resistant to ionizing radiation at doses in excess of 100 Gy, is sensitive to cycloheximide throughout the induction period. The sensitivity to cycloheximide decreases during the last 2 days of the induction period, approximately 1 day after the reduction in radiosensitivity. Based on these properties hexose transport may be a convenient model for the study of radiation effects upon gene expression in this cell line

  2. APS: Lighting up the future

    International Nuclear Information System (INIS)

    Work on the Advanced Photon Source (APS) at Argonne National Laboratory (ANL) involves the construction and supporting research and development for a national user facility for synchrotron radiation research in the x-ray region. The facility, when operational in 1997, will provide super-intense x-ray beams for many areas of basic research and will serve the entire US x-ray research community of several thousand users. This paper describes the pertinent features of the design, construction and planned operation of the facility; and the impact quality has had in these areas. In addition, the introduction of several quality management techniques such as total quality management, reliability/availability planning, and user interface are discussed concerning their status and success

  3. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin

    2012-01-01

    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  4. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  5. Transportation infrastructure between nuclear power plant gates and nearest line-haul networks: Plan and procedure for data development

    International Nuclear Information System (INIS)

    This study is concerned with the segments of the transportation system that include possible routings over public roads and private (or public) rail links, and waterway access (within 25 miles) from the gates of typical reactor sites to proximate links of what can be termed the national through-route system. These routings are by no means uniform throughout the United States. Local roads and rail links near reactor sites may be subject to a wide variety of jurisdictions for maintenance, repair, and inspection; may or may not (at present) qualify for federal assistance under the Federal-Aid Highway and related funding programs; may or may not meet accepted construction standards for facilities expected to bear heavy loads; and, perhaps most importantly for the spent-fuel transportation program, may be subject to occasional and currently unavoidable disruptions that could seriously impair shipment schedules. The overall objectives of the study are to describe a framework for identifying the characteristics of the near-site transportation networks of all existing nuclear power plants that could give rise to important shipment scheduling and programming constraints. These characteristics cover both transportation infrastructure and existing structural and environmental limitation, and define a scope and schedule for constructing a data base for the transportation networks surrounding all nuclear power plants. 6 refs., 4 figs., 8 tabs

  6. Mapping of the spontaneous deletion in the Ap3d1 gene of mocha mice: fast and reliable genotyping

    OpenAIRE

    Delenclos Marion; Holm Mai; Drasbek Kim; Jensen Kimmo

    2008-01-01

    Abstract Background The mocha mouse carries a spontaneous deletion in the Ap3d1 gene, encoding the delta 1 subunit of the adaptor related protein complex 3, (Ap3d1), and subsequently lack the expression of functional AP-3. This leads to a deficiency in vesicle transport and storage, which affects neurotransmitter vesicle turnover and release in the central nervous system. Since the genomic sequence of the Ap3d1 gene of mocha mouse is not known, precise mapping of the deletion as well as relia...

  7. Stokes IQUV mapping of $\\alpha^2$ CVn & other Ap stars using ESPaDOnS and NARVAL

    OpenAIRE

    Silvester, J.; Kochukhov, O.; Wade, G. A.

    2013-01-01

    New spectral line polarisation observations of 7 bright Ap stars have been obtained with the ESPaDOnS and Narval high resolution spectropolarimeters (Silvester et al. 2012). The aim of this data set is produce a series of surface magnetic field and surface chemistry maps for these Ap stars. We present new magnetic maps for the Ap star $\\alpha^2$ CVn using these new data and the MDI inversion code INVERS10. $\\alpha^2$ CVn is the first Ap star to be observed during two separate epochs using hig...

  8. Transport characteristics of L-carnosine and the anticancer derivative 4-toluenesulfonylureido-carnosine in a human epithelial cell line

    DEFF Research Database (Denmark)

    Nielsen, Carsten Uhd; Supuran, Claudiu T; Scozzafava, Andrea;

    2002-01-01

    The aim of the present study was to evaluate whether the transepithelial transport of the anticancer compound 4-toluenesulfonylureido-carnosine (Ts-carnosine) and the dipeptide moiety L-carnosine was due to a hPepT1 carrier-mediated flux.......The aim of the present study was to evaluate whether the transepithelial transport of the anticancer compound 4-toluenesulfonylureido-carnosine (Ts-carnosine) and the dipeptide moiety L-carnosine was due to a hPepT1 carrier-mediated flux....

  9. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  10. Coaching Strategies for AP: Building a Successful AP European History Program

    Science.gov (United States)

    Fornaciari, Jim

    2014-01-01

    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's…

  11. Installation Technology of AP1000 Steam Generator%AP1000蒸汽发生器安装技术

    Institute of Scientific and Technical Information of China (English)

    郑东宏; 王志强; 张明; 门昌华; 胡德全

    2013-01-01

    AP1000 nuclear power plant is a 3rd generation advanced passive 1000 MWe pressurized water reactor plant with two loops of reactor coolant systems .Compared with the conventional 2nd generation pressurized water reactor technology ,the steam generator ( SG) of AP1000 has many improved changes concerning SG property features and arrangement requirements for facilities within the nuclear island . Based on these improved changes and relevant installation practices ,the installation technology of AP 1000 SG has been introduced and analyzed including installation preparation ,transportation ,lifting,and instal-lation construction ,etc., with a view to provide a technical reference to the installation of main equip-ments in steam supply system of nuclear power plant .%AP1000是二环路的1000 MWe级压水堆三代核电厂,采用非能动安全设施,与传统的二代压水堆核电技术相比,蒸汽发生器本体特征和核岛内的就位要求均有较大的改进。根据AP1000蒸汽发生器自身的特点,并在实践的基础上,对蒸汽发生器的现场安装技术,包括安装准备、现场运输、吊装、核岛安装等进行了介绍和分析,为核电站核蒸汽供应系统主设备的现场运输、吊装和安装提供技术参考。

  12. The status of APS, BESSRC, and NEET.

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Dunford, R. W.; Esbensen, H.; Gemmell, D. S.; Kanter, E. P.; Kraessig, B.; Rutt, U.; Southworth, S. H.

    1999-03-10

    We present a brief summary of the current status of the Advanced Photon Source (APS) at Argonne National Laboratory and of the facilities at two of the APS sectors operated by the Basic Energy Sciences Synchrotrons Radiation Center (BESSRC). This is followed by a report on recent measurements at BESSRC on the phenomenon of Nuclear Excitation by Electronic Transition (NEET).

  13. The status of APS, BESSRC, and NEET

    International Nuclear Information System (INIS)

    We present a brief summary of the current status of the Advanced Photon Source (APS) at Argonne National Laboratory and of the facilities at two of the APS sectors operated by the Basic Energy Sciences Synchrotrons Radiation Center (BESSRC). This is followed by a report on recent measurements at BESSRC on the phenomenon of Nuclear Excitation by Electronic Transition (NEET)

  14. AP Courses Get Audited for Quality

    Science.gov (United States)

    Ashford, Ellie

    2007-01-01

    As the college admissions process has gotten much more competitive, the number of high school students taking Advanced Placement (AP) courses has soared. At the same time, policymakers and education leaders seek to get more minorities and students not on the college track to sign up for AP and other rigorous classes. But as high schools have…

  15. AP-42 ADDITIONS AND REVISIONS - WILDLAND FIRES

    Science.gov (United States)

    This project is aimed at consolidating, selecting, and disseminating the most appropriate data and methods for estimating air emissions from wildfires and prescribed burns. The product will replace a current section of AP-42, but may not take the precise form of an AP-42 secti...

  16. Kinetics and conductivity parameters of uptake and transport of polychlorinated biphenyls in the Caco-2 intestinal cell line model

    NARCIS (Netherlands)

    Dulfer, W.J.; Govers, H.A.J.; Groten, J.P.

    1998-01-01

    Most of the accumulation of polychlorinated biphenyls (PCBs) over the food chain can be attributed to contaminant uptake from food. The effect of fatty acid absorption on net uptake and transport fluxes of a selection of 14 PCBs over the organismal gut epithelium has been determined in monolayers of

  17. High-speed screen beam-profile-monitor system for high-energy beam-transport line at the HIMAC

    International Nuclear Information System (INIS)

    A screen monitor system was developed for beam profile monitors at the new High-Energy Beam-Transport (HEBT) section out the HIMAC. This monitor consists of the very thin fluorescent screen and the high-speed CCD camera. In addition to perform high-speed and high-resolution, this monitor does not almost destroy the beam. (author)

  18. Predicting gemcitabine transport and toxicity in human pancreatic cancer cell lines with the positron emission tomography tracer 3'-deoxy-3'-fluorothymidine.

    Science.gov (United States)

    Paproski, Robert J; Young, James D; Cass, Carol E

    2010-02-15

    The abundance of human equilibrative nucleoside transporter 1 (hENT1) has recently been shown to be a predictive marker of benefit from gemcitabine therapy in patients with pancreatic cancer. Since hENT1 is also important for the uptake of positron emission tomography (PET) tracer 3'-deoxy-3'-fluorothymidine (FLT) in various cultured human cell lines, this study was undertaken to determine if FLT uptake predicts gemcitabine uptake and/or toxicity in a panel of human pancreatic cancer cell lines (Capan-2, AsPC-1, BxPC-3, PL45, MIA PaCa-2, and PANC-1). Capan-2 cells displayed the lowest levels of (1) extracellular nitrobenzylmercaptopurine ribonucleoside (NBMPR) binding, which represents cell-surface hENT1, (2) FLT and gemcitabine uptake during short (1-45s) and prolonged (1h) periods, and (3) gemcitabine sensitivity. Exposure to NBMPR (inhibits only hENT1) or dilazep (inhibits hENT1 and hENT2) reduced FLT and gemcitabine uptake and gemcitabine sensitivity, with dilazep having greater effects than NBMPR. Gemcitabine permeation was almost completely mediated, primarily by hENT1 and to a lesser extent by hENT2, whereas FLT permeation included a substantial component of passive diffusion. In five of six cell lines, correlations were observed between (1) FLT and gemcitabine initial rates of uptake, (2) gemcitabine uptake and gemcitabine toxicity, (3) FLT uptake and gemcitabine toxicity, and (4) ribonucleotide reductase subunit M1 expression and gemcitabine toxicity. FLT and gemcitabine uptake were comparable for predicting gemcitabine toxicity in the tested pancreatic cancer cell lines suggesting that FLT PET may provide clinically useful information about tumor gemcitabine transport capacity and sensitivity. PMID:19788890

  19. Residual radiation studies at AP0

    Energy Technology Data Exchange (ETDEWEB)

    Alexander J Elwyn et al.

    2002-06-19

    The radiation environment at the NuMI experiment has received a lot of attention in the last few years in preparation for project construction. One important issue is the induced radioactivation of the components in the beam line and the shielding materials. This arises from irradiation by hadrons that are generated in the target. Since the level of the residual activity has to be considered when determining access procedures for maintenance during NuMI operation, an understanding of the properties of the remnant radiation is important. To this end, experimental studies were performed in the target vault at AP0 which is similar in design to the NuMI target area. Here 120 GeV protons bombard a target, generating the hadrons that produce the induced radioactivity. Two sets of samples each consisting of three small cylindrical or rectangular solids of iron and steel, one sample of aluminum, and one of concrete were irradiated. One set was hung just below the bottom of a module near the lithium lens (in-vault), and the other was placed on top of the modules downstream of this location (above-vault), just beneath the movable concrete roof of the vault at AP0. Further, four thin activation foils of Au, Au+Cd, In, and Al (along with small disks of the same iron, aluminum, and concrete samples discussed above) were mounted on four 10.2 cm diameter Al disks, one placed on the in-vault module and three at above-vault downstream locations as well. The radioactivity of all these materials on the 10.2 cm Al disks was determined at the Radioisotope Analysis Facility in an attempt to characterize the radionuclides produced during irradiation. The activities of the thin foils were employed in an effort to unfold a spectrum of the neutrons produced during the hadronic cascades in the target. The MARS Monte Carlo code (MO95, MO00) was used to predict and analyze the residual radiation produced during the beam irradiation. New subroutines have been developed for the MARS14 version

  20. Quantitative analysis of photoquadrats acquired at Johnston Atoll permanent transect site 1A-P on June 29, 2000

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This spreadsheet summarizes the number of corals photographed along a permanent transect line at Underwater Site 1A-P at Johnston Atoll on 6/29/2000.

  1. Quantitative analysis of photoquadrats acquired at Johnston Atoll permanent transect site 2A-P on June 30, 2000

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This spreadsheet summarizes the number of corals photographed along a permanent transect line at Underwater Site 2AP at Johnston Atoll on 6302000.

  2. Quantitative analysis of photoquadrats acquired at Johnston Atoll permanent transect site 3A-P on July 1, 2000

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This spreadsheet summarizes the number of corals photographed along a permanent transect line at Underwater Site 3AP at Johnston Atoll on 712000.

  3. APS undulator radiation: First results

    International Nuclear Information System (INIS)

    The first undulator radiation has been extracted from the Advanced Photon Source (APS). The results from the characterization of this radiation are very satisfactory. With the undulator set at a gap of 15.8 mm (K=1.61), harmonics as high as the 17th were observed using a crystal spectrometer. The angular distribution of the third-harmonic radiation was measured, and the source was imaged using a zone plate to determine the particle beam emittance. The horizontal beam emittance was found to be 6.9 ± 1.0 nm-rad, and the vertical emittance coupling was found to be less than 3%. The absolute spectral flux was measured over a wide range of photon energies, and it agrees remarkably well with the theoretical calculations based on the measured undulator magnetic field profile and the measured beam emittance. These results indicate that both the emittance of the electron beam and the undulator magnetic field quality exceed the original specifications

  4. The use of thioglycolate to distinguish between 3' AP (apurinic/apyrimidinic) endonucleases and AP lyases.

    OpenAIRE

    Bricteux-Grégoire, S; Verly, W G

    1989-01-01

    Addition of thioglycolate and DEAE-Sephadex chromatography were used to analyze the cleavage of the C(3')-O-P bond 3' to AP (apurinic/apyrimidinic) sites in DNA and to distinguish between a mechanism of hydrolysis (which would allow the nicking enzyme to be called 3' AP endonuclease) or beta-elimination (so that the nicking enzyme should be called AP lyase). For this purpose, DNA labelled in the AP sites was first cleaved by rat-liver AP endonuclease, then with the 3' nicking catalyst in the ...

  5. Dynamic analysis of Arabidopsis AP2 σ subunit reveals a key role in clathrin-mediated endocytosis and plant development.

    Science.gov (United States)

    Fan, Lusheng; Hao, Huaiqing; Xue, Yiqun; Zhang, Liang; Song, Kai; Ding, Zhaojun; Botella, Miguel A; Wang, Haiyang; Lin, Jinxing

    2013-09-01

    Clathrin-mediated endocytosis, which depends on the AP2 complex, plays an essential role in many cellular and developmental processes in mammalian cells. However, the function of the AP2 complex in plants remains largely unexplored. Here, we show in Arabidopsis that the AP2 σ subunit mutant (ap2 σ) displays various developmental defects that are similar to those of mutants defective in auxin transport and/or signaling, including single, trumpet-shaped and triple cotyledons, impaired vascular pattern, reduced vegetative growth, defective silique development and drastically reduced fertility. We demonstrate that AP2 σ is closely associated and physically interacts with the clathrin light chain (CLC) in vivo using fluorescence cross-correlation spectroscopy (FCCS), protein proximity analyses and co-immunoprecipitation assays. Using variable-angle total internal reflection fluorescence microscopy (VA-TIRFM), we show that AP2 σ-mCherry spots colocalize with CLC-EGFP at the plasma membrane, and that AP2 σ-mCherry fluorescence appears and disappears before CLC-EGFP fluorescence. The density and turnover rate of the CLC-EGFP spots are significantly reduced in the ap2 σ mutant. The internalization and recycling of the endocytic tracer FM4-64 and the auxin efflux carrier protein PIN1 are also significantly reduced in the ap2 σ mutant. Further, the polar localization of PIN1-GFP is significantly disrupted during embryogenesis in the ap2 σ mutant. Taken together, our results support an essential role of AP2 σ in the assembly of a functional AP2 complex in plants, which is required for clathrin-mediated endocytosis, polar auxin transport and plant growth regulation. PMID:23924631

  6. Colorectal cancer cell lines made resistant to SN38-and Oxaliplatin: Roles of altered ion transporter function in resistance?

    DEFF Research Database (Denmark)

    Sandra, Christensen; Jensen, Niels Frank; Stoeckel, Johanne Danmark; Belling, Kirstine C.; Romer, Maria Unni; Gupta, Ramneek; Brunner, Nils; Pedersen, Stine Helene Falsig; Stenvang, Jan

    2013-01-01

    resistance in HCT-116, HT-29 and LoVo cells. Microarray analysis and qPCR validation showed that mRNA expression of glutamate transporters SLC1A1 and SLC1A3 were markedly altered in resistant cells. Remarkably, mRNA levels of SLC1A3 were increased by ~40-and ~2500-fold in SN38-and Oxp-resistant HT29 cells...

  7. Experience in using based embedded controllers with EPICS environment for beam transport in SPES off-line target prototype

    International Nuclear Information System (INIS)

    EPICS was chosen as general framework to develop the control system of the SPES accelerator facility under construction at LNL in Italy. We report some experience in using some commercial devices based on Debian Linux to control the electrostatic deflectors installed on the beam line at the output of target chamber. We discuss this solution and compare it to other IOC implementations in use in the Target control system. (authors)

  8. Alaska-US gas line - design considerations for the Alaska segment of ANGTS (Alaska natural gas transportation system)

    Energy Technology Data Exchange (ETDEWEB)

    Hetland, N.

    1982-01-01

    In 1968, the largest single discovery of oil and natural gas ever found on the North American continent was made at Prudhoe Bay on the North Slope of Alaska. The Prudhoe Bay field contains over 26 tcf of recoverable natural gas, or ca 13% of the proven domestic gas reserves. To bring this natural gas to the market in the Lower 48 states, filings were made with the Federal Power Commission, the predecessor to the Federal Energy Regulatory Commission, to construct a pipeline transportation system. The gas pipeline project will initially transport ca 2 billion cu ft of gas daily, expandable to 3.2 billion cu ft/day with additional compressor stations. The total ANGTS comprises nearly 4,800 miles of pipeline with diameters ranging from 36 to 56 in., and initially ca 1.4 million hp will be installed to transport 2.0 billion cu ft/day. This presentation concentrates on the Alaska segment of the ANGTS.

  9. Parametric Study of the current limit within a single driver-scale transport beam line of an induction Linac for Heavy Ion Fusion

    International Nuclear Information System (INIS)

    The High Current Experiment (HCX) at Lawrence Berkeley National Laboratory is part of the US program that explores heavy-ion beam as the driver option for fusion energy production in an Inertial Fusion Energy (IFE) plant. The HCX is a beam transport experiment at a scale representative of the low-energy end of an induction linear accelerator driver. The primary mission of this experiment is to investigate aperture fill factors acceptable for the transport of space-charge-dominated heavy-ion beams at high intensity (line charge density ∼0.2 (micro)C/m) over long pulse durations (4 (micro)s) in alternating gradient focusing lattices of electrostatic or magnetic quadrupoles. This experiment is testing transport issues resulting from nonlinear space-charge effects and collective modes, beam centroid alignment and steering, envelope matching, image charges and focusing field nonlinearities, halo and, electron and gas cloud effects. We present the results for a coasting 1 MeV K+ ion beam transported through ten electrostatic quadrupoles. The measurements cover two different fill factor studies (60% and 80% of the clear aperture radius) for which the transverse phase-space of the beam was characterized in detail, along with beam energy measurements and the first halo measurements. Electrostatic quadrupole transport at high beam fill factor (∼80%) is achieved with acceptable emittance growth and beam loss. We achieved good envelope control, and re-matching may only be needed every ten lattice periods (at 80% fill factor) in a longer lattice of similar design. We also show that understanding and controlling the time dependence of the envelope parameters is critical to achieving high fill factors, notably because of the injector and matching section dynamics

  10. Electron stripping processes of H- ion beam in the 80 kV high voltage extraction column and low energy beam transport line at LANSCE

    Science.gov (United States)

    Draganic, I. N.

    2016-02-01

    Basic vacuum calculations were performed for various operating conditions of the Los Alamos National Neutron Science H- Cockcroft-Walton (CW) injector and the Ion Source Test Stand (ISTS). The vacuum pressure was estimated for both the CW and ISTS at five different points: (1) inside the H- ion source, (2) in front of the Pierce electrode, (3) at the extraction electrode, (4) at the column electrode, and (5) at the ground electrode. A static vacuum analysis of residual gases and the working hydrogen gas was completed for the normal ion source working regime. Gas density and partial pressure were estimated for the injected hydrogen gas. The attenuation of H- beam current and generation of electron current in the high voltage acceleration columns and low energy beam transport lines were calculated. The interaction of H- ions on molecular hydrogen (H2) is discussed as a dominant collision process in describing electron stripping rates. These results are used to estimate the observed increase in the ratio of electrons to H- ion beam in the ISTS beam transport line.

  11. Electron stripping processes of H− ion beam in the 80 kV high voltage extraction column and low energy beam transport line at LANSCE

    International Nuclear Information System (INIS)

    Basic vacuum calculations were performed for various operating conditions of the Los Alamos National Neutron Science H− Cockcroft-Walton (CW) injector and the Ion Source Test Stand (ISTS). The vacuum pressure was estimated for both the CW and ISTS at five different points: (1) inside the H− ion source, (2) in front of the Pierce electrode, (3) at the extraction electrode, (4) at the column electrode, and (5) at the ground electrode. A static vacuum analysis of residual gases and the working hydrogen gas was completed for the normal ion source working regime. Gas density and partial pressure were estimated for the injected hydrogen gas. The attenuation of H− beam current and generation of electron current in the high voltage acceleration columns and low energy beam transport lines were calculated. The interaction of H− ions on molecular hydrogen (H2) is discussed as a dominant collision process in describing electron stripping rates. These results are used to estimate the observed increase in the ratio of electrons to H− ion beam in the ISTS beam transport line

  12. Altered retinal cell differentiation in the AP-3 delta mutant (Mocha) mouse.

    Science.gov (United States)

    Baguma-Nibasheka, Mark; Kablar, Boris

    2009-11-01

    Adaptor-related protein complex 3 delta 1 (Ap3d1) encodes the delta 1 subunit of an adaptor protein regulating intracellular vesicle-mediated transport, and the Ap3d-deletion mutant (Mocha) mouse undergoes rapid photoreceptor degeneration leading to blindness soon after birth. Previous microarray analysis revealed Ap3d down-regulation in the retina of mouse embryos specifically lacking cholinergic amacrine cells as a result of the absence of skeletal musculature. To investigate the role of Ap3d in the determination of retinal cell fate, the present study examined retinal morphology in newborn Ap3d-/- mice. The Ap3d-/- retina showed a complete absence of cholinergic amacrine cells and a decrease in parvalbumin-expressing amacrine cells and syntaxin- and VC1.1-expressing amacrine precursor cells, but had a normal number of cell layers and number of cells in each layer with no detectable difference in cell proliferation or apoptosis. These findings indicate that, despite having no apparent effect on the basic spatial organization of the retina at this stage of development, Ap3d could be involved in the regulation of progenitor cell competence and the eventual ratio of resulting differentiated cells. Finding the mouse mutant which phenocopies the eye defect seen in fetuses with no striated muscle was accomplished by the Systematic Subtractive Microarray Analysis Approach (SSMAA), explained in the discussion section. PMID:19631730

  13. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.

    1999-08-12

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  14. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  15. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded

  16. Standardized safety management of AP1000 nuclear power plant

    International Nuclear Information System (INIS)

    In 2002, China published and implemented the Law of the People's Republic of China on Work Safety and promulgated a series of guidelines and policies, which strengthened the safety management supervision. Standardization of safety, as another important step on safety supervision, comes after safety assesment and safety production licensing system, is also a permanent solution. Standardization of safety is a strategic, long term and fundamental work, which is also the basic access to achieving scientific safety management and increasing the inherent safety of an enterprise. Haiyang AP1000 nuclear power plant, adopting the modularized, 'open-top' and parallel construction means, overturned the traditional construction theory of installation work comes after the civil work and greatly shorten the construction period. At the same time, the notable increase of oversize module transportation and lifting and parallel construction raises higher demands for safety management. This article combines the characteristics and difficulties of safety management for Haiyang AP1000 nuclear power plant, puts forward ideas and methods for standardized safety management, and could also serve as reference to the safety management for other AP1000 projects. (authors)

  17. Constitutively internalized dopamine transporter is targeted to late endosomes and lysosomal degradation in heterologous cell lines and dopaminergic neurons

    DEFF Research Database (Denmark)

    Eriksen, Jacob; Madsen, Kenneth; Vægter, Christian Bjerggaard;

    amphetamine, a substrate of the DAT. In antibody feeding experiments we observed that Tac-DAT was constitutively internalized faster than Tac alone and using an ELISA based assay we could quantify time-dependent intracellular accumulation of the transporter. Incubation with inhibitors of lysosomal degradation...... dopaminergic neurons and visualized the DAT directly in the neurons using the fluorescent cocaine analog JHC 1-064. These data showed pronounced colocalization upon constitutive internalization with Lysotracker, a late endosomal/lysosomal marker; however only little co-lolization was observed with Alexa488...

  18. DEVELOPMENT OF SUPERCONDUCTING COMBINED FUNCTION MAGNETS FOR THE PROTON TRANSPORT LINE FOR THE J-PARC NEUTRINO EXPERIMENT

    International Nuclear Information System (INIS)

    Superconducting combined function magnets will be utilized for the 50 GeV, 750 kW proton beam line for the J-PARC neutrino experiment. The magnet is designed to provide a dipole field of 2.6 T combined with a quadrupole field of 19 T/m in a coil aperture of 173.4 mm at a nominal current of 7345 A. Two full-scale prototype magnets to verify the magnet performance were successfully developed. The first prototype experienced no training quench during the excitation test and good field quality was confirmed

  19. AP600-passive containment cooling system structure design and analysis

    International Nuclear Information System (INIS)

    The purpose of this paper is to present the design and analysis activities for the structures of AP 600 passive containment cooling system (PCCS). This design is being performed jointly by Ansaldo and Westinghouse as a part of the AP 600 program under the overall leadership of Westinghouse. The AP 600 is a 600 MWe advanced light water reactor that is being designed with passive safety features. The PCCS structures consist of the shield building roof which includes a 400,000 gallon water tank and the PCCS air baffles which direct air flow over the outside of a steel containment vessel to provide the passive cooling of the containment. Two different configurations have been investigated for the shield building roof. One is a flat roof with deep steel girders and a concrete slab with the water tank integral with the steel girders. Another is a conical concrete roof with a steel-lined reinforced concrete tank. Three different options for the water tank have been analyzed. The function of the air baffles is to provide a pathway for natural circulation in a postulated design basis event resulting in large energy release into a containment. (K.I.)

  20. Over-expression of the PaAP1 gene from sweet cherry (Prunus avium L.) causes early flowering in Arabidopsis thaliana.

    Science.gov (United States)

    Wang, Jing; Zhang, Xiaoming; Yan, Guohua; Zhou, Yu; Zhang, Kaichun

    2013-02-15

    A homologue of SQUAMOSA/APETALA1, designated PaAP1, was isolated from Prunus avium by reverse transcription-PCR (RT-PCR). The full length of PaAP1 cDNA is 753 bp, and it codes for a polypeptide of 250 amino acid residues. Sequence comparison revealed that PaAP1 belongs to the MADS-box gene family. Phylogenetic analysis indicated that PaAP1 shared the highest identity with SQUA/AP1 homologues from Prunus serrulata. Real-time fluorescence quantitative PCR analysis showed that PaAP1 was expressed at high levels in petal, sepal, style, and flower buds, which was slightly different from the expression pattern of AP1 of Arabidopsis thaliana. To characterize the functions of PaAP1, we assessed Arabidopsis transformed with 35S::PaAP1. A total of 8 transgenic T(1) lines with an early flowering phenotype were obtained, and a 3:1 segregation ratio of flowering time was observed in the T(2) generation of 4 lines. This study provides the first functional analysis of an SQUA/AP1 homolog from P. avium and suggests that PaAP1 is potentially useful for shortening the juvenile period in sweet cherry. PMID:23206932

  1. Development of Superconducting Combined Function Magnets for the Proton Transport Line for the J-PARC Neutrino Experiments

    CERN Document Server

    Nakamoto, Tatsushi; Anerella, Michael; Escallier, John; Fujii, T; Fukui, Yuji; Ganetis, George; Gupta, Ramesh C; Harrison, Michael; Hashiguchi, E; Higashi, Norio; Ichikawa, Atsuko; Iwamoto, Yosuke; Jain, Animesh K; Kanahara, T; Kimura, Nobuhiro; Kobayashi, Takashi; Makida, Yasuhiro; Muratore, Joseph F; Obana, Tetsuhiro; Ogitsu, T; Ohhata, Hirokatsu; Okamura, T; Orikasa, T; Parker, Brett; Sasaki, Ken Ichi; Takasaki, Minoru; Tanaka, Ken Ichi; Terashima, Akio; Tomaru, Takayuki; Wanderer, Peter; Yamamoto, Akira

    2005-01-01

    A second generation of long-baseline neutrino oscillation experiments has been proposed as one of the main projects at J-PARC jointly built by JAERI and KEK. Superconducting combined function magnets, SCFMs, will be utilized for the 50 GeV, 750 kW proton beam line for the neutrino experiment and an R&D program is in underway at KEK. The magnet is designed to provide a combined function of a dipole field of 2.6 T with a quadrupole field of 19 T/m in a coil aperture of 173.4 mm. A series of 28 magnets in the beam line will be operated DC in supercritical helium cooling below 5 K. A design feature of the SCFM is the left-right asymmetry of the coil cross section: current distributions for superimposed dipole- and quadrupole- fields are combined in a single layer coil. Another design feature is the adoption of glass-fiber reinforced phenolic plastic spacers to replace the conventional metallic collars. To evaluate this unique design, fabrication of full-scale prototype magnets is in progress at KEK and the fi...

