WorldWideScience

Sample records for aps topical group

  1. The History of the APS Shock Compression of Condensed Matter Topical Group

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-05-02

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wave/high pressure sessions at APS general meetings in even numbered years.

  2. History of the APS Topical Group on Shock Compression of Condensed Matter

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-10-19

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wavehigh pressure sessions at APS general meetings in even numbered years.

  3. PREFACE: Second Meeting of the APS Topical Group on Hadronic Physics

    Science.gov (United States)

    Ernst, David; de Jager, Kees; Roberts, Craig; Sheldon, Paul; Swanson, Eric

    2007-06-01

    The Second Meeting of the APS Topical Group on Hadronic Physics was held on 22-24 October 2006 at the Opryland Resort in Nashville, Tennessee. Keeping with tradition, the meeting was held in conjunction with the Fall meeting of the APS Division of Nuclear Physics. Approximately 90 physicists participated in the meeting, presenting 25 talks in seven plenary sessions and 48 talks in 11 parallel sessions. These sessions covered a wide range of topics related to strongly interacting matter. Among these were charm spectroscopy, gluonic exotics, nucleon resonance physics, RHIC physics, electroweak and spin physics, lattice QCD initiatives, and new facilities. Brad Tippens and Brad Keister provided perspective from the funding agencies. The organisers are extremely grateful to the following institutions for financial and logistical support: the American Physical Society, Jefferson Lab, Brookhaven National Laboratory, and Vanderbilt University. We thank the following persons for assisting in organising the parallel sessions: Ted Barnes, Jian-Ping Chen, Ed Kinney, Krishna Kumar, Harry Lee, Mike Leitch, Kam Seth, and Dennis Weygand. We also thank Gerald Ragghianti for designing the conference poster, Will Johns for managing the audio-visual equipment and for placing the talks on the web, Sandy Childress for administrative expertise, and Vanderbilt graduate students Eduardo Luiggi and Jesus Escamillad for their assistance. David Ernst, Kees de Jager, Craig Roberts (Chair), Paul Sheldon and Eric Swanson Editors

  4. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Spring 1997

    CERN Document Server

    Pullin, J

    1997-01-01

    Contents: News: April 1997 Joint APS/AAPT Meeting, by Beverly Berger TGG News, by Jim Isenberg Report from NSF, by David Berley We hear that..., by Jorge Pullin Research briefs: GR in GPS, by Neil Ashby What happens near the innermost stable circular orbit? by Doug Eardley Conference reports: Journees Relativistes 96, by D. Brill, M. Heusler, G. Lavrelashvili TAMA Workshop, by Peter Saulson Midwest gravity meeting, by Comer Duncan OMNI-1 Workshop by N.S. Magalhaes, W. F. Velloso Jr and O.D. Aguiar Chandra Symposium, by Robert Wald Penn State Meeting, by Lee Smolin Aspen Winter Conference, by Syd Meshkov

  5. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Spring 2001

    CERN Document Server

    Pullin, J

    2001-01-01

    News: APS Prize on gravitation, by Cliff Will TGG elections, by David Garfinkle We hear that... by Jorge Pullin Research Briefs: Experimental Unruh radiation?, by Matt Visser Why is the universe accelerating?, by Beverly Berger The Lazarus Project, by Richard Price LIGO locks its first detector!, by Stan Whitcomb Progress on the nonlinear r-mode problem, by Keith Lockitch Conference reports: Analog models of general relativity, by Matt Visser Astrophysical Sources of Gravitational radiation by Joan Centrella Numerical relativity at the 20th Texas meeting, by Pablo Laguna

  6. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Spring 2003

    CERN Document Server

    Pullin, J

    2003-01-01

    Contents: Community news: GGR activities, by Richard Price We hear that..., by Jorge Pullin Institute of Physics Gravitational Physics Group, by Elizabeth Winstanley Center for gravitational wave astronomy, by Mario Diaz Research briefs: LIGO's first preliminary science run, by Gary Sanders Quantization of area: the plot thickens, by John Baez Convergence of G measurements -Mysteries remain, by Riley Newman Conference reports: Brane world gravity, by Elizabeth Winstanley Massive black holes focus session, by Steinn Sigurdsson GWDAW 2002, by Peter Saulson Source simulation focus session, by Pablo Laguna RRI workshop on loop quantum gravity, by Fernando Barbero Lazarus/Kudu Meeting, by Warren G. Anderson

  7. Topics in cohomology of groups

    CERN Document Server

    Lang, Serge

    1996-01-01

    The book is a mostly translated reprint of a report on cohomology of groups from the 1950s and 1960s, originally written as background for the Artin-Tate notes on class field theory, following the cohomological approach. This report was first published (in French) by Benjamin. For this new English edition, the author added Tate's local duality, written up from letters which John Tate sent to Lang in 1958 - 1959. Except for this last item, which requires more substantial background in algebraic geometry and especially abelian varieties, the rest of the book is basically elementary, depending only on standard homological algebra at the level of first year graduate students.