  2. Analysis of large scale tests for AP-600 passive containment cooling system

    International Nuclear Information System (INIS)

    One unique feature of the AP-600 is its passive containment cooling system (PCCS), which is designed to maintain containment pressure below the design limit for 72 hours without action by the reactor operator. During a design-basis accident, i.e., either a loss-of-coolant or a main steam-line break accident, steam escapes and comes in contact with the much cooler containment vessel wall. Heat is transferred to the inside surface of the steel containment wall by convection and condensation of steam and through the containment steel wall by conduction. Heat is then transferred from the outside of the containment surface by heating and evaporation of a thin liquid film that is formed by applying water at the top of the containment vessel dome. Air in the annual space is heated by both convection and injection of steam from the evaporating liquid film. The heated air and vapor rise as a result of natural circulation and exit the shield building through the outlets above the containment shell. All of the analytical models that are developed for and used in the COMMIX-ID code for predicting performance of the PCCS will be described. These models cover governing conservation equations for multicomponents single phase flow, transport equations for the κ-ε two-equation turbulence model, auxiliary equations, liquid-film tracking model for both inside (condensate) and outside (evaporating liquid film) surfaces of the containment vessel wall, thermal coupling between flow domains inside and outside the containment vessel, and heat and mass transfer models. Various key parameters of the COMMIX-ID results and corresponding AP-600 PCCS experimental data are compared and the agreement is good. Significant findings from this study are summarized

  3. Knockdown of CDK2AP1 in primary human fibroblasts induces p53 dependent senescence.

    Directory of Open Access Journals (Sweden)

    Khaled N Alsayegh

    Full Text Available Cyclin Dependent Kinase-2 Associated Protein-1 (CDK2AP1 is known to be a tumor suppressor that plays a role in cell cycle regulation by sequestering monomeric CDK2, and targeting it for proteolysis. A reduction of CDK2AP1 expression is considered to be a negative prognostic indicator in patients with oral squamous cell carcinoma and also associated with increased invasion in human gastric cancer tissue. CDK2AP1 overexpression was shown to inhibit growth, reduce invasion and increase apoptosis in prostate cancer cell lines. In this study, we investigated the effect of CDK2AP1 downregulation in primary human dermal fibroblasts. Using a short-hairpin RNA to reduce its expression, we found that knockdown of CDK2AP1 in primary human fibroblasts resulted in reduced proliferation and in the induction of senescence associated beta-galactosidase activity. CDK2AP1 knockdown also resulted in a significant reduction in the percentage of cells in the S phase and an accumulation of cells in the G1 phase of the cell cycle. Immunocytochemical analysis also revealed that the CDK2AP1 knockdown significantly increased the percentage of cells that exhibited γ-H2AX foci, which could indicate presence of DNA damage. CDK2AP1 knockdown also resulted in increased mRNA levels of p53, p21, BAX and PUMA and p53 protein levels. In primary human fibroblasts in which p53 and CDK2AP1 were simultaneously downregulated, there was: (a no increase in senescence associated beta-galactosidase activity, (b decrease in the number of cells in the G1-phase and increase in number of cells in the S-phase of the cell cycle, and (c decrease in the mRNA levels of p21, BAX and PUMA when compared with CDK2AP1 knockdown only fibroblasts. Taken together, this suggests that the observed phenotype is p53 dependent. We also observed a prominent increase in the levels of ARF protein in the CDK2AP1 knockdown cells, which suggests a possible role of ARF in p53 stabilization following CDK2AP1

  4. A novel dopamine transporter transgenic mouse line for identification and purification of midbrain dopaminergic neurons reveals midbrain heterogeneity

    DEFF Research Database (Denmark)

    Christiansen, Mia Apuschkin; Stilling, Sara; Rahbek-Clemmensen, Troels;

    2015-01-01

    Midbrain dopaminergic (DAergic) neurons are a heterogeneous cell group, composed of functionally distinct cell populations projecting to the basal ganglia, prefrontal cortex and limbic system. Despite their functional significance, the midbrain population of DAergic neurons is sparse, constituting...... dopamine transporter (DAT) promoter was characterized. Confocal microscopy analysis of brain sections showed strong eGFP signal reporter in midbrain regions and striatal terminals that co-localized with the DAergic markers DAT and tyrosine hydroxylase (TH). Thorough quantification of co-localization of the...... synaptosomal DA uptake nor altered levels of DAT and TH in both striatum and midbrain. No behavioural difference between Dat1-eGFP and wild-type was found, suggesting that the strain is not aberrant. Finally, cell populations highly enriched in DAergic neurons can be obtained from postnatal mice by...

  5. Auxin Transport and Ribosome Biogenesis Mutant/Reporter Lines to Study Plant Cell Growth and Proliferation under Altered Gravity

    Science.gov (United States)

    Valbuena, Miguel A.; Manzano, Ana I.; van Loon, Jack JWA.; Saez-Vasquez, Julio; Carnero-Diaz, Eugenie; Herranz, Raul; Medina, F. J.

    2013-02-01

    We tested different Arabidopsis thaliana strains to check their availability for space use in the International Space Station (ISS). We used mutants and reporter gene strains affecting factors of cell proliferation and cell growth, to check variations induced by an altered gravity vector. Seedlings were grown either in a Random Positioning Machine (RPM), under simulated microgravity (μg), or in a Large Diameter Centrifuge (LDC), under hypergravity (2g). A combination of the two devices (μgRPM+LDC) was also used. Under all gravity alterations, seedling roots were longer than in control 1g conditions, while the levels of the nucleolar protein nucleolin were depleted. Alterations in the pattern of expression of PIN2, an auxin transporter, and of cyclin B1, a cell cycle regulator, were shown. All these alterations are compatible with previous space data, so the use of these strains will be useful in the next experiments in ISS, under real microgravity.

  6. The AP-3 adaptor complex is required for vacuolar function in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    Maria Zwiewka; Elena Feraru; Barbara M(o)ller; Inhwan Hwang; Mugurel I Feraru; Jürgen Kleine-Vehn; Dolf Weijers; Ji(n) Friml

    2011-01-01

    Subcellular trafficking is required for a multitude of functions in eukaryotic cells.It involves regulation of cargo sorting,vesicle formation,trafficking and fusion processes at multiple levels.Adaptor protein (AP) complexes are key regulators of cargo sorting into vesicles in yeast and mammals but their existence and function in plants have not been demonstrated.Here we report the identification of the protein-affected trafficking 4 (pat4) mutant defective in the putative δ subunit of the AP-3 complex.pat4 and pat2,a mutant isolated from the same GFP imaging-based forward genetic screen that lacks a functional putative AP-3 β,as well as dominant negative AP-3 μ transgenic lines display undistinguishable phenotypes characterized by largely normal morphology and development,but strong intracellular accumulation of membrane proteins in aberrant vacuolar structures.All mutants are defective in morphology and function of lytic and protein storage vacuoles (PSVs) but show normal sorting of reserve proteins to PSVs.Immunoprecipitation experiments and genetic studies revealed tight functional and physical associations of putative AP-3 β and AP-3 δ subunits.Furthermore,both proteins are closely linked with putative AP-3 μ and σ subunits and several components of the clathrin and dynamin machineries.Taken together,these results demonstrate that AP complexes,similar to those in other eukaryotes,exist in plants,and that AP-3 plays a specific role in the regulation of biogenesis and function of vacuoles in plant cells.

  7. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  8. The Role of Monocarboxylate Transporters and Their Chaperone CD147 in Lactate Efflux Inhibition and the Anticancer Effects of Terminalia chebula in Neuroblastoma Cell Line N2-A

    Science.gov (United States)

    Messeha, S. S.; Zarmouh, N. O.; Taka, E.; Gendy, S. G.; Shokry, G. R.; Kolta, M. G.; Soliman, K. F. A.

    2016-01-01

    Aims In the presence of oxygen, most of the synthesized pyruvate during glycolysis in the cancer cell of solid tumors is released away from the mitochondria to form lactate (Warburg Effect). To maintain cell homeostasis, lactate is transported across the cell membrane by monocarboxylate transporters (MCTs). The major aim of the current investigation is to identify novel compounds that inhibit lactate efflux that may lead to identifying effective targets for cancer treatment. Study Design In this study, 900 ethanol plant extracts were screened for their lactate efflux inhibition using neuroblastoma (N2-A) cell line. Additionally, we investigated the mechanism of inhibition for the most potent plant extract regarding monocarboxylate transporters expression, and consequences effects on viability, growth, and apoptosis. Methodology The potency of lactate efflux inhibition of ethanol plant extracts was evaluated in N2-A cells by measuring extracellular lactate levels. Caspase 3- activity and acridine orange/ethidium bromide staining were performed to assess the apoptotic effect. The antiproliferative effect was measured using WST assay. Western blotting was performed to quantify protein expression of MCTs and their chaperone CD147 in treated cells lysates. Results Terminalia chebula plant extract was the most potent lactate efflux inhibitor in N2-A cells among the 900 - tested plant extracts. The results obtained show that extract of Terminalia chebula fruits (TCE) significantly (P = 0.05) reduced the expression of the MCT1, MCT3, MCT4 and the chaperone CD147. The plant extract was more potent (IC50 of 3.59 ± 0.26 μg/ml) than the MCT standard inhibitor phloretin (IC50 76.54 ± 3.19 μg/ml). The extract also showed more potency and selective cytotoxicity in cancer cells than DI-TNC1 primary cell line (IC50 7.37 ± 0.28 vs. 17.35 ± 0.19 μg/ml). Moreover, TCE Inhibited N2-A cell growth (IG50 = 5.20 ± 0.30 μg/ml) and induced apoptosis at the 7.5 μg/ml concentration

  9. Microcystin-LR induces anoikis resistance to the hepatocyte uptake transporter OATP1B3-expressing cell lines

    International Nuclear Information System (INIS)

    Microcystin-LR is a cyclic peptide released by several bloom-forming cyanobacteria. Understanding the mechanism of microcystin-LR toxicity is important, because of the both potencies of its acute cytotoxicity and tumor-promoting activity in hepatocytes of animals and humans. Recently, we have reported that the expression of human hepatocyte uptake transporter OATP1B3 was critical for the selective uptake of microcystin-LR into hepatocytes and for induction of its fatal cytotoxicity. In this study, we demonstrated a novel function of microcystin-LR which induced bipotential changes including anoikis resistance and cytoskeleton reorganization to OATP1B3-transfected HEK293 cells (HEK293-OATP1B3). After exposure to microcystin-LR, HEK293-OATP1B3 cells were divided to the floating cells and remaining adherent cells. After collection and reseeding the floating cells into a fresh flask, cells were confluently proliferated (HEK293-OATP1B3-FL) under the microcystin-LR-free condition. Both the proliferated HEK293-OATP1B3-FL and remaining adherent HEK293-OATP1B3-AD cells changed the character with down- and up-regulation of E-cadherin, respectively. Additionally, these cells acquired resistance to microcystin-LR. These results suggest that microcystin-LR could be associated with not only tumor promotion, but also epithelial–mesenchymal transition-mediated cancer metastasis. Furthermore, microcystin-LR might induce the cytoskeleton reorganization be accompanied epithelial–mesenchymal transition

  10. APS storage ring vacuum system

    International Nuclear Information System (INIS)

    The Advanced Photon Source synchrotron radiation facility, under construction at the Argonne National Laboratory, incorporates a large ring for the storage of 7 GeV positrons for the generation of photon beams for the facility's experimental program. The Storage Ring's 1104 m circumference is divided into 40 functional sectors. The sectors include vacuum, beam transport, control, acceleration and insertion device components. The vacuum system, which is designed to operate at a pressure of 1 n Torr, consists of 240 connected sections, the majority of which are fabricated from an aluminum alloy extrusion. The sections are equipped with distributed NeG pumping, photon absorbers with lumped pumping, beam position monitors, vacuum diagnostics and valving. The details of the vacuum system design, selected results of the development program and general construction plans are presented. 11 refs., 6 figs., 3 tabs

  11. A high-order unstaggered constrained transport method for the 3D ideal magnetohydrodynamic equations based on the method of lines

    CERN Document Server

    Helzel, Christiane; Taetz, Bertram

    2012-01-01

    Numerical methods for solving the ideal magnetohydrodynamic (MHD) equations in more than one space dimension must confront the challenge of controlling errors in the discrete divergence of the magnetic field. One approach that has been shown successful in stabilizing MHD calculations are constrained transport (CT) schemes. CT schemes can be viewed as predictor-corrector methods for updating the magnetic field, where a magnetic field value is first predicted by a method that does not exactly preserve the divergence-free condition on the magnetic field, followed by a correction step that aims to control these divergence errors. In Helzel et al. (2011) the authors presented an unstaggered constrained transport method for the MHD equations on 3D Cartesian grids. In this work we generalize the method of Helzel et al. (2011) in three important ways: (1) we remove the need for operator splitting by switching to an appropriate method of lines discretization and coupling this with a non-conservative finite volume meth...

  12. Survey and alignment report on the primary control network for the APS

    International Nuclear Information System (INIS)

    During November 1992 the survey and alignment team measured the entire primary control network for the APS. This task had to be finished before the enclosure of the EAA and the RF buildings were put in place, inhibiting several lines of sight necessary for the determination of the monument locations

  13. Deletion mutants of AP-1 adaptin subunits display distinct phenotypes in fission yeast.

    Science.gov (United States)

    Ma, Yan; Takeuchi, Mai; Sugiura, Reiko; Sio, Susie O; Kuno, Takayoshi

    2009-08-01

    Adaptins are subunits of the heterotetrameric (beta/mu/gamma/sigma) adaptor protein (AP) complexes that are involved in clathrin-mediated membrane trafficking. Here, we show that in Schizosaccharomyces pombe the deletion strains of each individual subunit of the AP-1 complex [Apl2 (beta), Apl4 (gamma), Apm1 (mu) and Aps1 (sigma)] caused distinct phenotypes on growth sensitivity to temperature or drugs. We also show that the Deltaapm1 and Deltaapl2 mutants displayed similar but more severe phenotypes than those of Deltaaps1 or Deltaapl4 mutants. Furthermore, the Deltaapl2Deltaaps1 and Deltaapl2Deltaapl4 double mutants displayed synthetic growth defects, whereas the Deltaaps1Deltaapl4 and Deltaapl2Deltaapm1 double mutants did not. In pull-down assay, Apm1 binds Apl2 even in the absence of Aps1 and Apl4, and Apl4 binds Aps1 even in the absence of Apm1 and Apl2. Consistently, the deletion of any subunit generally caused the disassociation of the heterotetrameric complex from endosomes, although some subunits weakly localized to endosomes. In addition, the deletion of individual subunits caused similar endosomal accumulation of v-SNARE synaptobrevin Syb1. Altogether, results suggest that the four subunits are all essential for the heterotetrameric complex formation and for the AP-1 function in exit transport from endosomes. PMID:19624755

  14. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed

  15. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-12-22

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  16. AP1000's advanced control room

    International Nuclear Information System (INIS)

    AP1000 is a passive Advanced Light Water Reactor designed by Westinghouse Electric Company to comply with the Electric Power Research Institute's (EPRI) Advanced Light Water Reactor (ALWR) Utility Requirements Document (URD). AP600, the predecessor to AP1000, received Design Certification by the US Nuclear Regulatory Commission (USNRC) in 1999. The AP1000 received its Final Design Approval in the Fall of 2004 and Design Certification is expected in the fall of 2005. During both of these licensing efforts a control room and Human Machine Interface (HMI) design process was submitted and approved. Realizing that Instrumentation and Control (I and C) and HMI technology changes rapidly, Westinghouse chose to delay the detailed design of the control room and operator interfaces. This allows the latest technology to be used when a plant is actually going to be built. That time has now come. This paper describes the preliminary designs of the AP1000 main control room (MCR) and HMI planned for use in new plants both in the United States and abroad. The paper also addresses how the certified design process is being conducted to complete the detailed HMI designs. (authors)

  17. Building an AP Social Studies Program with Non-Traditional AP Students

    Science.gov (United States)

    Ashmead, Amanda; Blanchette, Sue

    2013-01-01

    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  18. A note on weighted Ap(G)-modules

    OpenAIRE

    ÖZTOP, Serap

    2011-01-01

    Let G be a locally compact abelian group and w be a weight function on G. In this paper, we show that the space Ap,w(G) is a Banach module over the Figà-Talamanca Herz algebra Ap(G) and study the multiplier space from Ap(G) to Ap,w(G).

  19. 光动力作用对人结肠癌细胞转录因子激活蛋白-4表达的影响%Inhibition of AP-4 gene expression by zinc phthalocyanine-mediated photodynamic therapy in human colon cancer cell line SW480

    Institute of Scientific and Technical Information of China (English)

    张通; 曹杰; 杨平; 李旺林; 孙政; 张伟健; 曾山崎

    2013-01-01

    目的 观察不同浓度光敏剂酞菁锌对结肠癌细胞株SW480的生长抑制作用及其对转录因子激活蛋白-4(AP-4)表达的影响.方法 应用CCK-8方法 评估光动力作用后SW480细胞的存活率,通过流式细胞技术、RT-PCR技术、Western blot技术检测光敏剂酞菁锌光动力作用后对SW480细胞凋亡和AP-4基因表达等生物学行为的影响.结果 酞菁锌光动力治疗对结肠癌细胞株SW480生长增殖具有明显抑制作用,其效应呈浓度和光照剂量依赖性;流式细胞仪分析显示SW480细胞呈G2/M期阻滞;SW480细胞的凋亡率随酞菁锌浓度增加逐步上升.2.0 μg/mL酞菁锌光动力作用SW480细胞48 h后其AP-4 mRNA水平下降了81%,培养液上清液AP-4蛋白浓度下降了75.6%(P<0.01).结论 应用光敏剂酞菁锌光动力作用能有效抑制SW-480细胞 AP-4的表达,进而抑制细胞的生长、增殖及诱导细胞的凋亡,为结肠癌治疗提供了新的思路和手段.%Objective To investigate the influence of zinc phthalocyanine on the proliferation and AP - 4 gene expression in SW480 cells in vitro. Methods The cell proliferation was analyzed by cell counting kit - 8 ( CCK8 ) assay, while the AP - 4 mRNA and protein expression after photodynamic therapy ( PDT ) were analyzed by RT - PCR and Western blot, respectively. Meanwhile, the flow cytometry ( FCM ) was used to detect the cell apoptosis and cycle. Results The proliferation of SW480 cells was significantly suppressed by zinc phthalocyanine - mediated PDT in concentration - and light dose - dependent manners. The cell was arrested at G2/M by PDT, while the apoptosis rate was enhanced with zinc phthalocyanine in concentration dependent manner. After 2. 0 μg/mL zinc phthalocyanine - mediated PDT, the AP - 4 mRNA and protein were significantly reduced by 81% and 75. 6% , respectively, in SW480 cells ( P <0. 01 ). Conclusion Zinc phthalocyanine - mediated PDT can effectively suppress the expression of AP - 4, and

  20. Slotted Aloha with multi-AP diversity and APS transmit beamforming

    Directory of Open Access Journals (Sweden)

    Zheng Di

    2011-01-01

    Full Text Available Abstract Slotted Aloha is an effective random access protocol and can also be an important element of more advanced media access protocols. This paper investigates slotted Aloha in a radio environment with multiple access points. Specifically, we examine the impact of multi-access-point (multi-AP diversity on the performance of slotted Aloha. The paper considers both omni-directional (OM and beamforming (BF antennas at transmission nodes. This leads to the investigation and comparison of four different network scenarios, i.e., OM with multi-AP diversity, OM without multi-AP diversity, BF with multi-AP diversity and BF without multi-AP diversity. Performance evaluations and comparisons are presented in terms of throughput and average packet delay.

  1. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  2. Comparison of a CCD and an APS for soft X-ray diffraction

    International Nuclear Information System (INIS)

    We compare a new CMOS Active Pixel Sensor (APS) to a Princeton Instruments PIXIS-XO: 2048B Charge Coupled Device (CCD) with soft X-rays tested in a synchrotron beam line at the Diamond Light Source (DLS). Despite CCDs being established in the field of scientific imaging, APS are an innovative technology that offers advantages over CCDs. These include faster readout, higher operational temperature, in-pixel electronics for advanced image processing and reduced manufacturing cost. The APS employed was the Vanilla sensor designed by the MI3 collaboration and funded by an RCUK Basic technology grant. This sensor has 520 x 520 square pixels, of size 25 μm on each side. The sensor can operate at a full frame readout of up to 20 Hz. The sensor had been back-thinned, to the epitaxial layer. This was the first time that a back-thinned APS had been demonstrated at a beam line at DLS. In the synchrotron experiment soft X-rays with an energy of approximately 708 eV were used to produce a diffraction pattern from a permalloy sample. The pattern was imaged at a range of integration times with both sensors. The CCD had to be operated at a temperature of -55°C whereas the Vanilla was operated over a temperature range from 20°C to -10°C. We show that the APS detector can operate with frame rates up to two hundred times faster than the CCD, without excessive degradation of image quality. The signal to noise of the APS is shown to be the same as that of the CCD at identical integration times and the response is shown to be linear, with no charge blooming effects. The experiment has allowed a direct comparison of back thinned APS and CCDs in a real soft x-ray synchrotron experiment.

  3. Plyler Prize and APS Fellow Introductions

    Science.gov (United States)

    Nathanson, Gilbert

    2014-03-01

    The Division of Chemical Physics is delighted to announce the 2013 APS Fellows sponsored by DCP and to honor the 2014 Earl K. Plyler Prize Award winner. The new APS Fellows are: Ilan Benjamin, Hua Guo, Manos Mavrikakis, Josef Paldus, Joern Siepmann, Hans-Peter Steinrueck, Douglas Tobias, Angela Wilson, and Yijing Yan. The citations for each awardee will be read out loud. I will also introduce Prof. Lai-Sheng Wang of the Department of Chemistry at Brown University, who was awarded the 2014 Plyler Prize for Molecular Spectroscopy and Dynamics. Please come learn about these extraordinary scientists during this prize session. Prof. Wang's Plyler Prize talk will follow immediately after this introduction. For more information, see http://www.aps.org/units/dcp/.

  4. AP600 - an ALWR conceptual design

    International Nuclear Information System (INIS)

    The Electric Power Research Institute is spearheading an effort to develop utility requirements for the Advanced Light Water Reactor (ALWR) plants which will become the next generation nuclear power plants for the U.S. This EPRI ALWR Program involves utilities, the U.S. Department of Energy, the U.S. Nuclear Regulatory Commission, and various industry suppliers. The ALWR Program is aimed at ALWR plants which incorporate step improvements in safety, reliability, operability and power generation costs. As part of the ALWR efforts, a Westinghouse team is conducting conceptual design development of a PWR plant design called the AP600, reflecting advanced passive safety features and the chosen 600 MWe plant output. The AP600 conceptual design provides significant improvements while employing proven component technology. This paper describes the basic reactor and primary coolant system features, the passive safety system features, and plant arrangement/construction features of AP600

  5. Present status of design, installation and testing of electron gun and low energy beam transport line of electron Linac at VECC

    International Nuclear Information System (INIS)

    A key component of ANURIB (Advanced National Facility of Unstable and Rare Isotope Beams) project at VECC is a 2 mA, 30/50 MeV continuous-wave superconducting electron linear accelerator (e-Linac). The e-Linac has two sections - a 10 MeV Injector and an Accelerator section for further accelerating the beam to 30/50 MeV. The Injector comprises a 300 kV de thermionic electron gun with gridded cathode modulated at 650 MHz, low energy beam transport (LEBT) line and an injector cryo-module (ICM) that houses one 9-cell beta=1, 1.3 GHz niobium elliptical cavity. As an alternative to the 300 kV gun, a capture cryo-module (CCM) having two single-cell beta=1, 1.3 GHz niobium cavities that will allow the electron gun to be operated at 100 kV is also being developed. The CCM will pre-accelerate the beam from the gun prior to injection in the ICM. The e-Linac has been jointly designed with TRIUMF Canada. The ICM is being built by TRIUMF whereas the front-end of the injector is being built indigenously at VECC. Till the Rajarhat site for ANURIB is getting ready, an e-Linac test area is being setup at VECC Salt Lake campus. The Injector is being installed here and will be later moved to the new campus. The electron gun and several components of the LEBT line up to the CCM have been installed. Alignment and vacuum tests have also been completed. The LEBT line consists of steering magnets, solenoid magnets, diagnostics chamber and a room temperature 1.3 GHz buncher. Solenoid magnets are under fabrication and steering magnets have been procured. A dipole magnet and rf- deflector cavity for characterization of time structure of the beam has been designed and will be added to the LEBT line. In this report, the detail design of the various components and magnets along with present status of installation of the Injector will be presented. (author)

  6. Mechanical equipment classification research of AP1000 nuclear units

    International Nuclear Information System (INIS)

    According to the design features of AP1000, the AP1000 classification definition and seismic classification is described and analyzed. The characteristics of AP1000 mechanical equipment classification list is concluded for safety, seismic and manufacture classification. Through comparing the AP1000 classification and M310 classification, the questions perhaps met are found during the mechanical equipment classification of AP1000 nuclear power plants design and construction in China at future. Finally solution plans are given aiming at the above questions. (authors)

  7. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  8. Project W-519 CDR supplement: Raw water and electrical services for privatization contractor, AP tank farm operations

    International Nuclear Information System (INIS)

    This supplement to the Project W-519 Conceptual Design will identify a means to provide RW and Electrical services to serve the needs of the TWRS Privatization Contractor (PC) at AP Tank Farm as directed by DOE-RL. The RW will serve the fire suppression and untreated process water requirements for the PC. The purpose of this CDR supplement is to identify Raw Water (RW) and Electrical service line routes to the TWRS Privatization Contractor (PC) feed delivery tanks, AP-106 and/or AP-108, and establish associated cost impacts to the Project W-519 baseline

  9. Regulation of Aggression by Obesity-Linked Genes TfAP-2 and Twz Through Octopamine Signaling in Drosophila

    OpenAIRE

    Williams, Michael J.; Goergen, Philip; Rajendran, Jayasimman; Klockars, Anica; Kasagiannis, Anna; Fredriksson, Robert; Schiöth, Helgi B.

    2013-01-01

    In Drosophila, the monoamine octopamine, through mechanisms that are not completely understood, regulates both aggression and mating behavior. Interestingly, our study demonstrates that the Drosophila obesity-linked homologs Transcription factor AP-2 (TfAP-2; TFAP2B in humans) and Tiwaz (Twz; KCTD15 in humans) interact to modify male behavior by controlling the expression of Tyramine β-hydroxylase and Vesicular monanime transporter, genes necessary for octopamine production and secretion. Fur...

  10. Butyrate Produced by Commensal Bacteria Potentiates Phorbol Esters Induced AP-1 Response in Human Intestinal Epithelial Cells

    OpenAIRE

    Nepelska, Malgorzata; Cultrone, Antonietta; Béguet-Crespel, Fabienne; Le Roux, Karine; Doré, Joël; Arulampalam, Vermulugesan; Blottière, Hervé M.

    2012-01-01

    The human intestine is a balanced ecosystem well suited for bacterial survival, colonization and growth, which has evolved to be beneficial both for the host and the commensal bacteria. Here, we investigated the effect of bacterial metabolites produced by commensal bacteria on AP-1 signaling pathway, which has a plethora of effects on host physiology. Using intestinal epithelial cell lines, HT-29 and Caco-2, stably transfected with AP-1-dependent luciferase reporter gene, we tested the effect...

  11. Transport of artificial amino acid into kidney epithelial cell line monolayer: 3-[125I]iodo-alpha-methyl-L-tyrosine comparison with L-[14C]Tyr

    International Nuclear Information System (INIS)

    Aim: We investigated the carrier systems involved in 3-[125I]iodo-alpha-methyl-L-tyrosine (125I-IMT) and L-[14C]Tyr transport in pig kidney epithelial cell line LLC-PK1 monolayer. These cells, from an oriented monolayer with microvilli and tight junctions, exhibit unidirectional transcellular transport of electrolytes and some nutrients. Materials and Methods: Cell line studies were performed as follows, using methods described by Satoh et al.. LLC-PK1 cells were grown on plastic dishes in Dulbecco's modified Eagle's medium, supplemented with 10% fetal calf serum without antibiotics in an atmosphere of 5% CO2 at 370C. Subculturing was conducted every 7 days using 0.02% EDTA and 0.05% trypsin. For uptake studies, LLC-PK1 cells were seeded on 60-mm dishes at a cell density of 5x105 cells/dish in 5 mL of complete medium, and were used on day 6-7 after inoculation. The composition of the incubation medium was as follows: 145 mM NaCl, 3 mM KCl, 1 mM CaCl2, 0.5 mM MgCl2, and 5 mM HEPES, pH 7.4. In the sodium dependence study, NaCl was replaced with same concentration of choline-Cl. After removal of culture medium, each dish was washed once with 5 mL of incubation medium for 10 min at 370C. Cells were then incubated with 2 mL of incubation medium containing 125I-IMT for the specified periods at 370C, or at 40C in a temperature dependence study. For inhibition studies, L-Tyr, D-Tyr, probenecid and DNP were added to give final concentrations of 5.0 mM, 5.0 mM, 1 mM and 0.1 mM, respectively. Cells were incubated for 5 min at 370C with 1.11 kBq 125I-IMT or L-[14C]Tyr. After incubation, the medium was aspirated, and monolayers were rinsed rapidly twice with 5 ml of ice-cold incubation medium. Cells were solubilized in 1.5 mL of 1 N NaOH, and the radioactivity of each aliquot was quantitated using a well-type scintillation counter. Results: Significant inhibition of 125I-IMT and L-[14C]Tyr uptake (62.61% and 80.0%, respectively) was noted with L-Tyr (P125I-IMT and L-[14C

  12. Stokes IQUV Magnetic Doppler Imaging of Ap stars I. ESPaDOnS and NARVAL Observations

    OpenAIRE

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Bagnulo, S.; Folsom, C. P.; Hanes, D.

    2012-01-01

    In this paper we describe and evaluate new spectral line polarisation observations obtained with the goal of mapping the surfaces of magnetic Ap stars in great detail. One hundred complete or partial Stokes IQUV sequences, corresponding to 297 individual polarised spectra, have been obtained for 7 bright Ap stars using the ESPaDOnS and NARVAL spectropolarimeters. The targets span a range of mass from approximately 1.8 to 3.4 solar mass, a range of rotation period from 2.56 to 6.80 days, and a...

  13. Tank 241-AP-107 tank characterization plan

    International Nuclear Information System (INIS)

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107

  14. 2000 Johnston Site 3A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  15. 2000 Johnston Site 2A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  16. 2000 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  17. 2006 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  18. The Demographic Wave: Rethinking Hispanic AP Trends

    Science.gov (United States)

    Edwards, Kelcey; Sawtell, Ellen

    2013-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  19. Two Successful Approaches to Teaching AP Government

    Science.gov (United States)

    Ladd, Brian; Stepp, Heidi

    2013-01-01

    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  20. Luteolin, a flavonoid, inhibits AP-1 activation by basophils

    International Nuclear Information System (INIS)

    Flavonoids including luteolin, apigenin, and fisetin are inhibitors of IL-4 synthesis and CD40 ligand expression by basophils. This study was done to search for compounds with greater inhibitory activity of IL-4 expression and to clarify the molecular mechanisms through which flavonoids inhibit their expression. Of the 37 flavonoids and related compounds examined, ayanin, luteolin, and apigenin were the strongest inhibitors of IL-4 production by purified basophils in response to anti-IgE antibody plus IL-3. Luteolin did not suppress Syk or Lyn phosphorylation in basophils, nor did suppress p54/46 SAPK/JNK, p38 MAPK, and p44/42 MAPK activation by a basophilic cell line, KU812 cells, stimulated with A23187 and PMA. However, luteolin did inhibit phosphorylation of c-Jun and DNA binding activity of AP-1 in nuclear lysates from stimulated KU812 cells. These results provide a fundamental structure of flavonoids for IL-4 inhibition and demonstrate a novel action of flavonoids that suppresses the activation of AP-1

  1. AP1000® SBLOCA simulations with TRACE code

    International Nuclear Information System (INIS)

    Highlights: • Assessment of AP1000 behavior in SBLOCA sequences. • Importance of CMTs and PRHR system for core cooling in case of small break sizes. • Well behavior of the plant in case of availability of half of the total ECCS because of DEDVI. - Abstract: The AP1000® is an advanced pressurized water reactor (PWR) design developed by Westinghouse which implements passive safety systems to provide core cooling in case of accident. The performing of such systems must be evaluated through the performance of experiments and simulations with a variety of thermal–hydraulic codes. This paper presents the results which has been obtained for different SBLOCA break sizes with the best estimate TRACE V5.0 patch 2 thermal–hydraulic code and their comparison with those obtained by Westinghouse with NOTRUMP code. The main results show that TRACE code predicts a similar trend in all sequences with some differences that are expected to be an issue of the more conservative models and hypothesis assumed in the SBLOCA licensing analysis performed with NOTRUMP. Some particular characteristics of this reactor are also shown in this paper such as the importance of core makeup tank (CMT) and passive residual heat removal (PRHR) system for core cooling in case of small break sizes and the behavior of the plant in case of availability of half of the total passive safety injection systems which is the case of the double-ended direct vessel injection line break (DEDVI)

  2. Tank 241-AP-106, grab samples, 6AP-96-1 through 6AP-96-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A., Westinghouse Hanford

    1996-12-11

    This document is the final report for tank 241-AP-106 grab samples. This document presents the analytical results for three samples (6AP-96-1, 6AP-96-2 and 6AP-96-3) taken from riser 1 @ 150{degrees} of tank 241-AP-1 06 on September 12, 1996. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1996) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler, 1995).

  3. Review on Transport Organization for the Disassemble Project of Guangzhou Metro Line 2%广州地铁原2号线拆解后的车务组织回顾

    Institute of Scientific and Technical Information of China (English)

    宋利明

    2011-01-01

    The original Guangzhou metro Line 2 started operation in June, 2003. In September, 2010, this line was disassembled and linked with a new part (with 20 stations and 26.7 km in length) to form new Line 2 and Line 8. Only 3 days were given to finish the disassemble project, and the new lines would be opened for operation right after the project. Since the original Line 2 had a large passenger flow,so the new one is required to maintain the same transportation capacity after disassemble work. However, there isn't any pre-operation drilling for the new lines, it surely requires a well-prepared transport organization before the disassemble project. This paper takes a review on the transport organization for the disassemble project of Guangzhou metro, Line 2.%广州地铁原2号线于2010年9月拆解,连同新开通的26.7 km,20座车站一起,形成新的2号线和8号线.由于原2号线停运工程拆解时间短,拆解后要立即按2条线来运营,故拆解前不具备条件进行运营演练.这就要求车务部门在拆解前做好车务组织工作.介绍了原2号线拆解前的运营车务组织工作,包括新2,8号线开通前,确定设备故障演练项目、进行时刻表演练等,为类似的城市轨道交通新线运营筹备工作提供参考.

  4. The Clathrin Adaptor AP-1A Mediates Basolateral Polarity

    OpenAIRE

    Gravotta, Diego; Carvajal-Gonzalez, Jose Maria; Mattera, Rafael; Deborde, Sylvie; Banfelder, Jason R.; Bonifacino, Juan S.; Rodriguez-Boulan, Enrique

    2012-01-01

    Clathrin and the epithelial-specific clathrin adaptor AP-1B mediate basolateral trafficking in epithelia. However, several epithelia lack AP-1B and mice knocked-out for AP-1B are viable, suggesting the existence of additional mechanisms that control basolateral polarity. Here, we demonstrate a distinct role of the ubiquitous clathrin adaptor AP-1A in basolateral protein sorting. Knock-down of AP-1A causes missorting of basolateral proteins in MDCK cells but only after knock-down of AP-1B, sug...

  5. Enhanced NFκB and AP-1 transcriptional activity associated with antiestrogen resistant breast cancer

    International Nuclear Information System (INIS)

    Signaling pathways that converge on two different transcription factor complexes, NFκB and AP-1, have been identified in estrogen receptor (ER)-positive breast cancers resistant to the antiestrogen, tamoxifen. Two cell line models of tamoxifen-resistant ER-positive breast cancer, MCF7/HER2 and BT474, showing increased AP-1 and NFκB DNA-binding and transcriptional activities, were studied to compare tamoxifen effects on NFκB and AP-1 regulated reporter genes relative to tamoxifen-sensitive MCF7 cells. The model cell lines were treated with the IKK inhibitor parthenolide (PA) or the proteasome inhibitor bortezomib (PS341), alone and in combination with tamoxifen. Expression microarray data available from 54 UCSF node-negative ER-positive breast cancer cases with known clinical outcome were used to search for potential genes signifying upregulated NFκB and AP-1 transcriptional activity in association with tamoxifen resistance. The association of these genes with patient outcome was further evaluated using node-negative ER-positive breast cancer cases identified from three other published data sets (Rotterdam, n = 209; Amsterdam, n = 68; Basel, n = 108), each having different patient age and adjuvant tamoxifen treatment characteristics. Doses of parthenolide and bortezomib capable of sensitizing the two endocrine resistant breast cancer models to tamoxifen were capable of suppressing NFκB and AP-1 regulated gene expression in combination with tamoxifen and also increased ER recruitment of the transcriptional co-repressor, NCoR. Transcript profiles from the UCSF breast cancer cases revealed three NFκB and AP-1 upregulated genes – cyclin D1, uPA and VEGF – capable of dichotomizing node-negative ER-positive cases into early and late relapsing subsets despite adjuvant tamoxfien therapy and most prognostic for younger age cases. Across the four independent sets of node-negative ER-positive breast cancer cases (UCSF, Rotterdam, Amsterdam, Basel), high expression of

  6. Enhanced NFκB and AP-1 transcriptional activity associated with antiestrogen resistant breast cancer

    Directory of Open Access Journals (Sweden)

    Moore Dan H

    2007-04-01

    Full Text Available Abstract Background Signaling pathways that converge on two different transcription factor complexes, NFκB and AP-1, have been identified in estrogen receptor (ER-positive breast cancers resistant to the antiestrogen, tamoxifen. Methods Two cell line models of tamoxifen-resistant ER-positive breast cancer, MCF7/HER2 and BT474, showing increased AP-1 and NFκB DNA-binding and transcriptional activities, were studied to compare tamoxifen effects on NFκB and AP-1 regulated reporter genes relative to tamoxifen-sensitive MCF7 cells. The model cell lines were treated with the IKK inhibitor parthenolide (PA or the proteasome inhibitor bortezomib (PS341, alone and in combination with tamoxifen. Expression microarray data available from 54 UCSF node-negative ER-positive breast cancer cases with known clinical outcome were used to search for potential genes signifying upregulated NFκB and AP-1 transcriptional activity in association with tamoxifen resistance. The association of these genes with patient outcome was further evaluated using node-negative ER-positive breast cancer cases identified from three other published data sets (Rotterdam, n = 209; Amsterdam, n = 68; Basel, n = 108, each having different patient age and adjuvant tamoxifen treatment characteristics. Results Doses of parthenolide and bortezomib capable of sensitizing the two endocrine resistant breast cancer models to tamoxifen were capable of suppressing NFκB and AP-1 regulated gene expression in combination with tamoxifen and also increased ER recruitment of the transcriptional co-repressor, NCoR. Transcript profiles from the UCSF breast cancer cases revealed three NFκB and AP-1 upregulated genes – cyclin D1, uPA and VEGF – capable of dichotomizing node-negative ER-positive cases into early and late relapsing subsets despite adjuvant tamoxfien therapy and most prognostic for younger age cases. Across the four independent sets of node-negative ER-positive breast cancer cases

  7. Dynamics of intracellular clathrin/AP1 and clathrin/AP3 containing carriers

    OpenAIRE

    2012-01-01

    Clathrin/AP1 and clathrin/AP3 coated vesicular carriers originate from endosomes and the TGN. We report here the real-time visualization of these structures in living cells reliably tracked by using rapid, three-dimensional imaging with a spinning-disk confocal microscope. We imaged relatively sparse, diffraction-limited, fluorescent objects containing chimeric fluorescent protein (clathrin light chain, σ adaptor subunits or dynamin2) with a spatial precision of up to ~ 30 nm and a temporal r...

  8. Hydrothermal waves in evaporating sessile drops (APS 2009)

    CERN Document Server

    Brutin, D; LeNiliot, C

    2009-01-01

    This fluid dynamics video was submitted to the Gallery of Fluid Motion for the 2009 APS Division of Fluid Dynamics Meeting in Minneapolis, Minnesota. Drop evaporation is a simple phenomena but still unclear concerning the mechanisms of evaporation. A common agreement of the scientific community based on experimental and numerical work evidences that most of the evaporation occurs at the triple line. However, the rate of evaporation is still empirically predicted due to the lack of knowledge on the convection cells which develop inside the drop under evaporation. The evaporation of sessile drop is more complicated than it appears due to the coupling by conduction with the heating substrate, the convection and conduction inside the drop and the convection and diffusion with the vapour phase. The coupling of heat transfer in the three phases induces complicated cases to solve even for numerical simulations. We present recent experimental fluid dynamics videos obtained using a FLIR SC-6000 coupled with a microsco...

  9. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  10. Detailed spatial measurements and Monte Carlo analysis of the transportation phenomena of thermal and epithermal neutrons from the 12-GeV proton transport line to an access maze

    International Nuclear Information System (INIS)

    In order to investigate the neutron transportation from a beam-line tunnel to an access maze at a 12-GeV proton accelerator, we measured the spatial distribution of thermal and epithermal neutrons by using the Au activation method in detail. Gold foils were placed at about 70 positions in the maze in the case of the insertion (or extraction) of a copper target of 1 mm thickness into (or from) the beam axis in front of the maze. After the end of accelerator operation, relative activities of the Au foils were simultaneously measured by using an imaging plate technique and the radioactivity of one reference foil was also measured with a HPGe detector to convert to the absolute activities of all foils. It was found that the neutrons reach to the depth of the maze in the case of the insertion of the copper target. This result reflects higher proportion of high-energy particles from the copper target to that from other beam loss points and high-energy particles become the successive source of low-energy neutrons. Furthermore, it was found that several circumstances such as door walls and electric wire cables obviously affect the absorption effect of thermal neutrons. The reaction rates obtained in this study were also used for the benchmark of the Monte Carlo simulation code, MARS15 (version of February 2008). The results of the MARS15 calculations precisely reproduced experimental results and significant effects of the electric wire cables and door walls

  11. Reliability Study of the AP1000 Passive Safety System by Fuzzy Approach

    Directory of Open Access Journals (Sweden)

    D.T. Sony Tjahyani

    2014-08-01

    Full Text Available The Westinghouse AP1000 is a new design nuclear power plant which has implemented the concept of passive system. Even though a passive system may be more reliable than an active one, the possibility of the passive system to fail still exists. In line with this possibility, generic database have been used to study the reliability of the AP1000 passive safety system. However, since the used data are not specific to the AP1000, the results of the analysis will not show its real performance. This study proposes a fuzzy reliability approach to overcome this problem. The proposed fuzzy reliability approach utilizes the concept of failure possibility to qualitatively describe basic event likely occurences and membership functions of triangular fuzzy numbers to quantitatively represent qualitative failure possibilities. A case-based experiment on reliability study of the AP1000 passive safety system involved to mitigate a large break loss of collant accident is used to validate the feasibility of the proposed approach. By comparisons, probabilities of basic events generated by the proposed approach are very close to the ones which have been used by previous reliability studies. This can be observed from the small numbers of relative errors, i.e. between 0.004125 and 0.079635. These results confirm that the fuzzy reliability approach offers a more realistic technique to study the reliability of the AP1000 passive safety system without the need to engage to precise probability distributions of its components which are currently unavailable.

  12. Modeliranje nove jedrske elektrarne tipa AP1000

    OpenAIRE

    GERJEVIČ, GREGA

    2015-01-01

    Diplomsko delo zajema primerjavo rezultatov simulacije male izlivne nezgode s programskim orodjem Advanced PWR simulator z rezultati, ki jih je opravilo podjetje Westinghouse v testnem objektu APEX-1000. V prvem delu diplomskega dela sta opisana primarni in sekundarni sistem, ki se bistveno ne razlikujeta od sistemov ostalih jedrskih elektrarn. Nato sledi opis pasivnih varnostnih sistemov, po katerih je AP1000 znana. Sledi splošen opis izlivne nezgode, simulacijskega orodja in potek simul...

  13. Magnetic Doppler Imaging of Ap stars

    OpenAIRE

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Landstreet, J. D.; Bagnulo, S.

    2007-01-01

    Historically, the magnetic field geometries of the chemically peculiar Ap stars were modelled in the context of a simple dipole field. However, with the acquisition of increasingly sophisticated diagnostic data, it has become clear that the large-scale field topologies exhibit important departures from this simple model. Recently, new high-resolution circular and linear polarisation spectroscopy has even hinted at the presence of strong, small-scale field structures, which were completely une...

  14. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    International Nuclear Information System (INIS)

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report

  15. APS storage ring vacuum system performance

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) storage ring was designed to operated with 7-GeV, 100-mA positron beam with lifetimes > 20 hours. The lifetime is limited by residual gas scattering and Touschek scattering at this time. Photon-stimulated desorption and microwave power in the rf cavities are the main gas loads. Comparison of actual system gas loads and design calculations will be given. In addition, several special features of the storage ring vacuum system will be presented

  16. AP-42 ADDITIONS AND REVISIONS - RESIDENTIAL WOOD COMBUSTION

    Science.gov (United States)

    This project develops emission factors, etc., for residential fireplaces and woodstoves which are incorporated into AP-42. AP42 is a massive collection of material which describes processes which generate air emissions and presents emission factors and control effectiveness infor...

  17. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  18. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  19. AP Deployment Research Based on Physical Distance and Channel Isolation

    OpenAIRE

    Dangui Yan; Chengchang Zhang; Honghua Liao; Lisheng Yang; Ping Li; Guogang Yang

    2014-01-01

    Aiming at the problem of inefficiency of wireless local area networks (WLAN) access point (AP) deployment in urban environment, a new algorithm for AP deployment based on physical distance and channel isolation (DPDCI) is proposed. First, it detects the position information of deployed APs and then calculates the interference penalty factor combined with physical distance and channel isolation, and finally gets the optimal location and channel of the new AP through the genetic algorithm. Comp...

  20. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S; Bruland, O; Løvås, K; Meager, A; Pedersen, Carsten; Husebye, E S; Knappskog, P M

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms or...

  1. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  2. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  3. Pharmakologische Charakterisierung der vasoaktiven Eigenschaften von Ap7A und Ap8A an der isolierten perfundierten Rattenniere

    OpenAIRE

    Blaschke, Daniela

    2010-01-01

    Recently, diadenosine heptaphosphate and diadenosine octaphosphate have been isolated in human platelets. With thrombin-induced platelet aggregation, Ap7A and Ap8A are released from the platelets into the extracellular space. Like other dinucleoside polyphosphates, maybe they play an important role in the control of vascular tone and platelet aggregation. Here we describe the effects on regulation of vascular tone of Ap7A and Ap8A in isolated perfused rat kidney. Our experiments demonstrate t...

  4. Study on modular construction management in AP1000 nuclear plant project

    International Nuclear Information System (INIS)

    The construction of AP1000 Nuclear Power Plant (NPP) has commenced in China. The AP1000 NPP features a passive design concept and modular construction technology. Based on the management of the construction of current AP1000 NNP, this paper describes the effects on Nuclear Island (NI) construction project management resulting from modular construction technology, as well as new construction techniques and methods. This paper puts forward new requirements for construction schedule management of the nuclear island construction at different levels. The AP1000 NI construction logic features the parallel construction of civil and structural erection as the main approach, with the integrated schedule of module fabrication, assembly and installation as support. The structural modules of AP1000 project are prefabricated in shop, delivered to site as sub-modules and assembled to integrated structural module. The assembled module is transported to the construction site, hoisted and finally set in NI. This paper illustrates how to ensure the construction quality of structural modules by analyzing the interface process and key links in the quality control program, and introduces how to ensure the safety of heavy structural components during various construction phases by evaluating and analyzing the construction safety process. This paper also makes an analysis of the safe environment for the assembly and installation of Containment Vessel, the management of product protection and personnel safety inside the Containment Building during 'Open Top' construction, raises to implement effective protection for the numerous pre-set mechanical modules and equipments, as well as personnel safety protection programs and measures. The modular construction feature of AP1000 NPP design requires technique improvement and management innovation during the NI construction. This paper makes a study and research on the control management of schedule, quality and safety of AP1000 NPP NI

  5. 77 FR 24480 - Application for New Awards; Advanced Placement (AP) Test Fee Program-Reopening the AP Test Fee...

    Science.gov (United States)

    2012-04-24

    .... ACTION: Notice reopening the AP Test Fee fiscal year 2012 competition. Catalog of Federal Domestic Assistance (CFDA) Number: 84.330B. SUMMARY: On February 15, 2012, we published in the Federal Register (77 FR... Application for New Awards; Advanced Placement (AP) Test Fee Program--Reopening the AP Test Fee Fiscal...

  6. AP1000R nuclear power plant safety overview for spent fuel cooling

    International Nuclear Information System (INIS)

    The AP1000R plant is an 1100-MWe class pressurized water reactor with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance, safety and costs. The AP1000 design uses passive features to mitigate design basis accidents. The passive safety systems are designed to function without safety-grade support systems such as AC power, component cooling water, service water or HVAC. Furthermore, these passive features 'fail safe' during a non-LOCA event such that DC power and instrumentation are not required. The AP1000 also has simple, active, defense-in-depth systems to support normal plant operations. These active systems provide the first level of defense against more probable events and they provide investment protection, reduce the demands on the passive features and support the probabilistic risk assessment. The AP1000 passive safety approach allows the plant to achieve and maintain safe shutdown in case of an accident for 72 hours without operator action, meeting the expectations provided in the U.S. Utility Requirement Document and the European Utility Requirements for passive plants. Limited operator actions are required to maintain safe conditions in the spent fuel pool via passive means. In line with the AP1000 approach to safety described above, the AP1000 plant design features multiple, diverse lines of defense to ensure spent fuel cooling can be maintained for design-basis events and beyond design-basis accidents. During normal and abnormal conditions, defense-in-depth and other systems provide highly reliable spent fuel pool cooling. They rely on off-site AC power or the on-site standby diesel generators. For unlikely design basis events with an extended loss of AC power (i.e., station blackout) or loss of heat sink or both, spent fuel cooling can still be provided indefinitely: - Passive systems, requiring minimal or no operator actions, are sufficient for at least 72 hours under all possible pool heat

  7. AP1000{sup R} nuclear power plant safety overview for spent fuel cooling

    Energy Technology Data Exchange (ETDEWEB)

    Gorgemans, J.; Mulhollem, L.; Glavin, J.; Pfister, A.; Conway, L.; Schulz, T.; Oriani, L.; Cummins, E.; Winters, J. [Westinghouse Electric Company LLC, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2012-07-01

    The AP1000{sup R} plant is an 1100-MWe class pressurized water reactor with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance, safety and costs. The AP1000 design uses passive features to mitigate design basis accidents. The passive safety systems are designed to function without safety-grade support systems such as AC power, component cooling water, service water or HVAC. Furthermore, these passive features 'fail safe' during a non-LOCA event such that DC power and instrumentation are not required. The AP1000 also has simple, active, defense-in-depth systems to support normal plant operations. These active systems provide the first level of defense against more probable events and they provide investment protection, reduce the demands on the passive features and support the probabilistic risk assessment. The AP1000 passive safety approach allows the plant to achieve and maintain safe shutdown in case of an accident for 72 hours without operator action, meeting the expectations provided in the U.S. Utility Requirement Document and the European Utility Requirements for passive plants. Limited operator actions are required to maintain safe conditions in the spent fuel pool via passive means. In line with the AP1000 approach to safety described above, the AP1000 plant design features multiple, diverse lines of defense to ensure spent fuel cooling can be maintained for design-basis events and beyond design-basis accidents. During normal and abnormal conditions, defense-in-depth and other systems provide highly reliable spent fuel pool cooling. They rely on off-site AC power or the on-site standby diesel generators. For unlikely design basis events with an extended loss of AC power (i.e., station blackout) or loss of heat sink or both, spent fuel cooling can still be provided indefinitely: - Passive systems, requiring minimal or no operator actions, are sufficient for at least 72 hours under all

  8. MiniAp-4: A Venom-Inspired Peptidomimetic for Brain Delivery.

    Science.gov (United States)

    Oller-Salvia, Benjamí; Sánchez-Navarro, Macarena; Ciudad, Sonia; Guiu, Marc; Arranz-Gibert, Pol; Garcia, Cristina; Gomis, Roger R; Cecchelli, Roméo; García, Jesús; Giralt, Ernest; Teixidó, Meritxell

    2016-01-11

    Drug delivery across the blood-brain barrier (BBB) is a formidable challenge for therapies targeting the central nervous system. Although BBB shuttle peptides enhance transport into the brain non-invasively, their application is partly limited by lability to proteases. The present study proposes the use of cyclic peptides derived from venoms as an affordable way to circumvent this drawback. Apamin, a neurotoxin from bee venom, was minimized by reducing its complexity, toxicity, and immunogenicity, while preserving brain targeting, active transport, and protease resistance. Among the analogues designed, the monocyclic lactam-bridged peptidomimetic MiniAp-4 was the most permeable. This molecule is capable of translocating proteins and nanoparticles in a human-cell-based BBB model. Furthermore, MiniAp-4 can efficiently deliver a cargo across the BBB into the brain parenchyma of mice. PMID:26492861

  9. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  10. Ozone mitigation tests at the APS

    International Nuclear Information System (INIS)

    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented

  11. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine

    2013-01-01

    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  12. Design of the AP 600 passive containment cooling system structures

    International Nuclear Information System (INIS)

    The AP 600 is a greatly simplified 600 MWe Pressurized Water Reactor, for the 1990's and beyond. Among its major features, a passive containment cooling system (PCCS) is designed to remove the residual heat, directly from the containment steel vessel, and transmits it to the environment. The design and analysis of the PCCS structures is being performed jointly by ANSALDO and WESTINGHOUSE, as part of the AP 600 program under WESTINGHOUSE's overall leadership, and will be presented in this paper. The PCCS uses the steel containment wall as a heat transfer surface. The surrounding concrete shield building is used along with a baffle to direct air from the top located air inlets down to a lower elevation of the containment and back up along the containment vessel. In addition a water storage tank is housed in the shield building roof at an elevation sufficient to allow gravity drain of the water on top of the steel containment. The air and the evaporated water exhaust through a chimney in the roof of the shield building. For the roof, a reinforced concrete conical configuration, with a cylindrical stainless steel lined water tank, has been selected and a comprehensive feasibility study has been performed including seismic behaviour, constructability, prefabrication and modularization, adaptability to cope with the External Events strength requirements. For the PCCS air baffles general functional and structural design criteria have been established by including requirements for the air flow path configuration, leaded through the baffles, inspection and maintenance; a series of alternate designs have analyzed, leading to the selection of a reference configuration that will be briefly described. (author). 11 fig

  13. Spent fuel pool spray cooling system for the AP1000 registered

    International Nuclear Information System (INIS)

    The AP1000 registered plant design features multiple, diverse lines of defense to ensure spent fuel cooling can be maintained for Design Basis Events and Beyond Design Basis Accidents (BDBA). The AP1000 registered plant lines of defense with respect to Spent Fuel Pool (SFP) cooling are as follows: 1. During normal and abnormal conditions, defense-in-depth and duty systems provide highly reliable SFP cooling, supplied by offsite AC power or the onsite Standby Diesel Generators. 2. For unlikely events with extended loss of AC power (i.e. station black-out) and/or loss of heat sink, spent fuel cooling can be still provided indefinitely by: 2a. Passive systems, requiring minimal or no operator actions, sufficient for at least 72 hours under all possible loading conditions. 2b. After 3 days, several different means are provided to continue SFP cooling using installed plant equipment as well as off-site equipment with built-in connections. 3. Even for BDBA with postulated SFP damage and multiple failures in the passive safety-related systems and in the defense-in-depth active systems, the AP1000 registered SFP Spray System provides an additional line of defense to prevent spent fuel damage. (orig.)

  14. Spent fuel pool spray cooling system for the AP1000 {sup registered}

    Energy Technology Data Exchange (ETDEWEB)

    Vujic, Zoran; Sassen, Felix; Tietsch, Wolfgang [Westinghouse Electric Germany GmbH, Mannheim (Germany)

    2013-07-01

    The AP1000 {sup registered} plant design features multiple, diverse lines of defense to ensure spent fuel cooling can be maintained for Design Basis Events and Beyond Design Basis Accidents (BDBA). The AP1000 {sup registered} plant lines of defense with respect to Spent Fuel Pool (SFP) cooling are as follows: 1. During normal and abnormal conditions, defense-in-depth and duty systems provide highly reliable SFP cooling, supplied by offsite AC power or the onsite Standby Diesel Generators. 2. For unlikely events with extended loss of AC power (i.e. station black-out) and/or loss of heat sink, spent fuel cooling can be still provided indefinitely by: 2a. Passive systems, requiring minimal or no operator actions, sufficient for at least 72 hours under all possible loading conditions. 2b. After 3 days, several different means are provided to continue SFP cooling using installed plant equipment as well as off-site equipment with built-in connections. 3. Even for BDBA with postulated SFP damage and multiple failures in the passive safety-related systems and in the defense-in-depth active systems, the AP1000 {sup registered} SFP Spray System provides an additional line of defense to prevent spent fuel damage. (orig.)