  8. Data Aggregation Gateway Framework for CoAP Group Communications

    Directory of Open Access Journals (Sweden)

    Minki Cha

    2016-11-01

    Full Text Available In this paper, a data aggregation gateway framework (DA-GW for constrained application protocol (CoAP group communications is proposed. The DA-GW framework is designed to improve the throughput performance and energy efficiency of group communication to monitor and control multiple sensor devices collectively with a single user terminal. The DA-GW consists of four function blocks—the message analyzer, group manager, message scheduler and data handler—and three informative databases—the client database, resource database and information database. The DA-GW performs group management and group communication through each functional block and stores resources in the informative databases. The DA-GW employs international standard-based data structures and provides the interoperability of heterogeneous devices used in various applications. The DA-GW is implemented using a Java-based open source framework called jCoAP to evaluate the functions and performance of the DA-GW. The experiment results showed that the DA-GW framework revealed better performance than existing group communication methods in terms of throughput and energy consumption.

  9. Pro/antioxidant status and AP-1 transcription factor in murine skin following topical exposure to cumene hydroperoxide.

    Science.gov (United States)

    Murray, A R; Kisin, E R; Kommineni, C; Vallyathan, V; Castranova, V; Shvedova, A A

    2007-07-01

    Organic peroxides, widely used in the chemical and pharmaceutical industries, can act as skin tumor promoters and cause epidermal hyperplasia. They are also known to trigger free radical generation. The present study evaluated the effect of cumene hydroperoxide (Cum-OOH) on the induction of activator protein-1 (AP-1), which is linked to the expression of genes regulating cell proliferation, growth and transformation. Previously, we reported that topical exposure to Cum-OOH caused formation of free radicals and oxidative stress in the skin of vitamin E-deficient mice. The present study used JB6 P+ mouse epidermal cells and AP-1-luciferase reporter transgenic mice to identify whether exposure to Cum-OOH caused activation of AP-1, oxidative stress, depletion of antioxidants and tumor formation during two-stage carcinogenesis. In vitro studies found that exposure to Cum-OOH reduced the level of glutathione (GSH) in mouse epidermal cells (JB6 P+) and caused the induction of AP-1. Mice primed with dimethyl-benz[a]anthracene (DMBA) were topically exposed to Cum-OOH (82.6 micromol) or the positive control, 12-O-tetradecanoylphorbol-13-acetate (TPA, 17 nmol), twice weekly for 29 weeks. Activation of AP-1 in skin was detected as early as 2 weeks following Cum-OOH or TPA exposure. No AP-1 expression was found 19 weeks after initiation. Papilloma formation was observed in both the DMBA-TPA- and DMBA-Cum-OOH-exposed animals, whereas skin carcinomas were found only in the DMBA-Cum-OOH-treated mice. A greater accumulation of peroxidative products (thiobarbituric acid-reactive substances), inflammation and decreased levels of GSH and total antioxidant reserves were also observed in the skin of DMBA-Cum-OOH-exposed mice. These results suggest that Cum-OOH-induced carcinogenesis is accompanied by increased AP-1 activation and changes in antioxidant status.

  10. Expansion and Functional Divergence of AP2 Group Genes in Spermatophytes Determined by Molecular Evolution and Arabidopsis Mutant Analysis

    Directory of Open Access Journals (Sweden)

    Pengkai Wang

    2016-09-01

    Full Text Available The APETALA2 (AP2 genes represent the AP2 group within a large group of DNA-binding proteins called AP2/EREBP. The AP2 gene is functional and necessary for flower development, stem cell maintenance, and seed development, whereas the other members of AP2 group redundantly affect flowering time. Here we study the phylogeny of AP2 group genes in spermatophytes. Spermatophyte AP2 group genes can be classified into AP2 and TOE types, six clades, and we found that the AP2 group homologs in gymnosperms belong to the AP2 type, whereas TOE types are absent, which indicates the AP2 type gene are more ancient and TOE type was split out of AP2 type and losing the major function. In Brassicaceae, the expansion of AP2 and TOE type lead to the gene number of AP2 group were up to six. Purifying selection appears to have been the primary driving force of spermatophyte AP2 group evolution, although positive selection occurred in the AP2 clade. The transition from exon to intron of AtAP2 in Arabidopsis mutant leads to the loss of gene function and the same situation was found in AtTOE2. Combining this evolutionary analysis and published research, the results suggest that typical AP2 group genes may first appear in gymnosperms and diverged in angiosperms, following expansion of group members and functional differentiation. In angiosperms, AP2 genes (AP2 clade inherited key functions from ancestors and other genes of AP2 group lost most function but just remained flowering time controlling in gene formation. In this study, the phylogenies of AP2 group genes in spermatophytes was analyzed, which supported the evidence for the research of gene functional evolution of AP2 group.