  15. Hot Topics in Study and Application of Steel Line Pipe for Natural Gas Transportation%天然气输送钢管研究与应用中的几个热点问题

    Institute of Scientific and Technical Information of China (English)

    李鹤林

    2001-01-01

    Several hot topics in study and application of steel line pipefor natural gas transportation are introduced including transportation under high pressure ,research and development of high grade steel line pipe,line pipe with high HIC(Hydrogen Induced Cracking) resistant and its technical requirements,rich gas transportation and technical requirements of steel pipe,comparison and selection between longitudinally submerged arc welded pipe and spirally submerged arc welded pipe,ductile fracture arrest of steel pipe for gas transportation,SCC (Stress Corrosion Cracking) of pipeline in soil environment with approximately neutral pH value,residual stress and its control of line pipe,the ratio of yield to tensile strength of high strength steel line pipe,fitness-for-purpose assessment and risk management of pipeline in service,etc..%全面阐述了天然气输送钢管研究与应用中的热点问题:高压输送与高钢级管线钢的研究开发;抗HIC管线管及其技术条件;富气输送及其对钢管性能的要求;直缝埋弧焊管和螺旋缝埋弧焊管的比较与选择;输气钢管延性断裂的止裂;管线在近中性pH土壤环境中的应力腐蚀开裂;管线管的残余应力及控制;高强度管线钢的屈强比问题;在役管道的适用性评价及风险管理等。

  16. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  17. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  18. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  19. Correction magnet power supplies for APS machine

    International Nuclear Information System (INIS)

    A number of correction magnets are required for the advanced photon source (APS) machine to correct the beam. There are five kinds of correction magnets for the storage ring, two for the injector synchrotron, and two for the positron accumulator ring (PAR). Table I shoes a summary of the correction magnet power supplies for the APS machine. For the storage ring, the displacement of the quadrupole magnets due to the low frequency vibration below 25 Hz has the most significant effect on the stability of the positron closed orbit. The primary external source of the low frequency vibration is the ground motion of approximately 20 μm amplitude, with frequency components concentrated below 10 Hz. These low frequency vibrations can be corrected by using the correction magnets, whose field strengths are controlled individually through the feedback loop comprising the beam position monitoring system. The correction field require could be either positive or negative. Thus for all the correction magnets, bipolar power supplies (BPSs) are required to produce both polarities of correction fields. Three different types of BPS are used for all the correction magnets. Type I BPSs cover all the correction magnets for the storage ring, except for the trim dipoles. The maximum output current of the Type I BPS is 140 Adc. A Type II BPS powers a trim dipole, and its maximum output current is 60 Adc. The injector synchrotron and PAR correction magnets are powered form Type III BPSs, whose maximum output current is 25 Adc

  20. APS insertion devices: Recent developments and results

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) now has a total of 23 insertion devices (IDs). Over two-thirds of them are installed on the storage ring. The installed devices include 18, 27 and 55 mm-period undulators; an 85 mm-period wiggler; a 16 cm-period elliptical multipole wiggler; and many 33 mm-period undulators. Most of the IDs occupy storage-ring straight sections equipped with 8 mm vertical-aperture vacuum chambers. All of the IDs were measured magnetically at the APS and, in most cases, underwent a final magnetic tuning in order to minimize variation in the various integrals of the field through the ID over the full gap range. Special shimming techniques to correct magnetic field parameters in appropriate gap-dependent ways were developed and applied. Measurements of the closed-orbit distortion as a function of the ID gap variation have been completed, and results are in a good agreement with magnetic measurements. Spectral diagnostics of the ID radiation, including measurements of the absolute spectral flux, brilliance and polarization, show excellent agreement between calculated and measured results. Studies of the sensitivity of IDs to radiation exposure and measurements of the dose rate received by the IDs are in progress

  1. The APS control system network upgrade

    International Nuclear Information System (INIS)

    When it was installed,the Advanced Photon Source (APS) control system network was at the state-of-the-art. Different aspects of the system have been reported at previous meetings [1,2]. As loads on the controls network have increased due to newer and faster workstations and front-end computers, we have found performance of the system declining and have implemented an upgraded network. There have been dramatic advances in networking hardware in the last several years. The upgraded APS controls network replaces the original FDDI backbone and shared Ethernet hubs with redundant gigabit uplinks and fully switched 10/100 Ethernet switches with backplane fabrics in excess of 20 Gbits/s (Gbps). The central collapsed backbone FDDI concentrator has been replaced with a Gigabit Ethernet switch with greater than 30 Gbps backplane fabric. Full redundancy of the system has been maintained. This paper will discuss this upgrade and include performance data and performance comparisons with the original network

  2. Interfacial transport phenomena

    CERN Document Server

    Slattery, John C; Oh, Eun-Suok

    2007-01-01

    Revised and updated extensively from the previous editionDiscusses transport phenomena at common lines or three-phase lines of contactProvides a comprehensive summary about the extensions of continuum mechanics to the nanoscale

  3. Evaluating EPA’s AP-42 development methodology to convert or rerate current AP-42 datasets

    Science.gov (United States)

    In August 2013, the U.S. Environmental Protection Agency’s (EPA) published their new methodology for updating the Compilation of Air Pollution Emission Factors (AP-42). The “Recommended Procedures for Development of Emissions Factors and Use of the WebFIRE Database” instructs that the ratings of the...

  4. Evaluation of environmental impact produced by power distribution lines. Evaluacion de impacto ambiental de lineas aereas de transporte de energia electrica

    Energy Technology Data Exchange (ETDEWEB)

    Granadino Asenjo, A.; Fernandez Teran, E. (INTRADEL-Grupo Cobra (Spain))

    1993-01-01

    In Spain the analysis and evaluation of the environmental impact produced by power distribution lines (aerial) is carried out under Regional Governments regulations. In general, a description of the line characteristics and those actions and works that during assembly and installation might produce environmental alterations are evaluated. The method used to quantify all these effects is given. (Author)

  5. Butyrate produced by commensal bacteria potentiates phorbol esters induced AP-1 response in human intestinal epithelial cells.

    Directory of Open Access Journals (Sweden)

    Malgorzata Nepelska

    Full Text Available The human intestine is a balanced ecosystem well suited for bacterial survival, colonization and growth, which has evolved to be beneficial both for the host and the commensal bacteria. Here, we investigated the effect of bacterial metabolites produced by commensal bacteria on AP-1 signaling pathway, which has a plethora of effects on host physiology. Using intestinal epithelial cell lines, HT-29 and Caco-2, stably transfected with AP-1-dependent luciferase reporter gene, we tested the effect of culture supernatant from 49 commensal strains. We observed that several bacteria were able to activate the AP-1 pathway and this was correlated to the amount of short chain fatty acids (SCFAs produced. Besides being a major source of energy for epithelial cells, SCFAs have been shown to regulate several signaling pathways in these cells. We show that propionate and butyrate are potent activators of the AP-1 pathway, butyrate being the more efficient of the two. We also observed a strong synergistic activation of AP-1 pathway when using butyrate with PMA, a PKC activator. Moreover, butyrate enhanced the PMA-induced expression of c-fos and ERK1/2 phosphorylation, but not p38 and JNK. In conclusion, we showed that SCFAs especially butyrate regulate the AP-1 signaling pathway, a feature that may contribute to the physiological impact of the gut microbiota on the host. Our results provide support for the involvement of butyrate in modulating the action of PKC in colon cancer cells.

  6. Analysis of AP1000 containment passive cooling system during a loss-of-coolant accident

    International Nuclear Information System (INIS)

    Highlights: • GOTHIC code is used to model the AP1000 passive cooling system. • The pressure and temperature response compare with DCD. • Predicting the recirculation flow characteristics in secondary containment. • Predicting the nature circulation phenomena in AP1000 containment. - Abstract: A loss-of-coolant accident (LOCA) is one of the design basis accidents (DBAs) in nuclear power plant safety. DBAs may cause containment failure as a result of high temperature or pressure from LOCAs. This study investigates the integrity of the protective mechanism of the AP1000 containment system during a LOCA. The performance of the passive containment cooling system (PCCS) and the ability to perform decay heat removal for long-term cooling are evaluated in this study. The PCCS utilizes gravity-driven natural convection and naturally induced passive safety devices to move the decay heat of fuels to the atmosphere. In this study, two accidents are selected for analysis: a double-ended guillotine of a hot leg and a double-ended break of a main steam line. The analytical results are compared with the corresponding results provided in the AP1000 “Design Control Document” (DCD). The short-term calculations and comparisons with the DCD suggest that GOTHIC 7.2a with a natural convection model may properly represent the phenomenon of passive, safe heat removal. This paper also simulates the long-term calculations of spraying the outer primary containment with a water film and the steam condensation of the inner containment

  7. Evaluation of the Scaling of the APEX-1000 Test Facility to AP1000 for Design Basis Events

    International Nuclear Information System (INIS)

    The AP1000 is a 1000 MWe advanced nuclear power plant that uses passive safety features to enhance plant safety and to provide significant and measurable improvements in plant simplification, reliability, investment protection and plant costs. The AP1000 relies heavily on the 600 MWe AP600 which received design certification in 1999. A critical part of the AP600 design certification process involved the testing of the passive safety systems. A one-fourth height, one-fourth pressure test facility, APEX-600, was constructed at the Oregon State University to study design basis events, and to provide a body of data to be used to validate the computer models used to analyze the AP600. This facility was extensively modified to reflect the design changes for AP1000 including higher power in the electrically heated rods representing the reactor core, and changes in the size of the pressurizer, core makeup tanks and automatic depressurization system. Several design basis events have been simulated at APEX-1000 including double-ended direct vessel injection (DEDVI) line break, 2-inch cold leg break, and inadvertent actuation of the automatic depressurization system. These events were analyzed as part of the AP1000 safety analysis using the NOTRUMP computer code. Applying the scaling factors that were used to size the APEX-1000 facility, the test results can be compared to the NOTRUMP plant simulations. These comparisons indicate the similarity between the design basis events in AP1000 and APEX-1000, the adequacy of the scaling of APEX-1000, and the applicability of the NOTRUMP code. (authors)

  8. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  9. Network Cooperation for Client-AP Association Optimization

    OpenAIRE

    Baid, Akash; Schapira, Michael; Seskar, Ivan; Rexford, Jennifer; Raychaudhuri, Dipankar

    2012-01-01

    In a WiFi deployment with multiple access points, optimizing the way each client selects an AP from amongst the available choices, has a significant impact on the realized performance. When two or more such multi-AP networks are deployed in the same region, APs from different networks can cause severe interference to one another. In this paper, we study how inter-network interference effects the intra-network association optimization and propose a cooperative optimization scheme to mitigate t...

  10. Determination of absolute transport efficiencies of Be, Cd, In, Pb and Bi for electrothermal vaporization sample introduction into an inductively coupled plasma using an in-line electrostatic precipitator

    Energy Technology Data Exchange (ETDEWEB)

    Ertas, Gulay; Holcombe, James A. E-mail: holcombe@mail.utexas.edu

    2003-09-26

    A novel laboratory-constructed electrostatic precipitator for the determination of analyte transport efficiencies from a tube furnace electrothermal vaporization (ETV) sample introduction system is described. This simple experimental set up captures the analyte electrostatically using a negative corona discharge. The absolute transport efficiencies using experimental conditions typical of those applied to real analysis by ETV-ICP-MS were determined for Be, Cd, In, Pb and Bi to be 26{+-}3, 39{+-}8, 35{+-}1, 50{+-}11 and 35{+-}1%, respectively. Pd and NaCl were evaluated as 'carriers' and were found to only marginally increase analyte transport for the elements investigated. Pd enhanced efficiencies 20-50% for all but Bi, which decreased by 17%. The NaCl produced transport enhancements of 10-50% for all five analytes. However, uncertainties in the measurements made several of the individual improvements statistically insignificant. The mean precipitator collection efficiency of the aerosol leaving the ETV for the five elements studied was found to be greater than 90% and was determined using the ICP-MS signal with the in-line precipitator's voltage either on or off. While 30 ETV firings were used for a single efficiency determination, reasonable precision could be obtained with approximately 10 firings while still employing reasonable analyte masses, i.e. approximately 20 ng. The transport results are in good agreement with previous studies using similar ETV design and analyte masses.

  11. Adaptor protein complexes AP-1 and AP-3 are required by the HHV-7 Immunoevasin U21 for rerouting of class I MHC molecules to the lysosomal compartment.

    Directory of Open Access Journals (Sweden)

    Lisa A Kimpler

    Full Text Available The human herpesvirus-7 (HHV-7 U21 gene product binds to class I major histocompatibility complex (MHC molecules and reroutes them to a lysosomal compartment. Trafficking of integral membrane proteins to lysosomes is mediated through cytoplasmic sorting signals that recruit heterotetrameric clathrin adaptor protein (AP complexes, which in turn mediate protein sorting in post-Golgi vesicular transport. Since U21 can mediate rerouting of class I molecules to lysosomes even when lacking its cytoplasmic tail, we hypothesize the existence of a cellular protein that contains the lysosomal sorting information required to escort class I molecules to the lysosomal compartment. If such a protein exists, we expect that it might recruit clathrin adaptor protein complexes as a means of lysosomal sorting. Here we describe experiments demonstrating that the μ adaptins from AP-1 and AP-3 are involved in U21-mediated trafficking of class I molecules to lysosomes. These experiments support the idea that a cellular protein(s is necessary for U21-mediated lysosomal sorting of class I molecules. We also examine the impact of transient versus chronic knockdown of these adaptor protein complexes, and show that the few remaining μ subunits in the cells are eventually able to reroute class I molecules to lysosomes.

  12. Road and Street Centerlines - INTERSTATES_I_69_INDOT_IN: Interstate Extension for I-69 in Southern Indiana (Indiana Department of Transportation, Line Shapefile)

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — INTERSTATES_I_69_INDOT_IN is a line shapefile that contains the newly developed I-69 route and associated ramps in southern Indiana, from Evansville to Bloomington....

  13. Light Rail and Subway Lines, This layer represents MTA's Lightrail transportation network., Published in 2007, 1:12000 (1in=1000ft) scale, City of Baltimore.

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This Light Rail and Subway Lines dataset, published at 1:12000 (1in=1000ft) scale, was produced all or in part from Field Observation information as of 2007. It is...

  14. Market analysis of APS/SCM applications and technologies

    OpenAIRE

    Prášil, Zdeněk

    2009-01-01

    The bachelor thesis aims to describe a current worldwide market of APS/SCM technologies and applications , i.e. advanced planned scheduling /supply chain management. In the first part, the APS/SCM is described in theory. The APS/SCM is defined and its benefits and impacts on company are discussed. The next part of the work is focused on the market with APS/SCM and the distribution of forces in the market. The demand and supply of this market segment is analyzed. In the last part, solutions of...

  15. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    International Nuclear Information System (INIS)

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability

  16. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  17. Characterization of liquid entrainment in the AP1000 automatic depressurization system from APEX tests

    International Nuclear Information System (INIS)

    Full text of publication follows: The AP1000 is a 1000 MWe advanced nuclear power plant that uses passive safety features to enhance plant safety and to provide significant and measurable improvements in plant simplification, reliability, investment protection and plant costs. The AP1000 relies heavily on the 600 MWe AP600 which received design certification in 1999. A critical part of the AP600 design certification process involved the testing of the passive safety systems. A one-fourth height, one-fourth pressure test facility, APEX-600, was constructed at the Oregon State University to study design basis events, and to provide a body of data to be used to validate the computer models used to analyze the AP600. This facility was extensively modified to reflect the design changes for AP1000 including higher power in the electrically heated rods representing the reactor core, and changes in the size of the pressurizer, core makeup tanks and automatic depressurization system. The APEX-1000 test facility was used to perform design basis accident simulations and separate effects tests to support the AP1000 design certification process. In the event of a LOCA, the AP1000 passive core cooling system provides sources of core makeup water along with an automatic depressurization system (ADS) consisting of several stages of valves which reduce the reactor coolant system pressure in a controlled manner. The final stage of this system, ADS-4, consists of four large valves that open off the hot legs, reducing the pressure to allow gravity injection from the in-containment refueling water storage tank (IRWST) and eventually the containment sump. The 67% increase in power from AP600 to AP1000 results in proportionally larger steam velocities exiting the core. Higher steam velocities could increases the potential for significant liquid entrainment out the ADS-4 lines, affecting the liquid inventory in the reactor. Tests were performed in APEX-1000 to characterize the two

  18. Characterization of liquid entrainment in the AP1000 automatic depressurization system from APEX tests

    Energy Technology Data Exchange (ETDEWEB)

    Richard F Wright; Terry L Schulz [Westinghouse Electric Co., PO Box 355, Pittsburgh, PA (United States); Jose N Reyes; John Groome [Oregon State University, Corvallis, OR (United States)

    2005-07-01

    Full text of publication follows: The AP1000 is a 1000 MWe advanced nuclear power plant that uses passive safety features to enhance plant safety and to provide significant and measurable improvements in plant simplification, reliability, investment protection and plant costs. The AP1000 relies heavily on the 600 MWe AP600 which received design certification in 1999. A critical part of the AP600 design certification process involved the testing of the passive safety systems. A one-fourth height, one-fourth pressure test facility, APEX-600, was constructed at the Oregon State University to study design basis events, and to provide a body of data to be used to validate the computer models used to analyze the AP600. This facility was extensively modified to reflect the design changes for AP1000 including higher power in the electrically heated rods representing the reactor core, and changes in the size of the pressurizer, core makeup tanks and automatic depressurization system. The APEX-1000 test facility was used to perform design basis accident simulations and separate effects tests to support the AP1000 design certification process. In the event of a LOCA, the AP1000 passive core cooling system provides sources of core makeup water along with an automatic depressurization system (ADS) consisting of several stages of valves which reduce the reactor coolant system pressure in a controlled manner. The final stage of this system, ADS-4, consists of four large valves that open off the hot legs, reducing the pressure to allow gravity injection from the in-containment refueling water storage tank (IRWST) and eventually the containment sump. The 67% increase in power from AP600 to AP1000 results in proportionally larger steam velocities exiting the core. Higher steam velocities could increases the potential for significant liquid entrainment out the ADS-4 lines, affecting the liquid inventory in the reactor. Tests were performed in APEX-1000 to characterize the two

  19. Experimental and analytical studies on fixed mask assembly for APS with enhanced cooling

    International Nuclear Information System (INIS)

    Fixed mask assembly is the first component which interacts with the photon beam emanating from Advanced Photon Source (APS) insertion devices. Two sets of masks, one horizontal and another vertical pair, contain the beam, limiting its excursion from its present center line. Conventional construction of these masks, such as those used in NSLS X-17 beam line, has been two water cooled heavy copper channels configured in a open-quote vclose quotes arrangement and set at grazing angles to the beam. A comparative investigation of the conventionally achievable heat transfer coefficient open-quote hclose quotes with water and the wall conductance of the copper structure reveals that major resistance is on the coolant side. Therefore, there exists a significant opportunity to improve heat transfer in the masks by enhancement of the coolant side. To this end a variety of enhanced copper tubes were subjected to laboratory tests with water and conventional heating to assess the resulting heat transfer improvement. This was followed by an analytical study of the candidate mask design for APS using the heat transfer data from the laboratory tests but subject to APS beam heating. Design improvements using enhanced cooling are discussed in terms of structural weight, controls, grazing angles, the operational reliability, and safety

  20. Transmission Lines or Poles, Electric, MDTA High Mast lighting, High Mast Lighting along I 95, Maryland Transportation Authority High Mast Lighting poles, Published in 2011, 1:1200 (1in=100ft) scale, Maryland Transportation Authority.

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This Transmission Lines or Poles, Electric dataset, published at 1:1200 (1in=100ft) scale, was produced all or in part from Orthoimagery information as of 2011. It...

  1. Genome-Wide Identification of the Target Genes of AP2-O, a Plasmodium AP2-Family Transcription Factor.

    Science.gov (United States)

    Kaneko, Izumi; Iwanaga, Shiroh; Kato, Tomomi; Kobayashi, Issei; Yuda, Masao

    2015-05-01

    Stage-specific transcription is a fundamental biological process in the life cycle of the Plasmodium parasite. Proteins containing the AP2 DNA-binding domain are responsible for stage-specific transcriptional regulation and belong to the only known family of transcription factors in Plasmodium parasites. Comprehensive identification of their target genes will advance our understanding of the molecular basis of stage-specific transcriptional regulation and stage-specific parasite development. AP2-O is an AP2 family transcription factor that is expressed in the mosquito midgut-invading stage, called the ookinete, and is essential for normal morphogenesis of this stage. In this study, we identified the genome-wide target genes of AP2-O by chromatin immunoprecipitation-sequencing and elucidate how this AP2 family transcription factor contributes to the formation of this motile stage. The analysis revealed that AP2-O binds specifically to the upstream genomic regions of more than 500 genes, suggesting that approximately 10% of the parasite genome is directly regulated by AP2-O. These genes are involved in distinct biological processes such as morphogenesis, locomotion, midgut penetration, protection against mosquito immunity and preparation for subsequent oocyst development. This direct and global regulation by AP2-O provides a model for gene regulation in Plasmodium parasites and may explain how these parasites manage to control their complex life cycle using a small number of sequence-specific AP2 transcription factors. PMID:26018192

  2. Decision Support Facility for the APS Control System

    CERN Document Server

    Dohan, D A

    2001-01-01

    The Advanced Photon Source is now in its fifth year of routine beam production. The EPICS-based [1] control system has entered the phase in its life cycle where new control algorithms must be implemented under increasingly stringent operational and reliability requirements. The sheer volume of the control system (~270,000 records, ~145 VME-based input-output controllers (IOCs), and ~7,000,000 lines of EPICS ASCII configuration code), presents a daunting challenge for code maintenance. The present work describes a relational database that provides an integrated view of the interacting components of the entire APS control system, including the IOC low-level logic, the physical wiring documentation, and high-level client applications. The database is extracted (booted) from the same operational CVS repository as that used to load the active IOCs. It provides site-wide decision support facilities to inspect and trace control flow and to identify client (e.g., user interface) programs involved at any selected poin...

  3. Status of the Advanced Photon Source (APS) linear accelerator

    International Nuclear Information System (INIS)

    A 2856-MHz S-band, 450-MeV electron/positron linear accelerator is the first part of the injector for the Advanced Photon Source (APS) 7-GeV storage ring. Construction of the APS linac is currently nearing completion, and commissioning will begin in July 1993. The linac and its current status are discussed in this paper

  4. AP1000 passive safety system design and analysis

    International Nuclear Information System (INIS)

    Westinghouse Electric Company has designed an advanced 600 MW nuclear power plant called the AP600. The AP600 uses passive safety systems to enhance plant safety and to satisfy US licensing requirements. The use of passive safety systems has provided significant and measurable improvements in plant simplification, safety, reliability, investment protection and plant costs. The overnight capital cost for the first AP600 plant is calculated to be between 1300- 1500 $/kw depending on the site selection. Although the AP600 is the most cost effective plant ready for deployment, it is still more expensive than the $1000/kw needed to compete in the United States today. In order to develop a cost competitive nuclear power plant Westinghouse has completed design studies which demonstrate that it is feasible to increase the power output of the AP600 to at least 1000 MW, maintaining its current design configuration, use of proven components and licensing basis. The AP1000 reactor and passive safety features retain the same configuration as the AP600. The approach to designing the passive core cooling features is to evaluate each feature to determine if changes are necessary to provide proper safety margins at the higher power rating. Both design basis and PRA based accidents sequences are considered in this evaluation. Insights from the extensive AP600 test and analysis program are used to assist in this process. The results of preliminary accident analysis for DBA and PRA sequences are used to demonstrate the effectiveness of this approach. (author)

  5. A Closer Examination of the Academic Benefits of AP

    Science.gov (United States)

    McKillip, Mary E. M.; Rawls, Anita

    2013-01-01

    The authors sought to better understand the relationship between students participating in the Advanced Placement (AP) program and subsequent performance on the Scholastic Aptitude Test (SAT). Focusing on students graduating from U.S. public high schools in 2010, the authors used propensity scores to match junior year AP examinees in 3 subjects to…

  6. AP-42 ADDITIONS AND REVISIONS - LANDFILLS (COMBUSTION CONTROLS)

    Science.gov (United States)

    This project develops emission factors, etc., for landfills, in particular for combustion devices fed by landfill gas, for incorporation into AP-42. AP-42 is a massive collection of information concerning processes which generate air emissions and presents emission factors and co...

  7. Data-Based Decision Making: The Road to AP Equity

    Science.gov (United States)

    Edwards, Kelcey; Duggan, Odette

    2012-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Lake Buena Vista, FL in July 2012. This presentation reviews concepts central to achieving equitable AP access and success for all willing and academically prepared students. We analyze trends in participation and performance by race/ethnicity from the AP Report to the Nation and…

  8. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  9. Training and development of the Assistant Practitioners (APs) in radiography

    International Nuclear Information System (INIS)

    A mixed methods study conducted over three phases (Phase I – scoping exercise, Phase II – questionnaire and Phase III – semi-structured interviews) aimed to explore the role and integration of the assistant practitioner (AP) practitioner in radiography from the AP perspective. Findings of the overall study are presented across a range of articles where this publication only presents the findings in relation to the training and education of APs from all three phases. Results showed the educational routes undertaken by APs in radiography during training. Training whilst working in the clinical department has highlighted a number of key issues relating to educational pathways and delivery methods. Findings showed that APs felt that more could be done to prepare the individual for clinical practice thereby increasing their confidence and facilitating role development. Results also identified a number of challenges in the training and education of APs in radiography. Clear routes of progression and career pathways are not available to APs in radiography. In conclusion the findings suggest the need for a review of existing educational programmes and future standardisation. The need exists to clarify the justifiable methods of training and differentiate between recognised educational qualifications to enable informed career development decisions by APs and their employers

  10. The development of beam current monitors in the APS

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) is a third-generation 7-GeV synchrotron radiation source. The precision measurement of beam current is a challenging task in high energy accelerators, such as the APS, with a wide range of beam parameters and complicated noise, radiation, and thermal environments. The beam pulses in the APS injector and storage ring have charge ranging from 50pC to 25nC with pulse durations varying from 30ps to 30ns. A total of nine non- intercepting beam current monitors have been installed in the APS facility (excluding those in the linac) for general current measurement. In addition, several independent current monitors with specially designed redundant interlock electronics are installed for personnel safety and machine protection. This paper documents the design and development of current monitors in the APS,. discusses the commissioning experience in the past year, and presents the results of recent operations

  11. Properties of LuAP: CE scintillator containing intentional impurities

    CERN Document Server

    Petrosyan, A G; Ovanesyan, K; Lecoq, Paul; Auffray, Etiennette; Trummer, Julia; Kronberger, Matthias; Pédrini, C; Dujardin, C; Anfre, P

    2007-01-01

    Single crystals of LuAP:Ce and LuYAP(Lu*70%):Ce co-doped with tetravalent (Hf and Zr) and pentavalent (Ta) ions were grown from melts by the Bridgman process. Underlying absorption, slope of the optical edge and transmission in the range of emission were compared to those of LuAP:Ce crystals. Absorption coefficients at 260 nm less than 2 cm−1 have been recorded in LuAP:Ce crystals containing tetravalent ions that are lower than the corresponding figures (5–6 cm−1) measured in undoped LuAP. At high concentrations of added impurities, despite of suppression of the parasitic underlying absorption below 300 nm, the slope of the optical edge and transmission in the range of emission are seriously damaged. Scintillation parameters of crystals with added impurities are compared to those of LuAP:Ce.

  12. AP1000, a nuclear central of advanced design

    International Nuclear Information System (INIS)

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  13. Using metallic filters in APS undulator beamlines

    International Nuclear Information System (INIS)

    Metallic filters are needed by APS users in their beamlines. Two general areas of use for the white-beam metallic filters are: (1) to attenuate the x-ray beam to reduce the thermal load during routine operations and (2) to attenuate the x-ray beam during alignment and for special testing of optics at low power. Metallic filters are important for users who will be working primarily in the high energy x-ray range because unwanted lower energy photons are absorbed through the metallic filters. Notwithstanding their high thermal conductivity, the metals, in general, absorb x-rays significantly near surface layers and hence can attain very large temperatures causing structural deformations and/or damage. Thermomechanical behavior and failure prediction need to be done carefully. In this paper, particulars of metallic filters are discussed and generalized analytical solutions are offered to help users of metallic filters determine their applicability for x-ray beamlines copyright 1996 American Institute of Physics

  14. Top-up operation experience at APS

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) is a 7-OeV, third-generation synchrotrons radiation source. To provide more stable beam for users, in September 1998 we began commissioning a new operating mode called ''top-up.'' In this mode, the beam current does not decay but is maintained at a high level using frequent injection, while photon shutters are open and photon beams are delivered to users. The hardware, software, and safety requirements for top-up will be reported. Safety issues related to injection with open photon shutters are covered in companion papers in this conference. Recent operational experience includes testing aspects of top-up injection and delivering beam to X-ray users for a few hours with fractional current stability of 10-3. We expect to run several top-up operation shifts in Spring 1999. Issues of importance are orbit and emittance transients during the injection and scheduling of injection pulses for the convenience of users

  15. Beam instability studies at the APS

    International Nuclear Information System (INIS)

    The Argonne Advanced Photon Source, APS (Fig. 1), is a 7-GeV positron storage ring with a circumference of 1104 m. It has a ''third generation, DBA or Chasman-Green'' lattice composed of 40 sectors each having a ∼6 m long zero-dispersion straight-section for accommodating insertion devices. Neighboring straight-sections are connected by a 360 degrees/40 = 9 degrees double-bend-achromatic bending section designed to produce the smallest emittance attainable with reasonable component parameter values and dynamic apertures. Thus, it is a very strongly focusing lattice with vx = 35.22 and vy = 14.30. The beam chamber of the storage ring including all rf, vacuum and photon beam components is designed to ensure that a beam current > 100 mA can be stably stored. We expect that the maximum stable beam current could be as high as 300 mA. This paper will give some details of the studies and computations to ensure the stability of such a beam. The discussions will be organized in the following three parts: Coupled-bunch instability caused by the higher-order modes (HOMs) of the rf cavities; Single-bunch instability due to the resistive wall impedance; and Single-bunch instability due to broadband impedances arising from beam chamber irregularities

  16. IL12A, MPHOSPH9/CDK2AP1 and RGS1 are novel multiple sclerosis susceptibility loci

    DEFF Research Database (Denmark)

    Sørensen, Per Soelberg

    2010-01-01

    same direction of effect observed in the discovery phase. Three loci exceeded genome-wide significance in the joint analysis: RGS1 (P value=3.55 x 10(-9)), IL12A (P=3.08 x 10(-8)) and MPHOSPH9/CDK2AP1 (P=3.96 x 10(-8)). The RGS1 risk allele is shared with celiac disease (CD), and the IL12A risk allele...... seems to be protective for celiac disease. Within the MPHOSPH9/CDK2AP1 locus, the risk allele correlates with diminished RNA expression of the cell cycle regulator CDK2AP1; this effect is seen in both lymphoblastic cell lines (P=1.18 x 10(-5)) and in peripheral blood mononuclear cells from subjects with...

  17. Enhancing and Archiving the APS Catalog of the POSS I

    Science.gov (United States)

    Humphreys, Roberta M.

    2003-01-01

    We have worked on two different projects: 1) Archiving the APS Catalog of the POSS I for distribution to NASA's NED at IPAC, SIMBAD in France, and individual astronomers and 2) The automated morphological classification of galaxies. We have completed archiving the Catalog into easily readable binary files. The database together with the software to read it has been distributed on DVD's to the national and international data centers and to individual astronomers. The archived Catalog contains more than 89 million objects in 632 fields in the first epoch Palomar Observatory Sky Survey. Additional image parameters not available in the original on-line version are also included in the archived version. The archived Catalog is also available and can be queried at the APS web site (URL: http://aps.umn.edu) which has been improved with a much faster and more efficient querying system. The Catalog can be downloaded as binary datafiles with the source code for reading it. It is also being integrated into the SkyQuery system which includes the Sloan Digital Sky Survey, 2MASS, and the FIRST radio sky survey. We experimented with different classification algorithms to automate the morphological classification of galaxies. This is an especially difficult problem because there are not only a large number of attributes or parameters and measurement uncertainties, but also the added complication of human disagreement about the adopted types. To solve this problem we used 837 galaxy images from nine POSS I fields at the North Galactic Pole classified by two independent astronomers for which they agree on the morphological types. The initial goal was to separate the galaxies into the three broad classes relevant to issues of large scale structure and galaxy formation and evolution: early (ellipticals and lenticulars), spirals, and late (irregulars) with an accuracy or success rate that rivals the best astronomer classifiers. We also needed to identify a set of parameters derived

  18. Some ethylene biosynthesis and AP2/ERF genes reveal a specific pattern of expression during somatic embryogenesis in Hevea brasiliensis

    Directory of Open Access Journals (Sweden)

    Piyatrakul Piyanuch

    2012-12-01

    Full Text Available Abstract Background Ethylene production and signalling play an important role in somatic embryogenesis, especially for species that are recalcitrant in in vitro culture. The AP2/ERF superfamily has been identified and classified in Hevea brasiliensis. This superfamily includes the ERFs involved in response to ethylene. The relative transcript abundance of ethylene biosynthesis genes and of AP2/ERF genes was analysed during somatic embryogenesis for callus lines with different regeneration potential, in order to identify genes regulated during that process. Results The analysis of relative transcript abundance was carried out by real-time RT-PCR for 142 genes. The transcripts of ERFs from group I, VII and VIII were abundant at all stages of the somatic embryogenesis process. Forty genetic expression markers for callus regeneration capacity were identified. Fourteen markers were found for proliferating calli and 35 markers for calli at the end of the embryogenesis induction phase. Sixteen markers discriminated between normal and abnormal embryos and, lastly, there were 36 markers of conversion into plantlets. A phylogenetic analysis comparing the sequences of the AP2 domains of Hevea and Arabidopsis genes enabled us to predict the function of 13 expression marker genes. Conclusions This first characterization of the AP2/ERF superfamily in Hevea revealed dramatic regulation of the expression of AP2/ERF genes during the somatic embryogenesis process. The gene expression markers of proliferating callus capacity to regenerate plants by somatic embryogenesis should make it possible to predict callus lines suitable to be used for multiplication. Further functional characterization of these markers opens up prospects for discovering specific AP2/ERF functions in the Hevea species for which somatic embryogenesis is difficult.

  19. Dicty_cDB: FC-AP05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP05 (Link to dictyBase) - - - Contig-U16521-1 FC-AP05Z (Li...nk to Original site) - - FC-AP05Z 532 - - - - Show FC-AP05 Library FC (Link to library) Clone ID FC-AP05 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP05Q.Seq.d/ Representative seq. ID FC-AP...05Z (Link to Original site) Representative DNA sequence >FC-AP05 (FC-AP05Q) /CSM/FC/FC-AP/FC-AP05Q.Seq....GAGA TCCGTCAAAGTTTCAAGCAAAAAAGTTGTTGCCAAGTAAATAAATAATACTTTTTTCCCT AT sequence update 1997. 3.25 Translated Amino Acid sequence ---AP

  20. Dicty_cDB: FC-AP23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP23 (Link to dictyBase) - G03230 DDB0190153 Contig-U16094-1 FC-AP...23P (Link to Original site) FC-AP23F 515 FC-AP23Z 472 FC-AP23P 987 - - Show FC-AP23 Library FC (Link ...ontig Contig-U16094-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...23Q.Seq.d/ Representative seq. ID FC-AP23P (Link to Original site) Representative DNA sequence >FC-AP23 (FC-AP...23Q) /CSM/FC/FC-AP/FC-AP23Q.Seq.d/ CAAATACATAATCTCTTTTTTGAAAATGTCCGAAAATAACGAAATTGAAATGGAACTCC

  1. Dicty_cDB: FC-AP12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP12 (Link to dictyBase) - G01739 DDB0232214 Contig-U15924-1 FC-AP...12P (Link to Original site) FC-AP12F 323 FC-AP12Z 613 FC-AP12P 936 - - Show FC-AP12 Library FC (Link ...ontig Contig-U15924-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...12Q.Seq.d/ Representative seq. ID FC-AP12P (Link to Original site) Representative DNA sequence >FC-AP12 (FC-AP...12Q) /CSM/FC/FC-AP/FC-AP12Q.Seq.d/ CATATTATTTTAAATTTCAGATGTTCCCAAAATAACACATTAATTTGCTTTTTTTGTTG

  2. AP1000R licensing and deployment in the United States

    International Nuclear Information System (INIS)

    In recent years, both domestic and foreign utilities have turned to the standardized Westinghouse AP1000 plant design in satisfying their near - and long-term - sustainable energy needs. As direct support to these actions, licensing the AP1000 design has played a significant role by providing one of the fundamental bases in clearing regulatory hurdles leading to the start of new plant construction. Within the U.S. alone, Westinghouse AP1000 licensing activities have reached unprecedented milestones with the approvals of both AP1000 Design Certification and Southern Company's combined construction permit and operating license (COL) application directly supporting the construction of two new nuclear plants in Georgia. Further COL application approvals are immediately pending for an additional two AP1000 plants in South Carolina. And, across the U.S. nuclear industry spectrum, there are 10 other COL applications under regulatory review representing some 16 new plants at 10 sites. In total, these actions represent the first wave of new plant licensing under the regulatory approval process since 1978. Fundamental to the Nuclear Regulatory Commission's AP1000 Design Certification is the formal recognition of the AP1000 passive safety design through regulatory acceptance rulemaking. Through recognition and deployment of the AP1000 Design Certification, the utility licensee / operator of this reactor design are now offered an opportunity to use a simplified 'one-step' combined license process, thereby managing substantial back-end construction schedule risk from regulatory and intervention delays. Application of this regulatory philosophy represents both acceptance and encouragement of standardized reactor designs like the AP1000. With the recent AP1000 Design Certification and utility COL acceptances, the fundamental licensing processes of this philosophy have successfully proven the attainment of significant milestones with the next stage licensing actions directed

  3. Sorting of the Alzheimer's Disease Amyloid Precursor Protein Mediated by the AP-4 Complex

    Energy Technology Data Exchange (ETDEWEB)

    Burgos, Patricia V.; Mardones, Gonzalo A.; Rojas, Adriana L.; daSilva, Luis L.P.; Prabhu, Yogikala; Hurley, James H.; Bonifacino, Juan S. (NIH)

    2010-08-12

    Adaptor protein 4 (AP-4) is the most recently discovered and least well-characterized member of the family of heterotetrameric adaptor protein (AP) complexes that mediate sorting of transmembrane cargo in post-Golgi compartments. Herein, we report the interaction of an YKFFE sequence from the cytosolic tail of the Alzheimer's disease amyloid precursor protein (APP) with the {micro}4 subunit of AP-4. Biochemical and X-ray crystallographic analyses reveal that the properties of the APP sequence and the location of the binding site on 4 are distinct from those of other signal-adaptor interactions. Disruption of the APP-AP-4 interaction decreases localization of APP to endosomes and enhances {gamma}-secretase-catalyzed cleavage of APP to the pathogenic amyloid-{beta} peptide. These findings demonstrate that APP and AP-4 engage in a distinct type of signal-adaptor interaction that mediates transport of APP from the trans-Golgi network (TGN) to endosomes, thereby reducing amyloidogenic processing of the protein.

  4. Continuous on-line calibration of diffusive soil-atmosphere trace gas transport using vertical 220Rn- and 222Rn-activity profiles

    International Nuclear Information System (INIS)

    Continuous monitoring of 220Rn- and 222Rn-activities above and below the soil surface combined with sporadic direct 222Rn-flux measurements is used to quantify diffusive trace gas transport in the air-filled pore space of soil, through the soil-atmosphere interface and in the lowest layers of the atmosphere. In a calm night, 222Rn-activities above the surface first build-up near the ground (z 222Rn-flux from activity profiles measured in soil gas, (2) from direct flux determinations and (3) using information about atmospheric diffusion parameters from 220Rn-activities measured near the surface it is possible to model the temporal evolution of the vertical 222Rn-profiles in a night with stable weather and constant soil conditions. The system operates automatically for extended periods of time in the field enabling a better understanding of transport processes in response to changing environmental conditions (wind, rain, soil humidity). (orig.)

  5. Westinghouse-GOTHIC comparisons to AP600 passive containment cooling tests

    International Nuclear Information System (INIS)

    Westinghouse-GOTHIC is a thermal-hydraulics code well suited to analyzing passively cooled containments which depend on heat removal primarily through the containment shell. The code includes boundary layer heat and mass transfer correlations. A liquid film convective energy transport model has been added to the Westinghouse-GOTHIC code to account for the sensible heat change of the applied exterior water. The objective of this paper is to compare the code's predictions of the AP600 large scale test facility with and without the liquid film convective energy transport model. The predicted vessel pressure and integrated heat rate with and without the film convective energy transport model will be compared to the measured data. (author)

  6. A high-order unstaggered constrained transport method for the 3D ideal magnetohydrodynamic equations based on the method of lines

    OpenAIRE

    Helzel, Christiane; Rossmanith, James A.; Taetz, Bertram

    2012-01-01

    Numerical methods for solving the ideal magnetohydrodynamic (MHD) equations in more than one space dimension must confront the challenge of controlling errors in the discrete divergence of the magnetic field. One approach that has been shown successful in stabilizing MHD calculations are constrained transport (CT) schemes. CT schemes can be viewed as predictor-corrector methods for updating the magnetic field, where a magnetic field value is first predicted by a method that does not exactly p...

  7. Magnetic activity of the spotted dwarf AP149 in the α Persei open cluster

    International Nuclear Information System (INIS)

    The simultaneous photometric and spectroscopic observations of the spotted G dwarf AP149 in the young open cluster α Persei are analyzed here. We reconstruct the observed light curves with a two-starspot model by means of a light curve modeling technique, and find that the active regions shift oppositely along longitude on a time scale of one day. Combining with the observational data obtained by other groups, we discuss the evolution of spotted regions in the photosphere, and find that its starspots evolve not only on a short time scale but also on a long time scale. The pure chromospheric emissions for Ca IIHK and Hβ lines are derived by using the spectral subtraction technique. The variation of Ca IIHK lines' excess emission is spatially correlated to the starspot regions. There is no clear rotational modulation for the Hβ line's excess emission, probably due to the contamination of prominence emission.

  8. AP600 design certification thermal hydraulics testing and analysis

    International Nuclear Information System (INIS)

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power

  9. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.

    1995-09-01

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  10. Tank 241-AP-105, cores 208, 209 and 210, analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final laboratory report for Tank 241-AP-105. Push mode core segments were removed from Risers 24 and 28 between July 2, 1997, and July 14, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-AP-105 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997) and Tank Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT), differential scanning calorimetry (DSC) analysis, or total organic carbon (TOC) analysis exceeded the notification limits as stated in TSAP and DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report. Appearance and Sample Handling Two cores, each consisting of four segments, were expected from Tank 241-AP-105. Three cores were sampled, and complete cores were not obtained. TSAP states core samples should be transported to the laboratory within three calendar days from the time each segment is removed from the tank. This requirement was not met for all cores. Attachment 1 illustrates subsamples generated in the laboratory for analysis and identifies their sources. This reference also relates tank farm identification numbers to their corresponding 222-S Laboratory sample numbers

  11. Analysis of an AP600 intermediate-size loss-of-coolant accident

    International Nuclear Information System (INIS)

    A postulated double-ended guillotine break of an AP600 direct-vessel-injection line has been analyzed. This event is characterized as an intermediate-break loss-of-coolant accident. Most of the insights regarding the response of the AP600 safety systems to the postulated accident are derived from calculations performed with the TRAC-PF1/MOD2 code. However, complementary insights derived from a scaled experiment conducted in the ROSA facility, as well as insights based upon calculations by other codes, are also presented. Based upon the calculated and experimental results, the AP600 will not experience a core heat up and will reach a safe shutdown state using only safety-class equipment. Only the early part of the long-term cooling period initiated by In-containment Refueling Water Storage Tank injection was evaluated. Thus, the observation that the core is continuously cooled should be verified for the later phase of the long-term cooling period when sump injection and containment cooling processes are important

  12. Analysis of an AP600 intermediate-size loss-of-coolant accident

    Energy Technology Data Exchange (ETDEWEB)

    Boyack, B.E.; Lime, J.F. [Los Alamos National Lab., NM (United States)

    1995-09-01

    A postulated double-ended guillotine break of an AP600 direct-vessel-injection line has been analyzed. This event is characterized as an intermediate-break loss-of-coolant accident. Most of the insights regarding the response of the AP600 safety systems to the postulated accident are derived from calculations preformed with the TRAC-PF1/MOD2 code. However, complementary insights derived from a scaled experiment conducted in the ROSA facility, as well as insights based upon calculations by other codes, are also presented. Based upon the calculated and experimental results, the AP600 will not experience a core heat up and will reach a safe shutdown state using only safety-class equipment. Only the early part of the long-term cooling period initiated by In-containment Refueling Water Storage Tank injection was evaluated. Thus, the observation that the core is continuously cooled should be verified for the later phase of the long-term cooling period when sump injection and containment cooling processes are important.

  13. Time-dependent atomic diffusion in magnetic ApBp stars

    Science.gov (United States)

    Stift, M. J.; Alecian, G.

    2016-03-01

    Numerical modelling of surface abundance distributions in ApBp star atmospheres constitutes a challenging astrophysical problem. This paper is intended to deepen our understanding of how atomic diffusion affects the atmospheric structure of magnetic ApBp stars, and in particular how time-dependent calculations may be compared to the alternative method of estimating equilibrium stratifications. Our numerical calculations - with the stellar atmosphere adjusted self-consistently to the abundance profiles - show that final stationary solutions of the time-dependent diffusion problem (constant particle flux throughout the stellar atmosphere) are seemingly at variance with equilibrium stratifications (zero particle flux). In this work, we will provide some understanding of the origin of these differences and try to elucidate the as yet little explored behaviour of time-dependent atomic diffusion. To this purpose, we assess the influence of the boundary condition at the bottom of the atmosphere, we investigate how the stratifications depend on magnetic field angle and strength, and we have a look at possible interactions between different chemical elements. Based on a grid of atmospheric models and stratifications reflecting dipolar magnetic geometries, we also present predicted line profiles for different oblique rotator models. Finally, we shortly discuss the consequences of our findings for the interpretation of abundance maps of magnetic ApBp stars.

  14. Large-scale wind energy application. Transporting wind energy over long distances using an HVDC transmission line, in combination with hydro energy or biomass energy

    International Nuclear Information System (INIS)

    The main objective of the study on the title subject is to assess the long-term prospects for large-scale application of wind energy, in combination with hydro energy in Norway and in combination with biomass energy in Scotland. These countries have high wind resource areas, however they are located far away from load centres. The development of new transmission technologies as High Voltage Direct Current (HVDC) transmission lines, in combination with highly suitable places for wind energy in Norway and Scotland, forms the driving force behind this study. The following two cases are being considered: (1) a large-scale wind farm (1,000 MW) in Norway from which electricity is transmitted to The Netherlands by using an HVDC transmission line, in combination with hydro energy. Hydro energy already makes a large contribution to the energy supply of Norway. Wind farms can contribute to the electricity production and save hydro energy generated electricity and make the export of electricity profitable; and (2) a large-scale wind farm (1,000 MW) in Scotland from which electricity is transmitted to The Netherlands by using an HVDC transmission line, in combination with biomass energy. Scotland has a large potential for biomass production such as energy crops and forestry. Poplars and willows cultivated on set-aside land can be gasified and fed into modern combined-cycle plants to generate electricity. In Scotland the usable potential of wind energy may be limited in the short and medium term by the capacity of the grid. New connections can overcome this constraint and allow wind energy to be treated as a European Union resource rather than as a national resource. Thus, the concept of this study is to look at the possibilities of making a 1,000 MW link from The Netherlands to Norway or to Scotland, in order to supply electricity at competitive costs generated with renewable energy sources. 16 figs., 24 tabs., 80 refs

  15. Integral testing of the AP600 passive emergency core cooling systems

    International Nuclear Information System (INIS)

    Its support of the development of AP600, Westinghouse is conducting two integral systems tests to examine the performance of the passive safety systems. A full-height, full pressure test is being performed to simulate a small loss-of-coolant, steam generator tube rupture and large steam line break events. A one-quarter scale, low pressure test is being performed to simulate transients with emphasis on the transition to the natural circulation post-accident, long-term cooling mode and to demonstrate the long-term cooling capability. Each of the tests will provide detailed experimental results for verification of the accident analysis computer codes. (Author)

  16. Comparison of the expression of human equilibrative nucleotide transporter 1 (hENT1) and ribonucleotide reductase subunit M1 (RRM1) genes in seven non-Hodgkin lymphoma cell lines.

    Science.gov (United States)

    Zhao, H B; Zhang, X F; Shi, F; Zhang, M Z; Xue, W L

    2016-01-01

    We investigated the variability in the expression of human equilibrative nucleoside transporter 1 (hENT1) and ribonucleotide reductase subunit M1 (RRM1) in non-Hodgkin lymphoma cell lines. hENT1 and RRM1 mRNA expression levels in natural killer (NK) cells and seven non-Hodgkin lymphoma cell lines (YTS, SNK-6, Jeko-1, ly-1, Raji, Karpas, and Jurket) were studied using reverse-transcription quantitative real-time polymerase chain reaction (RT-qPCR) and the results were compared using the Student t-test. mRNA expression of hENT1 was detectable in YTS, SNK-6, Jeko-1, ly-1, Raji, Karpas, Jurket, and NK cells, which revealed variability in gene expression. There were significant differences in the mRNA expression values of hENT1 (P = 0.021) and RRM1 (P = 0.002) compared to those in NK cells. mRNA expression of both hENT1 and RRM1 was closely associated with non-Hodgkin lymphoma cell proliferation. Differential expression analysis of hENT1 and RRM1 in non-Hodgkin lymphoma cell lines may provide novel drug leads for precision medicine. PMID:27173327

  17. Dicty_cDB: FC-AP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 SJMBIB09 SJM Schistosoma japonicum cDNA, mRNA sequence. 80 8e-20 2 BE859184 |BE859184.1 SsS0499 Suaeda salsa ZAP...FC (Link to library) FC-AP17 (Link to dictyBase) - - - Contig-U16254-1 FC-AP17Z (Li...nk to Original site) - - FC-AP17Z 546 - - - - Show FC-AP17 Library FC (Link to library) Clone ID FC-AP17 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP17Q.Seq.d/ Representative seq. ID FC-AP...17Z (Link to Original site) Representative DNA sequence >FC-AP17 (FC-AP17Q) /CSM/FC/FC-AP/FC-AP17Q.Seq.

  18. Dicty_cDB: FC-AP11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone IMAGE:4920557 5', mRNA sequence. 56 1e-04 2 BF345929 |BF345929.1 602017931F1 NCI_CGAP_Brn67 Homo sap...FC (Link to library) FC-AP11 (Link to dictyBase) - - - Contig-U16101-1 FC-AP11F (Li...nk to Original site) FC-AP11F 394 - - - - - - Show FC-AP11 Library FC (Link to library) Clone ID FC-AP11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP11Q.Seq.d/ Representative seq. ID FC-AP...11F (Link to Original site) Representative DNA sequence >FC-AP11 (FC-AP11Q) /CSM/FC/FC-AP/FC-AP11Q.Seq.

  19. Dicty_cDB: FC-AP18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP18 (Link to dictyBase) - - - Contig-U16455-1 FC-AP18Z (Li...nk to Original site) - - FC-AP18Z 367 - - - - Show FC-AP18 Library FC (Link to library) Clone ID FC-AP18 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP18Q.Seq.d/ Representative seq. ID FC-AP...18Z (Link to Original site) Representative DNA sequence >FC-AP18 (FC-AP18Q) /CSM/FC/FC-AP/FC-AP18Q.Seq....XELTPSRPMCVESFNEYPP LGRFAVRDMGQTVAVGVIKSTVKKAPGKAGDKKGAXAPSKKK*innis**iafynnfkkk kkkkk Translated Amino Acid

  20. Dicty_cDB: FC-AP16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP16 (Link to dictyBase) - - - Contig-U16269-1 FC-AP16Z (Li...nk to Original site) - - FC-AP16Z 552 - - - - Show FC-AP16 Library FC (Link to library) Clone ID FC-AP16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP16Q.Seq.d/ Representative seq. ID FC-AP...16Z (Link to Original site) Representative DNA sequence >FC-AP16 (FC-AP16Q) /CSM/FC/FC-AP/FC-AP16Q.Seq....7. 3.28 Translated Amino Acid sequence ---RNRRYKVRKGPLVVVSGKTTVSQALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWT KSAFEQLD

  1. Dicty_cDB: FC-AP15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP15 (Link to dictyBase) - - - Contig-U15444-1 FC-AP15Z (Li...nk to Original site) - - FC-AP15Z 594 - - - - Show FC-AP15 Library FC (Link to library) Clone ID FC-AP15 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP15Q.Seq.d/ Representative seq. ID FC-AP...15Z (Link to Original site) Representative DNA sequence >FC-AP15 (FC-AP15Q) /CSM/FC/FC-AP/FC-AP15Q.Seq....AAAAAAAAAAAAAAAAAA AAAA sequence update 1997. 3.25 Translated Amino Acid sequence ---RLLKIAEARAATPKGQAAPKAEK

  2. Different involvement of promoter methylation in the expression of organic cation/carnitine transporter 2 (OCTN2 in cancer cell lines.

    Directory of Open Access Journals (Sweden)

    Qiang Qu

    Full Text Available Organic cation/carnitine transporter 2 (OCTN2 is responsible for the cellular uptake of the antineoplastic agent, oxaliplatin. Epigenetic modification is a possible mechanism of altered drug-transporter expression in cancers, leading to altered efficacy of chemotherapeutic drugs. However, the mechanisms governing OCTN2 regulation are not completely understood. In this study, the low levels of OCTN2 in HepG2 and LS174T cells were elevated by the demethylating reagent, decitabine (DCA. To further reveal the epigenetic mechanism of down-regulation of OCTN2, we found that Region-1 within the OCTN2 promoter (spanning -354 to +85 was a determinant of OCTN2 expression in a luciferase reporter assay. Moreover, methylation-specific PCR (MSP and bisulfite genomic sequencing showed that the degree of individual methylated CpG sites within this region was inversely correlated with the levels of OCTN2 in different cancer cells. Application of DCA to HepG2 and LS174T cells reversed the hypermethylation status of the OCTN2 promoter and increased OCTN2 expression, enhancing cellular uptake of oxaliplatin. Thus, we identified that promoter methylation is responsible for epigenetic down-regulation of OCTN2 in HepG2 and LS174T cells. Given the essential role of OCTN2 in cancer cell uptake of chemotherapeutics, and thus treatment efficacy, pretreatment with a demethylating reagent is a possible strategy for optimizing pharmacotherapies against cancers.

  3. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  4. Testing of the AP600 automatic depressurization system

    International Nuclear Information System (INIS)

    The Automatic Depressurization System (ADS) of the Westinghouse AP600 reactor will be used to provide controlled depressurization of the reactor coolant system (RCS). This will, in turn allow the initiation and long term operation of gravity driven cooling flow in the RCS. ADS tests were conducted at the VAPORE test facility in Casaccia, Italy through a Technical Cooperation Agreement between Westinghouse, ENEA, SOPREN/ANSALDO, and ENEL to produce data for the development and verification of computer codes to simulate the system. The test program also provided insights about the operation of valves supplied from various vendors that could be used in the AP600 ADS. The data gathered from the tests showed the ability of the ADS design to fulfill its function over the range of conditions expected in the AP600. The tests also demonstrated the abilities of gate and globe valves from several vendors to initiate and terminate an ADS blowdown as could be required in the AP600

  5. A hot-spare injector for the APS linac

    International Nuclear Information System (INIS)

    Last year a second-generation SSRL-type thermionic cathode rf gun was installed in the Advanced Photon Source (APS) linac. This gun (referred to as ''gun2'') has been successfully commissioned and now serves as the main injector for the APS linac, essentially replacing the Koontz-type DC gun. To help ensure injector availability, particularly with the advent of top-up mode operation at the APS, a second thermionic-cathode rf gun will be installed in the APS linac to act as a hot-spare beam source. The hot-spare installation includes several unique design features, including a deep-orbit Panofsky-style alpha magnet. Details of the hot-spare beamline design and projected performance are presented, along with some plans for future performance upgrades

  6. Scaling of the AP600 containment large scale test facility

    International Nuclear Information System (INIS)

    The Large Scale Test (LST) Facility is an integral effects test facility which provides experimental data for validation of heat and mass transfer correlations used in WGOTHIC, the analysis code for the AP600 containment atmosphere. The LST tests consist of a series of pressurization transients in a 1/8th scale containment vessel with simulated internal heat sinks and passive containment cooling system (PCCS). These pressurization transients provide a range of transient as well as steady state data. To establish the applicability of the LST data as an integral effects facility to the AP600 containment; top-down, system-level scaling and bottom-up scaling similar to that described by Zuber (Hierarchical, Two-Tiered Scaling Methodology, 1991) were used to license the AP600 containment. Top-down, system-level scaling applied to the AP600 containment and the LST facility is the focus of this paper. Since pressure is the parameter of primary importance for the AP600 containment, the top-down, system-level scaling effort focuses on physical phenomena or processes such as heat and mass transfer. A detailed order of magnitude analysis by Spencer et al. (1997) has shown break mass-energy release, convection heat transfer, and mass transfer (condensation and evaporation) to be the dominant phenomena associated with the AP600 passive containment. To capture the aggregate influence (on pressure) of these dominant phenomena inside the AP600 containment, a simplified Rate of Pressure Change (RPC) equation is used. Variables in this equation are normalized using reference values associated with containment. The resulting coefficients in the non-dimensional RPC equation represent scaling groups which are numerically evaluated for AP600 and the LST. By comparing the magnitude of the ratios of the scaling groups for AP600 and LST, the applicability of LST data to AP600 is quantitatively assessed to judge whether the test facility is adequately scaled. Scaling ratios within the

  7. Analysis and characterization of double shell tank 241-AP-108

    International Nuclear Information System (INIS)

    This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank

  8. AP1000 design adaptation to European Markets and EUR compliance

    International Nuclear Information System (INIS)

    The AP1000 plant is an 1100-MWe pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. One of the key approaches in the AP1000 design is to use passive features to mitigate design basis accidents. In addition to redundancy, these features incorporate diversity based on PRA insights. The AP1000 design has incorporated a standardization approach, which together with the level of safety achieved by the passive safety features, results in a plant design that can be applied to different geographical regions with varying regulatory standards and utility expectations without major changes. Westinghouse has cooperated for almost 2 decades with European utilities to ensure adaptation of the AP1000 design to European market. The AP1000 50 Hz standard design (also referred to as European Passive Standard) is the resulting adaptation of the AP1000 design to European market needs and requirements, addressing both customer input from the EPP program and regulatory needs identified in the UK GDA process. This standard 50 Hz design retains the overall AP1000 design (safe, simple, standard), the use of proven components and its cost, safety and operability advantages, while it incorporates some changes to adapt to the European environment. In this paper, the key changes incorporated into the AP1000 50 Hz design are discussed, including: -) Adaptation of the electrical systems and Turbine adaptation from 60 Hz to 50 Hz, including approach to IEC vs IEEE compliance; -) Modifications to defense in depth (US class D, European Class 2) and other systems to simplify European licensing and address customer requirements; -) Option for adoption of KSB RUV type Main Reactor Coolant Pumps; -) Limited design adaptations in the areas of instrumentation-control and ventilation and filtration to adapt to European requirements and simplify the licensing process

  9. AP1000 radiation monitoring system design and engineering solution

    International Nuclear Information System (INIS)

    It presents the design concept and solution, including system integration architecture, communication network design and monitoring software of Radiation Monitoring System in Sanmen and Haiyang AP1000 nuclear power plant. The design of AP1000 radiation monitoring system has been simplified comparing to general Pressurized Water Reactor. Radiation monitoring network is composed of the radiation monitoring computer system (CRPS-1000) and four kinds of radiation monitors through standard interface. The data of radiation monitoring system are monitored and managed by CRPS-1000. (authors)

  10. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-05-18

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  11. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov

    2005-06-01

    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  12. ApúnteleaBogotá.com

    OpenAIRE

    2012-01-01

    Se contempla la constitución de una empresa de servicios bajo la razón social apunteleabogota.com, diseñada para facilitar a los visitantes que por motivo de capacitación o negocios deben viajar a la ciudad de Bogotá. apunteleabogota.com tiene como objetivo ofrecer a ejecutivos, directivos de empresas, estudiantes, entre otros una guía de servicios que cubran las necesidades de transporte, alojamiento, infraestructura y estadía, durante la permanencia en la ciudad, por motivos empresariales o...

  13. Ectopic expression of a grape aspartic protease gene, AP13, in Arabidopsis thaliana improves resistance to powdery mildew but increases susceptibility to Botrytis cinerea.

    Science.gov (United States)

    Guo, Rongrong; Tu, Mingxing; Wang, Xianhang; Zhao, Jiao; Wan, Ran; Li, Zhi; Wang, Yuejin; Wang, Xiping

    2016-07-01

    The grape aspartic protease gene, AP13 was previously reported to be responsive, in Chinese wild Vitis quinquangularis cv. 'Shang-24', to infection by Erysiphe necator, the causal agent of powdery mildew disease, as well as to treatment with salicylic acid in V. labrusca×V. vinifera cv. 'Kyoho'. In the current study, we evaluated the expression levels of AP13 in 'Shang-24' in response to salicylic acid (SA), methyl jasmonate (MeJA) and ethylene (ET) treatments, as well as to infection by the necrotrophic fungus, Botrytis cinerea, and the transcript levels of VqAP13 decreased after B. cinerea infection and MeJA treatment, but increased following ET and SA treatments. Transgenic Arabidopsis thaliana lines over-expressing VqAP13 under the control of a constitutive promoter showed enhanced resistance to powdery mildew and to the bacterium Pseudomonas syringae pv. tomato DC3000, and accumulated more callose than wild type plants, while the resistance of transgenic A. thaliana lines to B. cinerea inoculation was reduced. In addition, the expression profiles of various disease resistance- related genes in the transgenic A. thaliana lines following infection by different pathogens were compared to the equivalent profiles in the wild type plants. The results suggest that VqAP13 action promotes the SA dependent signal transduction pathway, but suppresses the JA signal transduction pathway. PMID:27181943

  14. 45-Day safety screening report for grab samples from Tank 241-AP-107

    International Nuclear Information System (INIS)

    Three samples; 107-AP-1C, 107-AP-2c and 107-AP-3C; were received at 222-S Laboratory for analysis of DSC, TGA and visual appearance. Four additional samples; 107-AP-1D, 107-AP-2D, 107-AP-3D and 107-AP-6; were received for visual appearance only. No results exceeded the safety screen notification criteria. This report compiles the analytical results. Tank 241-AP-107 is a double-shell tank which is not on any of the four Watch Lists

  15. The APETALA-2-like transcription factor OsAP2-39 controls key interactions between abscisic acid and gibberellin in rice.

    Directory of Open Access Journals (Sweden)

    Mahmoud W Yaish

    2010-09-01

    Full Text Available The interaction between phytohormones is an important mechanism which controls growth and developmental processes in plants. Deciphering these interactions is a crucial step in helping to develop crops with enhanced yield and resistance to environmental stresses. Controlling the expression level of OsAP2-39 which includes an APETALA 2 (AP2 domain leads to phenotypic changes in rice. Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines. Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key abscisic acid (ABA biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level. In addition to OsNCED-1, the gene expression analysis revealed the upregulation of a gene that codes for the Elongation of Upper most Internode (EUI protein, an enzyme that catalyzes 16α, 17-epoxidation of non-13-hydroxylated GAs, which has been shown to deactivate gibberellins (GAs in rice. The exogenous application of GA restores the wild-type phenotype in the transgenic line and ABA application induces the expression of EUI and suppresses the expression of OsAP2-39 in the wild-type line. These observations clarify the antagonistic relationship between ABA and GA and illustrate a mechanism that leads to homeostasis of these hormones. In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39. Together, these results reveal a novel mechanism for the control of the ABA/GA balance in rice which is regulated by OsAP2-39 that in turn regulates plant growth and seed production.

  16. Parthenolide inhibits ERK and AP-1 which are dysregulated and contribute to excessive IL-8 expression and secretion in cystic fibrosis cells

    Directory of Open Access Journals (Sweden)

    Saadane Aicha

    2011-10-01

    Full Text Available Abstract Background Excessive secretion of IL-8 characterizes cystic fibrosis (CF. This has been attributed to excessive activation of epithelial cell I-κB Kinase and/or NFκB. Maximum IL-8 production requires 3 cooperative mechanisms: 1 release of the promoter from repression; 2 activation of transcription by NFκB and AP-1; 3 stabilization of mRNA by p38-MAPK. Little is known about regulation of IL-8 by MAPKs or AP-1 in CF. Methods We studied our hypothesis in vitro using 3-cellular models. Two of these models are transformed cell lines with defective versus normal cystic fibrosis transmembrane conductance regulator (CFTR expression: an antisense/sense transfected cell line and the patient derived IB3-1/S9. In the third series of studies, we studied primary necropsy human tracheal epithelial cells treated with an inhibitor of CFTR function. All cell lines were pretreated with parthenolide and then stimulated with TNFα and/or IL-1β. Results In response to stimulation with TNFα and/or IL-1β, IL-8 production and mRNA expression was greater in CF-type cells than in non-CF controls. This was associated with enhanced phosphorylation of p38, ERK1/2 and JNK and increased activation of AP-1. Since we previously showed that parthenolide inhibits excessive IL-8 production by CF cells, we evaluated its effects on MAPK and AP-1 activation and showed that parthenolide inhibited ERK and AP-1 activation. Using a luciferase promoter assay, our studies showed that parthenolide decreased activation of the IL-8 promoter in CF cells stimulated with TNFα/IL-1β. Conclusions In addition to NFκB MAPKs ERK, JNK and p38 and the transcription factor AP-1 are also dysregulated in CF epithelial cells. Parthenolide inhibited both NFκB and MAPK/AP-1 pathways contributing to the inhibition of IL-8 production.

  17. Approaching acquisition path analysis formally. A comparison between AP and nonAP states

    International Nuclear Information System (INIS)

    In the past, the IAEA has planned its activities mainly based on the presence of nuclear material. However, resources should be spent where they are needed most. Therefore, a new risk model was developed to change the inspection system to a comprehensive, objective‑driven approach where the State is considered as a whole, the so called State‑level concept (SLC). Acquisition path analysis (APA) is a key element of the State‑level concept. By considering the State’s nuclear profile, the APA generates a list of acquisition paths ranked by their attractiveness for the State. Currently, this process is mainly based on expert judgment. However, the IAEA’s requirements state that APA must be objective, reproducible, transparent, standardized, documented and as a result non‑discriminatory. A formal approach fulfilling the requirements was set up by the authors in the past [1]. This methodology is based on a three step approach. The process starts in the first step with the parametrization of the network. In the second step, the network is analyzed in order find all acquisition paths for a State. Finally, game theory is used in the third step to model the decisions made by the IAEA and the State. In this paper, an advanced methodology will be presented. Improvements were made in the interface definition between the three stages. Also, the general network model was updated and the automatic visualization of acquisition paths was accomplished. Furthermore, a prototype implementation will be shown. The advanced methodology was applied to two test non‑nuclear weapon States under comprehensive safeguards agreements with the IAEA. Both States hold complex fuel cycles with only small technical differences. However,only one State is supposed to have the additional protocol (AP) in force. The example will show how the presence of the AP influences the detection probabilities of illegal behavior. As a consequence, these examples also indicate where to best focus

  18. 76 FR 51367 - China Shipping Container Lines Co., Ltd.; COSCO Container Lines Company Limited; Evergreen Line A...

    Science.gov (United States)

    2011-08-18

    ... China Shipping Container Lines Co., Ltd.; COSCO Container Lines Company Limited; Evergreen Line A Joint Service Agreement; Hanjin Shipping Co., Ltd.; Horizon Lines, LLC; Kawasaki Kisen Kaisha, Ltd.; Nippon Yusen Kaisha; United Arab Shipping Company (S.A.G.); and Yang Ming Marine Transport Corporation v....

  19. Laser-induced transport effect and laser induced-line narrowing mechanism for laser excitation in 87Rb atomic vapors in a finite-size buffer-less cell

    International Nuclear Information System (INIS)

    Full text: Coherent population trapping (CPT) and double radio-optical resonance (DROR) are quantum nonlinear effects. Both these effects are the base for the creation of high precision magnetometers and atomic frequency standards. We study the influence of the laser induced transport (LIT) and the laser induced line narrowing (LILN) effects on the DROR and CPT resonance line shape for excitation in 87Rb atomic vapors in wall-coated and uncoated cell. We take into account both hyperfine and Zeeman structures of the ground and the excited states of 87Rb atoms as well as the probabilities of spontaneous transitions. We investigate the dependence of the resonance shape on the length of the cell, on the type of boundary conditions, on the polarization and intensity of laser and microwave fields, and on the laser line width ('narrow-band' and 'broad-band'). Laser induced transport in DROR: the first the LIT was predicted for three-level model. We show that the LIT takes place in buffer-less cell with real 87Rb atoms. The physical essence of the LIT effect is the caused by the Doppler effect velocity-selectivity of the interaction of 'narrow-band' laser field with atoms, resulting in Bennett dips and peaks in the velocity distribution of atoms in the ground state sublevels. Asymmetry of the two velocity distributions gives rise to the opposite-directed (along the laser propagation direction) fluxes of the atoms in the ground state sublevels. Therefore, a flux of the population inversion (or, equivalently, of the longitudinal magnetization) arises. This behavior one experimentally can obverse as the transmission peak in the centre of the DROR signal. LIT effect is most pronounced for 'narrow-band' laser pumping. Laser induced line narrowing in CPT resonance: the LILN of the CPT resonance realizes only in the case of excitation by 'narrow-band' laser. We established that for the LILN mechanism the parameters (the amplitude and width) of the CPT resonance excited on

  20. FLASH/casp8ap2 Is Indispensable for Early Embryogenesis but Dispensable for Proliferation and Differentiation of ES Cells

    OpenAIRE

    Minamida, Yoshitaka; Someda, Masataka; Yonehara, Shin

    2014-01-01

    FLICE/caspase-8-associated huge protein (FLASH)/casp8ap2 is involved in various cellular functions, such as cell cycle progression, transcriptional regulation, the regulation of apoptosis, and the regulation of histone gene expression. The down-regulated expression of FLASH has been shown to inhibit cell cycle progression in the S phase in many kinds of mice and human cell lines and the inhibition of cell cycle progression may be attributed to the suppressed expression of replication-dependen...

  1. Mapping of the spontaneous deletion in the Ap3d1 gene of mocha mice: fast and reliable genotyping

    Directory of Open Access Journals (Sweden)

    Delenclos Marion

    2008-11-01

    Full Text Available Abstract Background The mocha mouse carries a spontaneous deletion in the Ap3d1 gene, encoding the delta 1 subunit of the adaptor related protein complex 3, (Ap3d1, and subsequently lack the expression of functional AP-3. This leads to a deficiency in vesicle transport and storage, which affects neurotransmitter vesicle turnover and release in the central nervous system. Since the genomic sequence of the Ap3d1 gene of mocha mouse is not known, precise mapping of the deletion as well as reliable genotyping protocols are lacking. Findings We sequenced the Ap3d1 gene (HGNC GeneID: 8943 around the deletion site in the mocha mouse and revealed a 10639 bp deletion covering exon 2 to 6. Subsequently, new PCR primers were designed yielding a reliable genotyping protocol of both newborn and adult tissue. To examine the genotypes further, hippocampal neurons were cultured from mocha and control mice. Patch-clamp recordings showed that mocha neurons had a higher input resistance, and that autaptic EPSC in mocha cultures depressed faster and stronger as compared with control cultures. Conclusion Our study reports the sequence of the deleted part of the Ap3d1 gene in mocha mice, as well as a reliable PCR-based genotyping protocol. We cultured hippocampal neurons from control and mocha mice, and found a difference in input resistance of the neurons, and in the synaptic short-term plasticity of glutamatergic autapses showing a larger synaptic depression than controls. The described procedures may be useful for the future utilization of the mocha mouse as a model of defective vesicle biogenesis. Importantly, as genotyping by eye color is complicated in newborn mice, the designed protocol is so fast and reliable that newborn mice could rapidly be genotyped and hippocampal neurons dissociated and cultured, which is normally best done at P0-P2.

  2. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands.

    Science.gov (United States)

    Abe, Yukiko S; Sasaki, Shigeki

    2016-02-15

    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site. PMID:26777298

  3. Heavy transport problems

    International Nuclear Information System (INIS)

    Assuming that very often a long transport route from the factory of the manufacturer to the provided site has to be reckoned with, in general only transport with a ship is possible. As each site is only called by a certain steamship line, at a very early stage of planning the nuclear power plant the possibilities and capacities of the lines and means of transportation under discussion should be investigated. In planning the unloading equipment at the site, due consideration should be given to the fact that at a later time this equipment should also be suitable for the transport of heavy components and spent fuel assemblies. (orig.)

  4. APS storage ring vacuum system development

    International Nuclear Information System (INIS)

    The Advanced Photon Source synchrotron radiation facility, under construction at the Argonne National Laboratory, incorporates a large ring for the storage of 7 GeV positrons for the generation of photon beams for the facility's materials research program. The Storage Ring's 1104 m circumference is divided into 40 sectors which contain vacuum, beam transport, control, rf and insertion device systems. The vacuum system will operate at a pressure of 1 nTorr and is fabricated from aluminum. The system includes distributed NeG pumping, photon absorbers with lumped pumping, beam position monitors, vacuum diagnostics and valving. An overview of the vacuum system design and details of selected development program results are presented. 5 refs

  5. Use of a wire scanner for monitoring residual gas ionization in Soreq Applied Research Accelerator Facility 20 keV/u proton/deuteron low energy beam transport beam line

    International Nuclear Information System (INIS)

    The ion source end of the Soreq Applied Research Accelerator Facility accelerator consists of a proton/deuteron ECR ion source and a low energy beam transport (LEBT) beam line. An observed reduction of the radio frequency quadrupole transmission with increase of the LEBT current prompted additional study of the LEBT beam properties. Numerous measurements have been made with the LEBT bream profiler wire biased by a variable voltage. Current-voltage characteristics in presence of the proton beam were measured even when the wire was far out of the beam. The current-voltage characteristic in this case strongly resembles an asymmetric diodelike characteristic, which is typical of Langmuir probes monitoring plasma. The measurement of biased wire currents, outside the beam, enables us to estimate the effective charge density in vacuum.

  6. Use of a wire scanner for monitoring residual gas ionization in Soreq Applied Research Accelerator Facility 20 keV∕u proton∕deuteron low energy beam transport beam line.

    Science.gov (United States)

    Vainas, B; Eliyahu, I; Weissman, L; Berkovits, D

    2012-02-01

    The ion source end of the Soreq Applied Research Accelerator Facility accelerator consists of a proton∕deuteron ECR ion source and a low energy beam transport (LEBT) beam line. An observed reduction of the radio frequency quadrupole transmission with increase of the LEBT current prompted additional study of the LEBT beam properties. Numerous measurements have been made with the LEBT bream profiler wire biased by a variable voltage. Current-voltage characteristics in presence of the proton beam were measured even when the wire was far out of the beam. The current-voltage characteristic in this case strongly resembles an asymmetric diodelike characteristic, which is typical of Langmuir probes monitoring plasma. The measurement of biased wire currents, outside the beam, enables us to estimate the effective charge density in vacuum. PMID:22380317

  7. C. Petrone et al.: "Magnetic measurement of the model magnet QD0 designed for the CLIC final focus beam transport line." CERN TE-MSC Internal Note, EDMS Nr: 1184196

    CERN Document Server

    Arpaia, Pasquale; Petrone, Carlo; Russenschuck, Stephan; Walckiers, Louis

    2012-01-01

    This note presents the results of the magnetic measurements performed on QD0, model magnet for the final focus transport line for CLIC (Fig. 1). This high-gradient, hybrid quadrupole has a yoke length of 0.1 m and an aperture of 8.3 mm. ND2Fe14B Permanent magnet blocks provide a gradient of 150 T/m, which can be further increased to 530 T/m when the four coils are excited to 18.3 A. The request was to measure the strength of the field and the multipole coefficients at different currents. The measurement of the field strength, by means of the single stretched wire system, was done in December 2011 in the I8 laboratory. The measurement of the multipole was done by means of the oscillating wire system [1][2].

  8. Synthesis of an inositol hexakisphosphate (IP6) affinity probe to study the interactome from a colon cancer cell line.

    Science.gov (United States)

    Yin, Meng-Xin; Catimel, Bruno; Gregory, Mark; Condron, Melanie; Kapp, Eugene; Holmes, Andrew B; Burgess, Antony W

    2016-03-14

    Inositol hexakisphosphate (InsP6 or IP6) is an important signalling molecule in vesicular trafficking, neurotransmission, immune responses, regulation of protein kinases and phosphatases, activation of ion channels, antioxidant functions and anticancer activities. An IP6 probe was synthesised from myo-inositol via a derivatised analogue, which was immobilised through a terminal amino group onto Dynabeads. Systematic analysis of the IP6 interactome has been performed using the IP6 affinity probe using cytosolic extracts from the LIM1215 colonic carcinoma cell line. LC/MS/MS analysis identified 77 proteins or protein complexes that bind to IP6 specifically, including AP-2 complex proteins and β-arrestins as well as a number of novel potential IP6 interacting proteins. Bioinformatic enrichment analysis of the IP6 interactome reinforced the concept that IP6 regulates a number of biological processes including cell cycle and division, signal transduction, intracellular protein transport, vesicle-mediated transport and RNA splicing. PMID:26840369

  9. Authenticated, private, and secured smart cards (APS-SC)

    Science.gov (United States)

    Szu, Harold; Mehmood, Amir

    2006-04-01

    From historical perspective, the recent advancements in better antenna designs, low power circuitry integrations and inexpensive fabrication materials have made possible a miniature counter-measure against Radar, a clutter behaving like a fake target return called Digital Reflection Frequency Modulation (DRFM). Such a military counter-measure have found its way in the commerce as a near field communication known as Radio Frequency Identification (RFID), a passive or active item tag T attached to every readable-writable Smart Card (SC): Passports ID, medical patient ID, biometric ID, driver licenses, book ID, library ID, etc. These avalanche phenomena may be due to the 3 rd Gen phones seeking much more versatile & inexpensive interfaces, than the line-of-sight bar-code optical scan. Despite of the popularity of RFID, the lacking of Authenticity, Privacy and Security (APS) protection restricted somewhat the wide spread commercial, financial, medical, legal, and militarily applications. Conventional APS approach can obfuscate a private passkey K of SC with the tag number T or the reader number R, or both, i.e. only T*K or R*K or both will appear on them, where * denotes an invertible operation, e.g. EXOR, but not limited to it. Then, only the authentic owner, knowing all, can inverse the operation, e.g. EXOR*EXOR= I to find K. However, such an encryption could be easily compromised by a hacker seeking exhaustively by comparison based on those frequently used words. Nevertheless, knowing biological wetware lesson for power of pairs sensors and Radar hardware counter-measure history, we can counter the counter-measure DRFM, instead using one RFID tag per SD, we follow the Nature adopting two ears/tags, e.g. each one holding portions of the ID or simply two different ID's readable only by different modes of the interrogating reader, followed by brain central processor in terms of nonlinear invertible shufflers mixing two ID bits. We prefer to adopt such a hardware

  10. Validation of the new trapped environment AE9/AP9/SPM at low Earth orbit

    Science.gov (United States)

    Badavi, Francis F.

    2014-09-01

    The completion of the international space station (ISS) in 2011 has provided the space research community an ideal proving ground for future long duration human activities in space. Ionizing radiation measurements in ISS form the ideal tool for the validation of radiation environmental models, nuclear transport codes and nuclear reaction cross sections. Indeed, prior measurements on the space transportation system (STS; shuttle) provided vital information impacting both the environmental models and the nuclear transport code developments by indicating the need for an improved dynamic model of the low Earth orbit (LEO) trapped environment. Additional studies using thermo-luminescent detector (TLD), tissue equivalent proportional counter (TEPC) area monitors, and computer aided design (CAD) model of earlier ISS configurations, confirmed STS observations that, as input, computational dosimetry requires an environmental model with dynamic and directional (anisotropic) behavior, as well as an accurate six degree of freedom (DOF) definition of the vehicle attitude and orientation along the orbit of ISS. At LEO, a vehicle encounters exposure from trapped particles and attenuated galactic cosmic rays (GCR). Within the trapped field, a challenge arises from properly estimating the amount of exposure acquired. There exist a number of models to define the intensities of the trapped particles during the solar quiet and active times. At active times, solar energetic particles (SEP) generated by solar flare or coronal mass ejection (CME) also contribute to the exposure at high northern and southern latitudes. Among the more established trapped models are the historic and popular AE8/AP8, dating back to the 1980s, the historic and less popular CRRES electron/proton, dating back to 1990s and the recently released AE9/AP9/SPM. The AE9/AP9/SPM model is a major improvement over the older AE8/AP8 and CRRES models. This model is derived from numerous measurements acquired over four

  11. AP@home: The Artificial Pancreas Is Now at Home.

    Science.gov (United States)

    Heinemann, Lutz; Benesch, Carsten; DeVries, J Hans

    2016-07-01

    In the past years the development of an artificial pancreas (AP) has made great progress and many activities are ongoing in this area of research. The major step forward made in the last years was moving the evaluation of AP systems from highly controlled experimental conditions to daily life conditions at the home of patients with diabetes; this was also the aim of the European Union-funded AP@home project. Over a time period of 5 years a series of clinical studies were performed that culminated in 2 "final studies" during which an AP system was used by patients in their home environment for 2 or 3 months without supervision by a physician, living their normal lives. Two different versions of the AP system developed within this project were evaluated. A significant improvement in glycated hemoglobin was observed during closed-loop conditions despite the fact that during the control period the patients used the best currently available therapeutic option. In addition, a "single-port AP system" was developed within the project that combines continuous glucose monitoring and insulin infusion at a single tissue site. By using such a combined device the patients not only have to carry one less device around, the number of access points through the skin is also reduced from 2 to 1. In summary, close cooperation of 12 European partners, both academic centers and industry, enabled the development and evaluation of AP systems under daily life conditions. The next step is to develop these into products in cooperation with commercial partners. PMID:26888971

  12. AP1000 - the new standard for nuclear power

    International Nuclear Information System (INIS)

    Full text of publication follows: The AP1000 is the only Generation III+ reactor to receive Final Design Approval (FDA) from the Nuclear Regulatory Commission, and is expected to receive its Design Certification by the end of the year. Building on the proven features of current generation nuclear plants, the AP1000 combines experience with innovation into a design that surpasses current standards of safety and reliability. Use of passive safety features results in a simpler and more compact design that enhances safety, simplifies O and M requirements, and reduces capital and operating costs. At 1117 Mwe, the AP1000 is well suited for almost any grid system and will be fully competitive with combined-cycle gas and comparable fossil fuel plants. The AP1000 is ready to help launch a renaissance in new nuclear plant construction throughout the world. Maturity of Design: In excess of 1300 man-years and $400 million in development funding have been expended on the AP1000. It has undergone extensive, part scale testing at the system, sub-system and component level, in addition to a series of part scale integrated tests. The AP1000 is the most analyzed of the next generation reactors. Simplicity of Design/Economics: The AP1000 uses simplified and innovative passive safety systems to an unprecedented extent. Simplified passive safety systems provide reliable operation, reduced capital costs, and enhanced plant safety with large plant operating margins. The AP1000 features improved reliability through simplicity rather than addition of redundant safety trains. This simpler design is easier and less costly to operate and maintain than larger, more complex plants, while less equipment and smaller buildings translate into lower capital costs and shorter construction durations. After construction, economic benefit will be found in reduced operating and maintenance costs, largely due to reduced operating and maintenance staffing requirements. Construction aspects

  13. PKCε inhibits isolation and stemness of side population cells via the suppression of ABCB1 transporter and PI3K/Akt, MAPK/ERK signaling in renal cell carcinoma cell line 769P.

    Science.gov (United States)

    Huang, Bin; Fu, Shun Jun; Fan, Wen Zhe; Wang, Zhong Hua; Chen, Ze Bin; Guo, Sheng Jie; Chen, Jun Xing; Qiu, Shao Peng

    2016-06-28

    Protein kinase C epsilon (PKCε), a member of the novel PKC family, is known to be a transforming oncogene and tumor biomarker for many human solid cancers including renal cell carcinoma (RCC). We isolated side population (SP) cells from the RCC 769P cell line, and proved that those cells possess cancer stem cell (CSC) characteristics. In this study, to identify the function of PKCε in cancer stemness of 769P SP cells, we reduced the expression of PKCε in those cells, following the results demonstrated that PKCε depletion had a negative correlation with the existence of SP cells in 769P cell line. Down-regulation of PKCε also suppresses the CSC potential of sorted 769P SP cells in several ways: proliferation potential, resistance to chemotherapeutics and in vivo tumor formation ability. Our study also reveals that PKCε is associated with ABCB1 and this association probably contributed to the SP cells isolation from 769P cell line. Furthermore, the expression of ABCB1 is directly regulated by PKCε. Additionally, after the depletion of PKCε, the phosphorylation of pAkt, pStat3 and pERK was apparently suppressed in 769P SP cells, whereas PKCε overexpression could promote the phosphorylation of AKT, STAT3 and ERK in 769P Non-SP cells. Overall, PKCε down-regulation suppresses sorting and the cancer stem-like phenotype of RCC 769P SP cells through the regulation of ABCB1 transporter and the PI3K/Akt, Stat3 and MAPK/ERK pathways that are dependent on the phosphorylation effects. Thus, PKCε may work as an important mediator in cancer stem cell pathogenesis of renal cell cancer. PMID:27037060

  14. Stokes IQUV mapping of α2 CVn & other Ap stars using ESPaDOnS and NARVAL

    Science.gov (United States)

    Silvester, J.; Kochukhov, O.; Wade, G. A.

    2013-12-01

    New spectral line polarisation observations of 7 bright Ap stars have been obtained with the ESPaDOnS and Narval high resolution spectropolarimeters (Silvester et al. 2012). The aim of this data set is produce a series of surface magnetic field and surface chemistry maps for these Ap stars. We present new magnetic maps for the Ap star α2 CVn using these new data and the MDI inversion code INVERS10. α2 CVn is the first Ap star to be observed during two separate epochs using high resolution phase resolved spectropolarimetric IQUV observations and as such allows us an insight into how stable the surface magnetic structure is over a decade timescale. We show that the new maps give a magnetic field structure consistent with the previous maps obtained by Kochukhov and Wade (2010) from lower quality MuSiCoS spectra taken a decade ago and that the field topology cannot be described by a dipolar or quadrupolar field.

  15. Stokes IQUV mapping of $\\alpha^2$ CVn & other Ap stars using ESPaDOnS and NARVAL

    CERN Document Server

    Silvester, J; Wade, G A

    2013-01-01

    New spectral line polarisation observations of 7 bright Ap stars have been obtained with the ESPaDOnS and Narval high resolution spectropolarimeters (Silvester et al. 2012). The aim of this data set is produce a series of surface magnetic field and surface chemistry maps for these Ap stars. We present new magnetic maps for the Ap star $\\alpha^2$ CVn using these new data and the MDI inversion code INVERS10. $\\alpha^2$ CVn is the first Ap star to be observed during two separate epochs using high resolution phase resolved spectropolarimetric $IQUV$ observations and as such allows us an insight into how stable the surface magnetic structure is over a decade timescale. We show that the new maps give a magnetic field structure consistent with the previous maps obtained by Kochukhov and Wade (2010) from lower quality MuSiCoS spectra taken a decade ago and that the field topology cannot be described by a dipolar or quadrupolar field.

  16. Mobile docking of REMUS-100 equipped with USBL-APS to an unmanned surface vehicle: A performance feasibility study

    Science.gov (United States)

    Miranda, Mario, II

    The overall objective of this work is to evaluate the ability of homing and docking an unmanned underwater vehicle (Hydroid REMUS 100 UUV) to a moving unmanned surface vehicle (Wave-Adaptive Modular Surface Vehicle USV) using a Hydroid Digital Ultra-Short Baseline (DUSBL) acoustic positioning system (APS), as a primary navigation source. An understanding of how the UUV can rendezvous with a stationary USV first is presented, then followed by a moving USV. Inherently, the DUSBL-APS is susceptible to error due to the physical phenomena of the underwater acoustic channel (e.g. ambient noise, attenuation and ray refraction). The development of an APS model has allowed the authors to forecast the UUV's position and the estimated track line of the USV as determined by the DUSBL acoustic sensor. In this model, focus is placed on three main elements: 1) the acoustic channel and sound ray refraction when propagating in an inhomogeneous medium; 2) the detection component of an ideal DUSBL-APS using the Neyman-Pearson criterion; 3) the signal-to-noise ratio (SNR) and receiver directivity impact on position estimation. The simulation tool is compared against actual open water homing results in terms of the estimated source position between the simulated and the actual USBL range and bearing information.

  17. 49 CFR 192.371 - Service lines: Steel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Steel. 192.371 Section 192.371 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... § 192.371 Service lines: Steel. Each steel service line to be operated at less than 100 p.s.i. (689...

  18. 49 CFR 192.377 - Service lines: Copper.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Copper. 192.377 Section 192.377 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... § 192.377 Service lines: Copper. Each copper service line installed within a building must be...

  19. Past, Present, and Future of AP Chemistry: A Brief History of Course and Exam Alignment Efforts

    Science.gov (United States)

    Magrogan, Serena

    2014-01-01

    As part of the Advanced Placement (AP) Program's commitment to continually enhance alignment with current best practices in college-level learning, the AP Program is currently evaluating and redesigning courses and exams, one of which launched during the 2013-2014 academic school year: AP chemistry. The history of the AP chemistry course and…

  20. AP Report to the Nation: A Closer Look at the Nation and Florida

    Science.gov (United States)

    Sawtell, Ellen A.; Gillie, Jacqueline M.; Smith, Patricia Z.

    2012-01-01

    In February 2012, the College Board published The 8th Annual AP Report to the Nation. This session provides a deeper dive into key information for the United States with an emphasis on Florida, and participants hear how one school in Florida utilizes AP Potential™ to help build their AP Program. Participants also learn about AP participation and…

  1. Vibration analysis of primary air pump JE01 AP003

    International Nuclear Information System (INIS)

    JE01 AP003 primary coolant pump is one of the main components in the safe operation of the reactor so that needs to be done early detection of damage types and levels of its constituent components. The main components of the pump that is often damaged bearing. The purpose of this paper is to know the symptoms of bearing damage and the level of damage based on vibration analysis. One indication of the bearing has been damaged, that is the vibration or temperature rise in the bearing. One way to detect early symptoms of damage to the pump is to use the vibration response peak Based on the analysis of the measurement results cited the obtained results that the primary coolant pump JE01 AP003 has been damage to a free end looseness bearing with moderate levels of damage. Need JE01 AP003 bearing replacement even though the damage is not severe. (author)

  2. Experience with the EPICS PV Gateway at the APS

    CERN Document Server

    Evans, Kenneth

    2005-01-01

    The EPICS PV Gateway has become a stable, high-performance application that provides access to process variables while minimizing the impact on critical IOCs and implementing additional access security. The additional access security typically prevents write access but is highly configurable. The Advanced Photon Source (APS) currently uses 40 Gateways running on 11 machines to provide access to the machine network from the offices and for the individual experimental teams. These include reverse Gateways that allow administration of all 40 APS Gateways from a single MEDM screen, even though the Gateways are running on separate networks. This administration includes starting, stopping, making and viewing reports, and viewing and editing access security files. There is one Gateway that provides process variable renaming. This paper provides an overview of the Gateways at the APS and describes the procedures that have been set up to use and administer them.

  3. PKA-activated ApAF–ApC/EBP heterodimer is a key downstream effector of ApCREB and is necessary and sufficient for the consolidation of long-term facilitation

    OpenAIRE

    LEE, Jin-A; Lee, Sue-Hyun; Lee, Changhoon; Chang, Deok-Jin; Lee, Yong; Kim, Hyoung; Cheang, Ye-Hwang; Ko, Hyoung-Gon; Lee, Yong-Seok; Jun, Heejung; Bartsch, Dusan; Kandel, Eric R.; Kaang, Bong-Kiun

    2006-01-01

    Long-term memory requires transcriptional regulation by a combination of positive and negative transcription factors. Aplysia activating factor (ApAF) is known to be a positive transcription factor that forms heterodimers with ApC/EBP and ApCREB2. How these heterodimers are regulated and how they participate in the consolidation of long-term facilitation (LTF) has not, however, been characterized. We found that the functional activation of ApAF required phosphorylation of ApAF by PKA on Ser-2...

  4. Transcriptional Regulation of the AP-2α Promoter by BTEB-1 and AP-2rep, a Novel wt-1/egr-Related Zinc Finger Repressor

    OpenAIRE

    Imhof, Axel; Schuierer, Marion; Werner, Oliver; Moser, Markus; Roth, Christina; Bauer, Reinhard; BUETTNER, REINHARD

    1999-01-01

    AP-2 transcription factors have been suggested to exert key regulatory functions in vertebrate embryonic development, in tumorigenicity of various cancer cell types, and in controlling cell cycle and apoptotic effector genes. In this study, we investigated transcriptional regulation of the AP-2α gene promoter mediated by an autoregulatory element (referred to as A32) with a core consensus AP-2 binding site at position −336 relative to the mRNA initiation site. AP-2 and multiple different nucl...

  5. Reasons for decision in the matter of Coral Energy Canada Inc. : application for approval of modifications to the Firm Transportation Risk Alleviation Mechanism (FT-RAM) pilot for the TransCanada PipeLines Limited Mainline

    International Nuclear Information System (INIS)

    Coral Energy Canada Inc. (Coral) is one of the largest wholesale energy marketers and traders in North America whose customers include utilities, gas distribution companies, municipalities, rural electrical cooperatives, independent power producers, industrial customers and commercial customers. As such, it is one of the largest shippers on the TransCanada Mainline Natural Gas Transmission System operated by TransCanada PipeLines Limited. As part of its 2001 and 2002 tolls and tariff applications, TransCanada proposed a new service enhancement called the Firm Transportation (FT) Make-up credits, which has proven to be flawed. A modified service enhancement known as the Firm Transportation Risk Alleviation Mechanism (FT-RAM) was subsequently proposed so that credits could be applied against a shipper's monthly interruptible transportation (IT) service account, based on any unused demand charges from the shippers FT contracts. In order to promote long haul service, the credits are only given for long-haul contracts, primarily for points originating in Alberta and Saskatchewan. On September 30, 2005, Coral applied to the Alberta Energy and Utilities Board for approval of modifications to the (FT-RAM) pilot to be effective on November 1, 2005. Coral proposed that the existing pilot be expanded to include short-haul FT contracts in limited circumstances where the same shipper holds a long-haul contract that delivers to the same location as the receipt point of the short-haul FT contract. The Board sought views from interested party of the appropriate process and associated timelines that should be used to deal with the application. Certain parties suggested that it would be inappropriate for the Board to approve any modifications to the existing FT-RAM pilot until the terms and conditions underlying certain Toll Task Force Resolutions were fulfilled. This document presented the positions of the interested parties, Coral's response to the positions of parties, views of

  6. Preliminary study on operational transient analysis for AP1000

    International Nuclear Information System (INIS)

    Typical operational transients have been analyzed with RELAP5 code for AP1000 NPP, in which the reactor power control system was simulated, including Reactor Control System (RECS), Rapid Power Reduction (RPR), Steam Dump Control System (SDCS), Feedwater Control System (FWCS), Pressurizer Pressure Control System (PPCS) and Pressurizer Level Control System (PLCS). It indicates that the plant control system is effective to bring the plant into a safe steady state without actuation of reactor protection system under the representative operational transient, only depends upon the plant control system adjustment. Analysis results show that the design requirement will be met for AP1000 operational transient. (authors)

  7. Analysis of the planning and scheduling functionality in APS systems

    Science.gov (United States)

    Steger-Jensen, Kenn; Hvolby, Hans-Henrik

    2001-10-01

    The paper discusses the basic functionality of planning and scheduling in Advanced Planning and Scheduling systems (APS). Three basic planning options - unconstrained planning, constrained planning and optimization are analyzed by use of theory and examples based on test of an APS system. Even though the planning functionality are radically improved compared to MRP and MRP II, the balance between the objectives are found to be too rigid. This conclusion is based on a number of examples, comparing the outcome of different objectives such as constraints based planning versus optimized planning.

  8. SN 2002ap, the hypernova of class Ic

    OpenAIRE

    Pandey, S. B.; Sahu, D. K.; Anupama, G. C.; Bhattacharya, D; Sagar, Ram

    2003-01-01

    The supernova SN 2002ap was discovered in the outer regions of the nearby spiral M74 on January 29.4 UT. Early photometric and spectroscopic observations indicate the supernova belongs to the class of Ic hypernova. Late time (After JD 2452500) light curve decay slopes are similar to that of the hypernovae SN 1997ef and SN 1998bw. We present here the $BVRI$ photometric light curves and colour evolutions of SN 2002ap to investigate the late time nature of the light curve.

  9. Status of the Advanced Photon Source (APS) linear accelerator

    International Nuclear Information System (INIS)

    A 2856-MHz S-band, electron-positron linear accelerator (linac) has been constructed at the Advanced Photon Source (APS). It is the source of particles and the injector for the other APS accelerators, and linac commissioning is well underway. The linac is operated 24 hours per day to support linac beam studies and rf conditioning, as well as positron accumulator ring and synchrotron commissioning studies. The design goal for accelerated positron current is 8-mA, and has been met. Maximum positron energy to date is 420-MeV, approaching the design goal of 450-MeV. The linac design and its performance are discussed

  10. Miniature Autonomous Star Tracker Based on CMOS APS

    OpenAIRE

    Ying, Dong; Zheng, You; Fei, Xing; Qin, Chou

    2006-01-01

    An APS (Active Pixel Sensor) based autonomous star tracker (AAST) has been proposed for small satellite and microsatellite attitude determination. A prototype of AAST has been developed. It has low mass of 1kg, low power of 3W, high rate up to 5Hz, and acquisition success rate of higher than 99.9%. The improvements in dimensions and performances are realized with the replacement of the CCD (Charge Coupled Device) by the APS. The optical design of the prototype is based on PSF (Point Spread Fu...

  11. Increased expression of AP2 and Sp1 transcription factors in human thyroid tumors: a role in NIS expression regulation?

    International Nuclear Information System (INIS)

    Sodium/iodide symporter (NIS) is a key protein in iodide transport by thyroid cells and this activity is a prerequisite for effective radioiodide treatment of thyroid cancer. In the majority of thyroid cancers, however, iodide uptake is reduced, probably as a result of decreased NIS protein expression. To identify the mechanisms that negatively affect NIS expression in thyroid tumors, we performed electrophoresis mobility shift assays and immunoblot analysis of nuclear protein extracts from normal and tumoral thyroid tissues from 14 unrelated patients. Two proteins closely related to the transcription factors AP2 and Sp1 were identified in the nuclear extracts. Expression of both AP2 and Sp1 in nuclear extracts from thyroid tumors was significantly higher than that observed in corresponding normal tissues. These observations raise the possibility that NIS expression, and subsequently iodide transport, are reduced in thyroid tumors at least in part owing to alterations in the binding activity of AP2 and Sp1 transcription factors to NIS promoter

  12. Increased expression of AP2 and Sp1 transcription factors in human thyroid tumors: a role in NIS expression regulation?

    Directory of Open Access Journals (Sweden)

    Schlumberger Martin

    2002-12-01

    Full Text Available Abstract Background Sodium/iodide symporter (NIS is a key protein in iodide transport by thyroid cells and this activity is a prerequisite for effective radioiodide treatment of thyroid cancer. In the majority of thyroid cancers, however, iodide uptake is reduced, probably as a result of decreased NIS protein expression. Methods To identify the mechanisms that negatively affect NIS expression in thyroid tumors, we performed electrophoresis mobility shift assays and immunoblot analysis of nuclear protein extracts from normal and tumoral thyroid tissues from 14 unrelated patients. Results Two proteins closely related to the transcription factors AP2 and Sp1 were identified in the nuclear extracts. Expression of both AP2 and Sp1 in nuclear extracts from thyroid tumors was significantly higher than that observed in corresponding normal tissues. Conclusion These observations raise the possibility that NIS expression, and subsequently iodide transport, are reduced in thyroid tumors at least in part owing to alterations in the binding activity of AP2 and Sp1 transcription factors to NIS promoter.

  13. Activation of CPP32-like Proteases Is Not Sufficient to Trigger Apoptosis: Inhibition of Apoptosis by Agents that Suppress Activation of AP24, but Not CPP32-like Activity

    OpenAIRE

    Wright, Susan C.; Schellenberger, Ute; Wang, Hong; Kinder, David H.; Talhouk, Jamil W.; Larrick, James W

    1997-01-01

    The 24-kD apoptotic protease (AP24) is a serine protease that is activated during apoptosis and has the capacity to activate internucleosomal DNA fragmentation in isolated nuclei. This study examined the following: (a) the functional relationship between AP24 and the CPP32-like proteases of the caspase family; and (b) whether activation of CPP32-like proteases is sufficient to commit irreversibly a cell to apoptotic death. In three different leukemia cell lines, we showed that agents that dir...

  14. RELATIVISTIC SUPERNOVAE HAVE SHORTER-LIVED CENTRAL ENGINES OR MORE EXTENDED PROGENITORS: THE CASE OF SN 2012ap

    International Nuclear Information System (INIS)

    Deep, late-time X-ray observations of the relativistic, engine-driven, type Ic SN 2012ap allow us to probe the nearby environment of the explosion and reveal the unique properties of relativistic supernova explosions (SNe). We find that on a local scale of ∼0.01 pc the environment was shaped directly by the evolution of the progenitor star with a pre-explosion mass-loss rate of M-dot <5×10−6 M⊙ yr−1, in line with gamma-ray bursts (GRBs) and the other relativistic SN 2009bb. Like sub-energetic GRBs, SN 2012ap is characterized by a bright radio emission and evidence for mildly relativistic ejecta. However, its late-time (δt ≈ 20 days) X-ray emission is ∼100 times fainter than the faintest sub-energetic GRB at the same epoch, with no evidence for late-time central engine activity. These results support theoretical proposals that link relativistic SNe like 2009bb and 2012ap with the weakest observed engine-driven explosions, where the jet barely fails to break out. Furthermore, our observations demonstrate that the difference between relativistic SNe and sub-energetic GRBs is intrinsic and not due to line-of-sight effects. This phenomenology can either be due to an intrinsically shorter-lived engine or to a more extended progenitor in relativistic SNe

  15. Incorporating the APS Catalog of the POSS I and Image Archive in ADS

    Science.gov (United States)

    Humphreys, Roberta M.

    1998-01-01

    The primary purpose of this contract was to develop the software to both create and access an on-line database of images from digital scans of the Palomar Sky Survey. This required modifying our DBMS (called Star Base) to create an image database from the actual raw pixel data from the scans. The digitized images are processed into a set of coordinate-reference index and pixel files that are stored in run-length files, thus achieving an efficient lossless compression. For efficiency and ease of referencing, each digitized POSS I plate is then divided into 900 subplates. Our custom DBMS maps each query into the corresponding POSS plate(s) and subplate(s). All images from the appropriate subplates are retrieved from disk with byte-offsets taken from the index files. These are assembled on-the-fly into a GIF image file for browser display, and a FITS format image file for retrieval. The FITS images have a pixel size of 0.33 arcseconds. The FITS header contains astrometric and photometric information. This method keeps the disk requirements manageable while allowing for future improvements. When complete, the APS Image Database will contain over 130 Gb of data. A set of web pages query forms are available on-line, as well as an on-line tutorial and documentation. The database is distributed to the Internet by a high-speed SGI server and a high-bandwidth disk system. URL is http://aps.umn.edu/IDB/. The image database software is written in perl and C and has been compiled on SGI computers with MIX5.3. A copy of the written documentation is included and the software is on the accompanying exabyte tape.

  16. Cinnamon extract induces tumor cell death through inhibition of NFκB and AP1

    Directory of Open Access Journals (Sweden)

    Lee Sung

    2010-07-01

    Full Text Available Abstract Background Cinnamomum cassia bark is the outer skin of an evergreen tall tree belonging to the family Lauraceae containing several active components such as essential oils (cinnamic aldehyde and cinnamyl aldehyde, tannin, mucus and carbohydrate. They have various biological functions including anti-oxidant, anti-microbial, anti-inflammation, anti-diabetic and anti-tumor activity. Previously, we have reported that anti-cancer effect of cinnamon extracts is associated with modulation of angiogenesis and effector function of CD8+ T cells. In this study, we further identified that anti-tumor effect of cinnamon extracts is also link with enhanced pro-apoptotic activity by inhibiting the activities NFκB and AP1 in mouse melanoma model. Methods Water soluble cinnamon extract was obtained and quality of cinnamon extract was evaluated by HPLC (High Performance Liquid Chromatography analysis. In this study, we tested anti-tumor activity and elucidated action mechanism of cinnamon extract using various types of tumor cell lines including lymphoma, melanoma, cervix cancer and colorectal cancer in vitro and in vivo mouse melanoma model. Results Cinnamon extract strongly inhibited tumor cell proliferation in vitro and induced active cell death of tumor cells by up-regulating pro-apoptotic molecules while inhibiting NFκB and AP1 activity and their target genes such as Bcl-2, BcL-xL and survivin. Oral administration of cinnamon extract in melanoma transplantation model significantly inhibited tumor growth with the same mechanism of action observed in vitro. Conclusion Our study suggests that anti-tumor effect of cinnamon extracts is directly linked with enhanced pro-apoptotic activity and inhibition of NFκB and AP1 activities and their target genes in vitro and in vivo mouse melanoma model. Hence, further elucidation of active components of cinnamon extract could lead to development of potent anti-tumor agent or complementary and alternative

  17. Cinnamon extract induces tumor cell death through inhibition of NFκB and AP1

    International Nuclear Information System (INIS)

    Cinnamomum cassia bark is the outer skin of an evergreen tall tree belonging to the family Lauraceae containing several active components such as essential oils (cinnamic aldehyde and cinnamyl aldehyde), tannin, mucus and carbohydrate. They have various biological functions including anti-oxidant, anti-microbial, anti-inflammation, anti-diabetic and anti-tumor activity. Previously, we have reported that anti-cancer effect of cinnamon extracts is associated with modulation of angiogenesis and effector function of CD8+ T cells. In this study, we further identified that anti-tumor effect of cinnamon extracts is also link with enhanced pro-apoptotic activity by inhibiting the activities NFκB and AP1 in mouse melanoma model. Water soluble cinnamon extract was obtained and quality of cinnamon extract was evaluated by HPLC (High Performance Liquid Chromatography) analysis. In this study, we tested anti-tumor activity and elucidated action mechanism of cinnamon extract using various types of tumor cell lines including lymphoma, melanoma, cervix cancer and colorectal cancer in vitro and in vivo mouse melanoma model. Cinnamon extract strongly inhibited tumor cell proliferation in vitro and induced active cell death of tumor cells by up-regulating pro-apoptotic molecules while inhibiting NFκB and AP1 activity and their target genes such as Bcl-2, BcL-xL and survivin. Oral administration of cinnamon extract in melanoma transplantation model significantly inhibited tumor growth with the same mechanism of action observed in vitro. Our study suggests that anti-tumor effect of cinnamon extracts is directly linked with enhanced pro-apoptotic activity and inhibition of NFκB and AP1 activities and their target genes in vitro and in vivo mouse melanoma model. Hence, further elucidation of active components of cinnamon extract could lead to development of potent anti-tumor agent or complementary and alternative medicine for the treatment of diverse cancers

  18. Tank 241-AP-106 tank characterization plan: Revision 1

    International Nuclear Information System (INIS)

    Tank 241-AP-106 (AP-106) is a candidate feed tank which is expected to be processed at the 242-A Evaporator. Three issues related to the overall concern of the evaporator must be evaluated: compatibility of the candidate waste with respect to feed tank, slurry tank, and evaporator requirements; safety parameters of the candidate waste tank to avoid a facility condition which is outside the safety boundaries; and compliance of the waste as dictated by regulations from various government and environmental agencies. The characterization efforts of this Tank Characterization Plan are focused on the resolution of the issues above. To evaluate the potential for waste incompatibility with the feed tank, slurry tank, and evaporator, as well as relevant safety issues, analyses will be performed on the grab samples obtained from tank AP-106. These analyses are discussed in Section 4.0. Once the characterization of tank AP-106 has been performed, the waste compatibility and safety assessment shall be conducted. This effort is discussed elsewhere

  19. Time Trials--An AP Physics Challenge Lab

    Science.gov (United States)

    Jones, David

    2009-01-01

    I have come to the conclusion that for high school physics classroom and laboratory experiences, simpler is better! In this paper I describe a very simple and effective lab experience that my AP students have thoroughly enjoyed year after year. I call this lab exercise "Time Trials." The experiment is simple in design and it is a lot of fun for…

  20. The AP Lever for Boosting Access, Success, and Equity

    Science.gov (United States)

    Roegman, Rachel; Hatch, Thomas

    2016-01-01

    Four New Jersey school districts worked together to increase student achievement by applying a number of strategies focused on getting traditionally underrepresented students to take more AP courses. The districts are members of the New Jersey Network of Superintendents (NJNS), comprising 15 superintendents who work together to develop systemwide…

  1. The New AP Chemistry Exam: Its Rationale, Content, and Scoring

    Science.gov (United States)

    Price, Paul D.; Kugel, Roger W.

    2014-01-01

    The 2013-2014 academic year marks the rollout of the redesigned advanced placement (AP) chemistry course and exam. There have been many questions as to why the course was redesigned and how the new examination will differ from its legacy version. In this article we give a brief overview of the legacy course and examine why a redesign occurred in…

  2. Early Telegraphic News Dispatches: The Forerunner of the AP.

    Science.gov (United States)

    Schwarzlose, Richard A.

    The origin of the Associated Press (AP) lies in the early cooperative news gathering efforts of the editors of several New York newspapers. As early as May 1846, these editors were "pooling" their energies in response to newly developed modes of communication--the wire and wireless telegraph and the trans-oceanic steamship mail services. The…

  3. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses

    Science.gov (United States)

    Prilliman, Stephen G.

    2014-01-01

    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  4. A process definition repository based on step AP 213

    Energy Technology Data Exchange (ETDEWEB)

    Butler, J.W.

    1997-09-01

    Over the years, in the context of numerically controlled machined part manufacturing, the loss, misinterpretation, and redundancy of re-inputting manufacturing instructions and data during the evolution of a product design into the finished product has been a resource depleting and costly endeavor. It is the intent of this project to utilize the emerging standards from the International Standards Organization, ISO 10303 Standard for the Exchange of Product Model Data, commonly referred to as STEP, to store and retrieve process planning information for a set of production work instructions. The project focuses on the utilization of the 1995 version of the Draft International Standard ISO/DIS 10303-213:1995 (E) Application protocol: Numerical control process plans for machined parts (AP213). This project illustrates the methodologies used to build an object-oriented Process Definition Repository (PDR), describes both the benefits and shortcomings experienced in implementing AP213, and recommends enhancements to AP213 for process planning information. The deliverable will be a Part 21 data file, based on the application-interpreted model for AP213 and integrated with product design data.

  5. 76 FR 82079 - AP1000 Design Certification Amendment

    Science.gov (United States)

    2011-12-30

    ... Vessel (RPV) Support System. SFP Decay Heat Analysis and Associated Design Changes. Spent Fuel Rack... any person. The NRC originally approved the AP1000 design certification in a final rule in 2006 (71 FR... notice of acceptance (ADAMS Accession No. ML073600743) in the Federal Register (73 FR 4926; January...

  6. Stokes IQUV magnetic Doppler imaging of Ap stars - I. ESPaDOnS and NARVAL observations

    Science.gov (United States)

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Bagnulo, S.; Folsom, C. P.; Hanes, D.

    2012-10-01

    In this paper we describe and evaluate new spectral line polarization observations obtained with the goal of mapping the surfaces of magnetic Ap stars in great detail. One hundred complete or partial Stokes IQUV sequences, corresponding to 297 individual polarized spectra, have been obtained for seven bright Ap stars using the Échelle SpectroPolarimetric Device for the Observation of Stars (ESPaDOnS) and NARVAL high-resolution spectropolarimeters. The targets span a range of masses from approximately 1.8 to 3.4 M⊙, a range of rotation periods from 2.56 to 6.80 d and a range of maximum longitudinal magnetic field strengths from 0.3 to over 4 kG. For three of the seven stars, we have obtained dense phase coverage sampling the entire rotational cycle. These data sets are suitable for immediate magnetic and chemical abundance surface mapping using magnetic Doppler imaging. For the remaining four stars, partial phase coverage has been obtained, and additional observations will be required in order to map the surfaces of these stars. The median signal-to-noise ratio of the reduced observations is over 700 per 1.8 km s-1 pixel. Spectra of all stars show Stokes V Zeeman signatures in essentially all individual lines, and most stars show clear Stokes QU signatures in many individual spectral lines. The observations provide a vastly improved data set compared to previous generations of observations in terms of signal-to-noise ratio, resolving power and measurement uncertainties. Measurement of the longitudinal magnetic field demonstrates that the data are internally consistent within computed uncertainties typically at the 50-100σ level. Data are also shown to be in excellent agreement with published observations and in qualitative agreement with the predictions of published surface structure models. In addition to providing the foundation for the next generation of surface maps of Ap stars, this study establishes the performance and stability of the ESPaDOnS and NARVAL

  7. High Line

    OpenAIRE

    Jagielska, Anna

    2015-01-01

    This project examines The High Line in New York City and what is due to its success. The park, which runs through the meatpacking district in Manhattan, is on an old rail line that was abandoned from the 1980s. Two private locals, Joshua and Hammond, founded the non-profit organization “Friends of The High Line” and established the rail line into a public park. The aesthetics of the park is the wildness of the nature and the modern architecture in the middle of Manhattan mixed with a sustaina...

  8. Heparin (GAG-hed inhibits LCR activity of Human Papillomavirus type 18 by decreasing AP1 binding

    Directory of Open Access Journals (Sweden)

    López-Bayghen Esther

    2006-08-01

    Full Text Available Abstract Background High risk HPVs are causative agents of anogenital cancers. Viral E6 and E7 genes are continuously expressed and are largely responsible for the oncogenic activity of these viruses. Transcription of the E6 and E7 genes is controlled by the viral Long Control Region (LCR, plus several cellular transcription factors including AP1 and the viral protein E2. Within the LCR, the binding and activity of the transcription factor AP1 represents a key regulatory event in maintaining E6/E7 gene expression and uncontrolled cell proliferation. Glycosaminoglycans (GAGs, such as heparin, can inhibit tumour growth; they have also shown antiviral effects and inhibition of AP1 transcriptional activity. The purpose of this study was to test the heparinoid GAG-hed, as a possible antiviral and antitumoral agent in an HPV18 positive HeLa cell line. Methods Using in vivo and in vitro approaches we tested GAG-hed effects on HeLa tumour cell growth, cell proliferation and on the expression of HPV18 E6/E7 oncogenes. GAG-hed effects on AP1 binding to HPV18-LCR-DNA were tested by EMSA. Results We were able to record the antitumoral effect of GAG-hed in vivo by using as a model tumours induced by injection of HeLa cells into athymic female mice. The antiviral effect of GAG-hed resulted in the inhibition of LCR activity and, consequently, the inhibition of E6 and E7 transcription. A specific diminishing of cell proliferation rates was observed in HeLa but not in HPV-free colorectal adenocarcinoma cells. Treated HeLa cells did not undergo apoptosis but the percentage of cells in G2/M phase of the cell cycle was increased. We also detected that GAG-hed prevents the binding of the transcription factor AP1 to the LCR. Conclusion Direct interaction of GAG-hed with the components of the AP1 complex and subsequent interference with its ability to correctly bind specific sites within the viral LCR may contribute to the inhibition of E6/E7 transcription and cell

  9. Functional analysis of the two Brassica AP3 genes involved in apetalous and stamen carpelloid phenotypes.

    Directory of Open Access Journals (Sweden)

    Yanfeng Zhang

    Full Text Available The Arabidopsis homeotic genes APETALA3 (AP3 and PISTILLATA (PI are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8 residues in B.AP3.b led to the change of PI-derived motifs. Meanwhile, B.AP3.a specified petal and stamen development, whereas B.AP3.b only specified stamen development. In B. rapa, the mutations of both genes generated the SC mutant HGMS. In B. napus that contained two B.AP3.a and two B.AP3.b, loss of the two B.AP3.a functions was the key reason for the apetalous mutation, however, the loss-of-function in all four AP3 was related to the SC mutant AMS. We inferred that the 8 residues or the PI-derived motif in AP3 gene probably relates to petal formation.

  10. Stokes IQUV Magnetic Doppler Imaging of Ap stars I. ESPaDOnS and NARVAL Observations

    CERN Document Server

    Silvester, J; Kochukhov, O; Bagnulo, S; Folsom, C P; Hanes, D

    2012-01-01

    In this paper we describe and evaluate new spectral line polarisation observations obtained with the goal of mapping the surfaces of magnetic Ap stars in great detail. One hundred complete or partial Stokes IQUV sequences, corresponding to 297 individual polarised spectra, have been obtained for 7 bright Ap stars using the ESPaDOnS and NARVAL spectropolarimeters. The targets span a range of mass from approximately 1.8 to 3.4 solar mass, a range of rotation period from 2.56 to 6.80 days, and a range of maximum longitudinal magnetic field strength from 0.3 to over 4 kG. For 3 of the 7 stars, we have obtained dense phase coverage sampling the entire rotational cycle. These datasets are suitable for immediate magnetic and chemical abundance surface mapping using Magnetic Doppler Imaging (MDI). For the 4 remaining stars, partial phase coverage has been obtained, and additional observations will be required in order to map the surfaces of these stars. The median signal-to-noise ratio of the reduced observations is ...

  11. Analysis of N-16 concentration in primary cooling system of AP1000 power reactor

    Science.gov (United States)

    Rohanda, Anis; Waris, Abdul

    2015-04-01

    Nitrogen-16 (N-16) is one of the radiation safety parameter on the primary reactor system. The activation product, N-16, is the predominant contributor to the activity in the reactor coolant system during reactor operation. N-16 is activation product derived from activation of O-16 with fast neutron based on 16O(n,p)16N reaction. Thus study is needed and it performs to determine N-16 concentration in reactor coolant (primary coolant) in supporting radiation safety. One of the way is using analytical methode based on activation and redecay princip to obtain N-16 concentration. The analysis was performed on the configuration basis and operational of Westinghouse AP1000 power reactor in several monitoring points at coolant reactor system. The results of the calculation of N-16 concentration at the core outlet, reactor vessel outlet, pressurizer line, inlet and outlet of steam generators, primary pumps, reactor vessels inlet and core inlet are: 281, 257, 255, 250, 145, 142, 129 and 112 µCi/gram respectively. The results of analysis compared with AP1000 design control document as standard values. The verification showed very high accuracy comparation between analytical results and standard values.

  12. Analysis of N-16 concentration in primary cooling system of AP1000 power reactor

    International Nuclear Information System (INIS)

    Nitrogen-16 (N-16) is one of the radiation safety parameter on the primary reactor system. The activation product, N-16, is the predominant contributor to the activity in the reactor coolant system during reactor operation. N-16 is activation product derived from activation of O-16 with fast neutron based on 16O(n,p)16N reaction. Thus study is needed and it performs to determine N-16 concentration in reactor coolant (primary coolant) in supporting radiation safety. One of the way is using analytical methode based on activation and redecay princip to obtain N-16 concentration. The analysis was performed on the configuration basis and operational of Westinghouse AP1000 power reactor in several monitoring points at coolant reactor system. The results of the calculation of N-16 concentration at the core outlet, reactor vessel outlet, pressurizer line, inlet and outlet of steam generators, primary pumps, reactor vessels inlet and core inlet are: 281, 257, 255, 250, 145, 142, 129 and 112 µCi/gram respectively. The results of analysis compared with AP1000 design control document as standard values. The verification showed very high accuracy comparation between analytical results and standard values

  13. Regulation of amino acid transporters by adenoviral-mediated human insulin-like growth factor-1 in a mouse model of placental insufficiency in vivo and the human trophoblast line BeWo in vitro

    Science.gov (United States)

    Jones, H.; Crombleholme, T.; Habli, M.

    2014-01-01

    Previous work in our laboratory demonstrated that over-expression of human insulin-like growth factor-11 (hIGF-1) in the placenta corrects fetal weight deficits in mouse, rat, and rabbit models of intrauterine growth restriction without changes in placental weight. The underlying mechanisms of this effect have not been elucidated. To investigate the effect of intra-placental IGF-1 over-expression on placental function we examined amino acid transporter expression and localization in both a mouse model of placental Insufficiency (PI) and a model of human trophoblast, the BeWo Choriocarcinoma cell line. For in vitro human studies, BeWo Choriocarcinoma cells were maintained in F12 complete medium + 10%FBS. Cells were incubated in serum-free control media ± Ad-IGF-1 or Ad-LacZ for 48 h. MOIs of 10:1 and 100:1 were utilized. In BeWo, transfection efficiency was 100% at an MOI of 100:1 and Ad-IGF-1 significantly increased IGF-1 secretion, proliferation and invasion but reduced apoptosis compared to controls. In vitro, amino acid uptake was increased following Ad-IGF-1 treatment and associated with significantly increased RNA expression of SNAT1, 2, LAT1 and 4F2hc. Only SNAT2 protein expression was increased but LAT1 showed relocalization from a perinuclear location to the cytoplasm and cell membrane. For in vivo studies, timed-pregnant animals were divided into four groups on day 18; sham-operated controls, uterine artery branch ligation (UABL), UABL + Ad-hIGF-1 (108 PFU), UABL + Ad-LacZ (108 PFU). At gestational day 20, pups and placentas were harvested by C-section. Only LAT1 mRNA expression changed, showing that a reduced expression of the transporter levels in the PI model could be partially rectified with Ad-hIGF1 treatment. At the protein level, System L was reduced in PI but remained at control levels following Ad-hIGF1. The System A isoforms were differentially regulated with SNAT2 expression diminished but SNAT1 increased in PI and Ad-hIGF1 groups. Enhanced

  14. Blurring lines

    OpenAIRE

    Howard, Heidi C; Knoppers, Bartha Maria; Borry, Pascal

    2010-01-01

    Companies that offer direct-to-consumer genetic testing and conduct research are blurring the line between customers and research subjects. Should these companies adhere to the same ethical regulations as academic researchers?

  15. High Line

    DEFF Research Database (Denmark)

    Kiib, Hans

    2015-01-01

    . The High Line project has been carried out as part of an open conversion strategy. The result is a remarkable urban architectural project, which works as a catalyst for the urban development of Western Manhattan. The greater project includes the restoration and reuse of many old industrial buildings......At just over 10 meters above street level, the High Line extends three kilometers through three districts of Southwestern Manhattan in New York. It consists of simple steel construction, and previously served as an elevated rail line connection between Penn Station on 34th Street and the many...... in close proximity to the park bridge and new projects being added to fit the context. The outcome is a conglomeration of non-contemporary urban activities along the High Line, where mechanical workshops, small wholesale stores. etc. mix with new exclusive residential buildings, eminent cafés, and...

  16. Polarity of fatty acid uptake and metabolism in a human intestinal cell line (CACO-2)

    International Nuclear Information System (INIS)

    Free fatty acids (ffa) can enter the intestinal cell via the apical (AP) or basolateral (BL) membrane. The authors are using the Caco-2 intestinal cell line to examine the polarity of ffa uptake and metabolism in the enterocyte. Cells are grown on permeable polycarbonate Transwell filters in order to obtain access to both AP and BL compartments. Differentiated Caco-2 cells form tight polarized monolayers which express small intestine-specific enzymes and are impermeable to the fluid phase marker Lucifer Yellow. Submicellar concentrations of 3H-palmitic acid (2uM) were added to AP or BL sides of Caco-2 monolayers at 37 degrees C and cells were incubated for various times between 2 and 120 minutes. Total AP and BL uptake is similar; however, when relative membrane surface areas are accounted for, AP uptake is about 2-fold higher. The metabolism of AP and BL ffa is not significantly different: triacylglycerol and phosphatidylcholine account for most of the metabolites (32±4 and 24±2% respectively at 5 minutes). Little ffa oxidation is observed. Preincubation with albumin-bound 2-monoolein (100uM) and palmitate (50uM) increases the level of TG metabolites. The results suggest that in this cell line the uptake of AP ffa may be greater than BL ffa, but that AP (dietary) ffa and BL (plasma) ffa are metabolized similarly

  17. Polarity of fatty acid uptake and metabolism in a human intestinal cell line (CACO-2)

    Energy Technology Data Exchange (ETDEWEB)

    Trotter, P.J.; Storch, J. (Harvard School of Public Health, Boston, MA (United States))

    1990-02-26

    Free fatty acids (ffa) can enter the intestinal cell via the apical (AP) or basolateral (BL) membrane. The authors are using the Caco-2 intestinal cell line to examine the polarity of ffa uptake and metabolism in the enterocyte. Cells are grown on permeable polycarbonate Transwell filters in order to obtain access to both AP and BL compartments. Differentiated Caco-2 cells form tight polarized monolayers which express small intestine-specific enzymes and are impermeable to the fluid phase marker Lucifer Yellow. Submicellar concentrations of {sup 3}H-palmitic acid (2uM) were added to AP or BL sides of Caco-2 monolayers at 37{degrees}C and cells were incubated for various times between 2 and 120 minutes. Total AP and BL uptake is similar; however, when relative membrane surface areas are accounted for, AP uptake is about 2-fold higher. The metabolism of AP and BL ffa is not significantly different: triacylglycerol and phosphatidylcholine account for most of the metabolites (32{plus minus}4 and 24{plus minus}2% respectively at 5 minutes). Little ffa oxidation is observed. Preincubation with albumin-bound 2-monoolein (100uM) and palmitate (50uM) increases the level of TG metabolites. The results suggest that in this cell line the uptake of AP ffa may be greater than BL ffa, but that AP (dietary) ffa and BL (plasma) ffa are metabolized similarly.

  18. AP24534, a Pan-BCR-ABL Inhibitor for Chronic Myeloid Leukemia, Potently Inhibits the T315I Mutant and Overcomes Mutation-Based Resistance

    Energy Technology Data Exchange (ETDEWEB)

    O’Hare, Thomas; Shakespeare, William C.; Zhu, Xiaotian; Eide, Christopher A.; Rivera, Victor M.; Wang, Frank; Adrian, Lauren T.; Zhou, Tianjun; Huang, Wei-Sheng; Xu, Qihong; Metcalf, III, Chester A.; Tyner, Jeffrey W.; Loriaux, Marc M.; Corbin, Amie S.; Wardwell, Scott; Ning, Yaoyu; Keats, Jeffrey A.; Wang, Yihan; Sundaramoorthi, Raji; Thomas, Mathew; Zhou, Dong; Snodgrass, Joseph; Commodore, Lois; Sawyer, Tomi K.; Dalgarno, David C.; Deininger, Michael W.N.; Druker, Brian J.; Clackson, Tim; (OHSU- Cancer Instit.); (ARIAD)

    2010-09-07

    Inhibition of BCR-ABL by imatinib induces durable responses in many patients with chronic myeloid leukemia (CML), but resistance attributable to kinase domain mutations can lead to relapse and a switch to second-line therapy with nilotinib or dasatinib. Despite three approved therapeutic options, the cross-resistant BCR-ABL{sup T315I} mutation and compound mutants selected on sequential inhibitor therapy remain major clinical challenges. We report design and preclinical evaluation of AP24534, a potent, orally available multitargeted kinase inhibitor active against T315I and other BCR-ABL mutants. AP24534 inhibited all tested BCR-ABL mutants in cellular and biochemical assays, suppressed BCR-ABL{sup T315I}-driven tumor growth in mice, and completely abrogated resistance in cell-based mutagenesis screens. Our work supports clinical evaluation of AP24534 as a pan-BCR-ABL inhibitor for treatment of CML.

  19. Functional Analysis of the Two Brassica AP3 Genes Involved in Apetalous and Stamen Carpelloid Phenotypes

    OpenAIRE

    Zhang, Yanfeng; Wang, Xuefang; Zhang, Wenxue; Yu, Fei; Tian, Jianhua; Li, Dianrong; Guo, Aiguang

    2011-01-01

    The Arabidopsis homeotic genes APETALA3 (AP3) and PISTILLATA (PI) are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC) mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8...

  20. Offsite dose risk quantification analysis for AP1000 nuclear power plant

    International Nuclear Information System (INIS)

    In order to estimate the potential offsite effect caused by severe accidents of AP1000 nuclear power plant, radiation dose risk was quantified, which takes into account six representative release categories. Atmospheric transport with airborne radioactive material was simulated by MACCS code. The results show that acute red marrow dose risk at the site boundary is 1.96 X 10-7 Sv/ (reactor · year), which mainly results from containment bypass release (BP). The early health effect risks are 10-10-10-9 Sv/ (reactor · year), and the risks decrease obviously with the increase of distance from reactor. Population whole-body effective dose risk is 6.94 X 10-4 person · Sv/ (reactor · year), and the corresponding cancer fatality risk is quite low. The study result also indicates that timely evacuation after the nuclear accident can reduce public dose risk significantly. (authors)

  1. Phase control and intra-pulse phase compensation of the Advanced Photon Source (APS) linear accelerator

    International Nuclear Information System (INIS)

    Rf power for the APS linear accelerator is provided by five klystrons, each of which feeds one linac ''sector,'' containing accelerating structures and SLED cavities. A VXI-based subsystem measures the phase of each sector of the linac with respect to a thermally stabilized reference line. The resulting information is used to control a linearized varactor phase shifter. Error correction is done by software, using operator-controllable parameters. A second phase shifter provides an intra-pulse correction to the phase of the klystron drive pulse. When the intra-pulse correction is applied, the resulting phase is flat to within 0.5 degrees after 2.5 μsec. A second correction, made after the PSK trigger to the SLED and during the filling of the accelerating structures, resulted in an energy gain of 5 MeV from a single sector

  2. Analysis of JUN/AP1 function in Hedgehog/GLI-associated cancer

    International Nuclear Information System (INIS)

    The Hedgehog (HH)/GLI signaling pathway is a developmental pathway involved in segment patterning of the Drosophila larval body or in A-P axis and pattern formation of the vertebrate embryo. In adult mammals, the Hedgehog pathway is essential for tissue homeostasis, while deregulation of this pathway is associated with the development and growth of cancers of the skin, brain, gastrointestinal tract, lung and prostate. A growing body of evidence suggests that control of oncogenic HH signaling involves interactions with other pathways frequently activated in human malignancies. In line with these findings, we have shown that Epidermal Growth Factor Receptor (EGFR) signaling synergizes with Hedgehog/GLI in oncogenic transformation of human keratinocytes in vitro. The integration of HH/GLI and EGFR signaling is thought to be mediated via an activation of the RAS/RAF/MEK/ERK cascade leading to the subsequent activation of the AP1 transcription factor JUN. Activated JUN can cooperate with GLI to activate the expression of selected EGFR-HH/GLI target genes thereby promoting transformation. Furthermore, it has been shown that the artificial GLI2 activator form (GLI2delN) can cooperate with active JUN in human keratinocytes, though these data were mainly based on overexpression and in vitro experiments. Given the crucial role of JUN in HH-EGFR-dependent cancer development and its putative cooperation with a dominant active GLI2delN form, the aim of my thesis was to address the in vivo role of cJun/Ap1 in Gli-driven basal cell carcinoma (BCC), a very common form of non-melanoma skin cancer. Using a combination of genetic tools including RNA interference and cre/loxP transgenic mouse technology for conditional inactivation of cJun/Ap1, I could show that inhibition of cJun/Ap1 in established Ptch deficient BCC cells decreases tumor growth in allograft experiments. By contrast, genetic deletion of cJun in GLI2delN expressing mice does not interfere with GLI2delN driven skin

  3. On-line atomic data access

    International Nuclear Information System (INIS)

    The need for atomic data is one which continues to expand in a wide variety of applications including fusion energy, astrophysics, laser-produced plasma research, and plasma processing. Modern computer database and communications technology enables this data to be placed on-line and obtained by users over the INTERNET. Presented here is a summary of the observations and conclusions regarding such on-line atomic data access derived from a forum held at the Tenth APS Topical Conference on Atomic Processes in Plasmas. copyright 1996 American Institute of Physics

  4. Genetic and phenotypic analysis of the mouse mutant mh2J, an Ap3d allele caused by IAP element insertion.

    Science.gov (United States)

    Kantheti, Prameela; Diaz, Maria E; Peden, Andrew E; Seong, Eunju E; Dolan, David F; Robinson, Margaret S; Noebels, Jeffrey L; Burmeister, Margit L

    2003-03-01

    Mocha (mh), a mouse model for Hermansky-Pudlak syndrome (HPS), is characterized by platelet storage pool deficiency, pigment dilution, and deafness as well as neurological abnormalities. The trans-Golgi/endosome adaptor-related complex AP-3 is missing in mh mice owing to a deletion in the gene encoding the delta subunit. Mice mutant for a second allele, mh(2J), are as hyperactive as mh, and display both spike wave absence and generalized tonic clonic seizures, but have less coat color dilution, no hearing loss, and no hypersynchronized EEG. Here we show that the mh(2J) mutation is due to an IAP element insertion in the Ap3d gene leading to a C-terminally truncated protein. Despite correct assembly of the AP-3 complex and localization to the trans-Golgi network and endosomes, AP-3 function in neurons remains impaired. While mh mice show a severe reduction of vesicular zinc (TIMM staining) owing to mislocalization and degradation of the Zinc transporter ZnT-3, the TIMM and ZnT-3 staining patterns in mh(2J) varies, with normal expression in hippocampal mossy fibers, but abnormal patterns in neocortex. These results indicate that the N-terminal portion of the delta subunit is sufficient for AP-3 complex assembly and subcellular localization to the TGN/endosomes, while subsequent function is regulated in part by cell-specific interactions with the C-terminal portion. PMID:12647238

  5. The magnetic fields of Ap stars from high resolution Stokes IQUV spectropolarimetry

    Science.gov (United States)

    Silvester, James

    In this thesis we describe the acquisition of high resolution time resolved spectropolarimetric observations of 7 (bright and well understood) Ap stars in Stokes IQUV using the ESPaDOnS and Narval spectropolarimeters at the Canada-France-Hawaii Telescope and the 2m Telescope Bernard Lyot at Pic du Midi Observatory. We compare these observations with those obtained a decade earlier using the MuSiCoS spectropolarimeter to confirm consistency with the older data and provide evidence that both ESPaDOnS and Narval perform as expected in all Stokes parameters. We demonstrate that our refined longitudinal magnetic field and linear polarisation measurements for these 7 stars are of much greater quality than was previously obtained with MuSiCoS and that the global magnetic properties of these stars are stable over a long timescale. The ultimate aim of these new data is to provide a basis from which mapping of both the magnetic field and abundance structures can be performed on our target stars. We then describe magnetic field mapping of the Ap star alpha 2 CVn using these data. This mapping is achieved with the use of tomographic inversion of Doppler-broadened Stokes IQUV profiles of a large variety of spectral lines using the INVERS10 Magnetic Doppler imaging code. We show that not only are the new magnetic field maps of alpha 2 CVn consistent with a previous generation of maps of alpha 2 CVn, but that the same magnetic field topology can be derived from a variety of atomic line sets. This indicates that the magnetic field we derive for alpha2 CVn is a realistic representation of the star's true magnetic topology. Finally we investigate surface abundance structures for alpha 2 CVn for various chemical elements. We investigate the correlation between the location of these abundance features and the magnetic field of alpha 2 CVn. We will demonstrate that whilst the magnetic field plays a role in the formation of abundance structures, the current theoretical framework does

  6. Tank 241-AP-107 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Defense Nuclear Facilities Safety Board has directed the DOE to concentrate ear-term sampling and analysis activities on identification and resolution of issues (Conway 1993). The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44-00 has been made, which states that ''A Tank Characterization Plan (TCP) will be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process; Development of TCPs by the DQO process is intended to allow users (e.g., Hanford Facility user groups, regulators) to ensure their needs will be met and that resources are devoted to gaining only necessary information.'' This document satisfies that requirement for the tank 241-AP-107 (AP-107)

  7. Status of APS 1-Mwe Parabolic Trough Project

    Energy Technology Data Exchange (ETDEWEB)

    Canada, S.; Brosseau, D.; Kolb, G.; Moore, L.; Cable, R.; Price, H.

    2005-11-01

    Arizona Public Service (APS) is currently installing new power facilities to generate a portion of its electricity from solar resources that will satisfy its obligation under the Arizona Environmental Portfolio Standard (EPS). During FY04, APS began construction on a 1-MWe parabolic trough concentrating solar power plant. This plant represents the first parabolic trough plant to begin construction since 1991. Site preparation and construction activities continued throughout much of FY05, and startup activities are planned for Fall 2005 (with completion early in FY06). The plant will be the first commercial deployment of the Solargenix parabolic trough collector technology developed under contract to the National Renewable Energy Laboratory. The plant will use an organic Rankine cycle (ORC) power plant, provided by Ormat. The ORC power plant is much simpler than the conventional steam Rankine cycle plant and allows unattended operation of the facility.

  8. Densification and microstructure development during HIPing of AP1

    International Nuclear Information System (INIS)

    The densification and the microstructural development during hot isostatic pressing of AP1 superalloy powder were compared with the predictions made from calculated HIP diagrams. Power law creep was found to dominate the densification of the Ni-base superalloy during HIPing. The densification was in accordance with calculated HIP maps at low pressures and annealing times, but at elevated pressures and prolonged HIPing times much faster than calculated. During HIPing some percent of the particles undergo minor deformation. It was found in AP1 that these particles showed coarse grains, whereas the more heavily deformed particles displayed a fine microstructure. The different degrees of deformation may arise from size differences of the particles. (orig.)

  9. Comparative advantages of AP1000 passive safety system

    International Nuclear Information System (INIS)

    With the increasing need of nuclear power, almost all countries who want to build new nuclear power plant take the generation Ⅲ technology as their first choice. The main reason is that the safety of generation Ⅲ technology has been improved greatly than generation Ⅱ and Ⅱ + technology. The passive safety technology is introduced by AP1000 and it is one of the best in generation Ⅲ technologies. The representative passive containment cooling system of AP1000 and containment spray system of generation Ⅱ nuclear power plant were compared in the paper and analyzed using probabilistic safety assessment method. The reasons of passive safety system possessing comparative advantages were obtained by the concrete calculation. (authors)

  10. DNA Charge Transport: Conformationally Gated Hopping through Stacked Domains

    OpenAIRE

    O'Neill, Melanie A.; Barton, Jacqueline K.

    2004-01-01

    The role of base motions in delocalization and propagation of charge through double helical DNA must be established experimentally and incorporated into mechanistic descriptions of DNA-mediated charge transport (CT). Here, we address these fundamental issues by examining the temperature dependence of the yield of CT between photoexcited 2-aminopurine (Ap*) and G through DNA bridges of varied length and sequence. DNA assemblies (35-mers) were constructed containing adenine bridges Ap(A)_nG (n ...

  11. Electron-cloud measurements and simulations for the APS

    International Nuclear Information System (INIS)

    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC

  12. QCD on the highly parallel computer AP1000

    International Nuclear Information System (INIS)

    We have been running quenched QCD simulations on 324 and 323 x 48 lattices using a 512 processor AP1000, which is a highly parallel computer with up to 1024 processing elements. We have developed programs for update, blocking and hadron propagator calculations. The pseudo heatbath and the overrelaxation algorithms were used for the update with performance of 2.6 and 2.0 μsec/link, respectively. (orig.)

  13. Thermal analysis of the beam missteering in APS storage ring

    International Nuclear Information System (INIS)

    Several bending magnet beam missteering cases have been investigated for the 7-GeV storage ring of the Advanced Photon Source (APS). One of the critical missteering events is presented in this paper. Finite element analyses are performed to solve for both temperature and stress fields. Thermally induced deflections are determined by using beam bending theory. A safe current limit is established for the storage ring chambers

  14. Electron-cloud measurements and simulations for the APS

    OpenAIRE

    Furman, M.A.; Pivi, M.; Harkay, K.C.; Rosenberg, R. A.

    2001-01-01

    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC.

  15. The interaction between the adaptor protein APS and Enigma is involved in actin organisation

    DEFF Research Database (Denmark)

    Barres, Romain; Gonzalez, Teresa; Le Marchand-Brustel, Yannick; Tanti, Jean-François

    2005-01-01

    APS (adaptor protein with PH and SH2 domains) is an adaptor protein phosphorylated by several tyrosine kinase receptors including the insulin receptor. To identify novel binding partners of APS, we performed yeast two-hybrid screening. We identified Enigma, a PDZ and LIM domain-containing protein...... that was previously shown to be associated with the actin cytoskeleton. In HEK 293 cells, Enigma interacted specifically with APS, but not with the APS-related protein SH2-B. This interaction required the NPTY motif of APS and the LIM domains of Enigma. In NIH-3T3 cells that express the insulin...... receptor, Enigma and APS were partially co-localised with F-actin in small ruffling structures. Insulin increased the complex formation between APS and Enigma and their co-localisation in large F-actin containing ruffles. While in NIH-3T3 and HeLa cells the co-expression of both Enigma and APS did not...

  16. Work plan, AP-102 mixer pump removal and pump replacement

    International Nuclear Information System (INIS)

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  17. Alignment and commissioning of the APS beamline front ends

    International Nuclear Information System (INIS)

    Fifteen out of forty initial beamline front ends have been installed in the storage-ring tunnel at the 7-GeV Advanced Photon Source (APS). For the front-end installation, a four-step alignment process was designed and consists of (1) prealigning the front-end components with support tables in the preassembly area, (2) installing the components with tables in the storage-ring tunnel and aligning relative to the APS global telescope survey network, (3) confirming the alignment using a tooling laser alignment system, and (4) performing adjustments with the synchrotron-radiation beam during commissioning. The laser alignment system and the prealignment database have been of great importance for the expedient maintenance of front-end components. These tools are very important to a large synchrotron radiation facility, such as the APS, since they make a quick alignment setup possible and minimize alignment time inside the tunnel. This paper will present the four-step alignment process, the laser alignment system, and discuss the alignment confirmation results. copyright 1996 American Institute of Physics

  18. Finite element modeling of AP1000 nuclear island

    International Nuclear Information System (INIS)

    The AP1000 is a standard design developed by Westinghouse and its partners for an advanced nuclear power plant utilizing passive safety features. It is based on the certified design of the AP600 and has been uprated to 1000 MWe. The plant has five principal building structures; the nuclear island, the turbine building; the annex building; the diesel generator building and the radwaste building. The nuclear island consists of the containment building (the steel containment vessel and the containment internal structures), the shield building, and the auxiliary building. These structures are founded on a common basemat and are collectively known as the nuclear island. This paper describes use of the general purpose finite element program ANSYS [2] in structural analyses and qualification of the AP1000 nuclear island buildings. It describes the modeling of the shield building and the auxiliary building and the series of analyses and the flow of information from the global analyses to the detailed analyses and building qualification. (author)

  19. Long-term stability of the APS storage ring

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS), a third-generation synchrotrons light source, was commissioned in 1995 at Argonne ''National Laboratory and has been fully-operational for beamline users since 1997. The APS storage ring can accommodate up to 68 user beamlines; about 70% of the available beamlines are currently in use by various collaborative access teams (CATS). The 7-GeV synchrotrons light source produces light in the soft to hard x-ray range that is used for research in such areas as x-ray instrumentation; material, chemical and atomic sciences; biology; and geo/soil/ environmental sciences. For the successful operation of an x-ray light source such as the Advanced Photon Source, the long-term stability of the concrete floor supporting the beam components and user beamlines is crucial. Settlements impact the orbit and location of the x-ray source points as well as the position of the x-ray beamlines. This paper compares the results of two successive resurveys of the APS accelerator components performed in 1995 and 1998

  20. Maternal AP determinants in the Drosophila oocyte and embryo.

    Science.gov (United States)

    Ma, Jun; He, Feng; Xie, Gengqiang; Deng, Wu-Min

    2016-09-01

    An animal embryo cannot initiate its journey of forming a new life on its own. It must rely on maternally provided resources and inputs to kick-start its developmental process. In Drosophila, the initial polarities of the embryo along both the anterior-posterior (AP) and dorsal-ventral (DV) axes are also specified by maternal determinants. Over the past several decades, genetic and molecular studies have identified and characterized such determinants, as well as the zygotic genetic regulatory networks that control patterning in the early embryo. Extensive studies of oogenesis have also led to a detailed knowledge of the cellular and molecular interactions that control the formation of a mature egg. Despite these efforts, oogenesis and embryogenesis have been studied largely as separate problems, except for qualitative aspects with regard to maternal regulation of the asymmetric localization of maternal determinants. Can oogenesis and embryogenesis be viewed from a unified perspective at a quantitative level, and can that improve our understanding of how robust embryonic patterning is achieved? Here, we discuss the basic knowledge of the regulatory mechanisms controlling oogenesis and embryonic patterning along the AP axis. We explore properties of the maternal Bicoid gradient in relation to embryo size in search for a unified framework for robust AP patterning. WIREs Dev Biol 2016, 5:562-581. doi: 10.1002/wdev.235 For further resources related to this article, please visit the WIREs website. PMID:27253156