  11. Report of the APS Neutrino Study Reactor Working Group

    Energy Technology Data Exchange (ETDEWEB)

    Abouzaid, E.; Anderson, K.; Barenboim, G.; Berger, B.; Blucher, E.; Bolton, T.; Choubey, S.; Conrad, J.; Formaggio, J.; Freedman, S.; Finely, D.; Fisher, P.; Fujikawa, B.; Gai, M.; Goodman, M.; de Goueva, A.; Hadley, N.; Hahn, R.; Horton-Smith, G.; Kadel, R.; Kayser, B.; Heeger, K.; Klein, J.; Learned, J.; Lindner, M.; Link, J.; Luk, K.-B.; McKeown, R.; Mocioiu, I.; Mohapatra, R.; Naples, D.; Peng, J.; Petcov, S.; Pilcher, J.; Rapidis, P.; Reyna, D.; Shaevitz, M.; Shrock, R.; Stanton, N.; Stefanski, R.; Yamamoto, R.; Worcester, M.

    2004-10-28

    The worldwide program to understand neutrino oscillations and determine the neutrino mixing parameters, CP violating effects, and mass hierarchy will require a broad combination of measurements. The group believes that a key element of this future neutrino program is a multi-detector neutrino experiment (with baselines of {approx} 200 m and {approx} 1.5 km) with a sensitivity of sin{sup 2} 2{theta}{sub 13} = 0.01. In addition to oscillation physics, the reactor experiment may provide interesting measurements of sin{sup 2} {theta}{sub W} at Q{sup 2} = 0, neutrino couplings, magnetic moments, and mixing with sterile neutrino states. {theta}{sub 13} is one of the twenty-six parameters of the standard model, the best model of electroweak interactions for energies below 100 GeV and, as such, is worthy of a precision measurement independent of other considerations. A reactor experiment of the proposed sensitivity will allow a measurement of {theta}{sub 13} with no ambiguities and significantly better precision than any other proposed experiment, or will set limits indicating the scale of future experiments required to make progress. Figure 1 shows a comparison of the sensitivity of reactor experiments of different scales with accelerator experiments for setting limits on sin{sup 2} 2{theta}{sub 13} if the mixing angle is very small, or for making a measurement of sin{sup 2} 2{theta}{sub 13} if the angle is observable. A reactor experiment with a 1% precision may also resolve the degeneracy in the {theta}{sub 23} parameter when combined with long-baseline accelerator experiments. In combination with long-baseline measurements, a reactor experiment may give early indications of CP violation and the mass hierarchy. The combination of the T2K and Nova long-baseline experiments will be able to make significant measurements of these effects if sin{sup 2} 2{theta}{sub 13} > 0.05 and with enhanced beam rates can improve their reach to the sin{sup 2} 2{theta}{sub 13} > 0.02 level

  12. 77 FR 22622 - AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc...

    Science.gov (United States)

    2012-04-16

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc., CardioVascular... lack of current and accurate information concerning the securities of BPO Management Services,...

  13. Flexible unicast-based group communication for CoAP-enabled devices.

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Van den Abeele, Floris; Rossey, Jen; Moerman, Ingrid; Demeester, Piet

    2014-06-04

    Smart embedded objects will become an important part of what is called the Internet of Things. Applications often require concurrent interactions with several of these objects and their resources. Existing solutions have several limitations in terms of reliability, flexibility and manageability of such groups of objects. To overcome these limitations we propose an intermediately level of intelligence to easily manipulate a group of resources across multiple smart objects, building upon the Constrained Application Protocol (CoAP). We describe the design of our solution to create and manipulate a group of CoAP resources using a single client request. Furthermore we introduce the concept of profiles for the created groups. The use of profiles allows the client to specify in more detail how the group should behave. We have implemented our solution and demonstrate that it covers the complete group life-cycle, i.e., creation, validation, flexible usage and deletion. Finally, we quantitatively analyze the performance of our solution and compare it against multicast-based CoAP group communication. The results show that our solution improves reliability and flexibility with a trade-off in increased communication overhead.

  14. Flexible Unicast-Based Group Communication for CoAP-Enabled Devices

    Directory of Open Access Journals (Sweden)

    Isam Ishaq

    2014-06-01

    Full Text Available Smart embedded objects will become an important part of what is called the Internet of Things. Applications often require concurrent interactions with several of these objects and their resources. Existing solutions have several limitations in terms of reliability, flexibility and manageability of such groups of objects. To overcome these limitations we propose an intermediately level of intelligence to easily manipulate a group of resources across multiple smart objects, building upon the Constrained Application Protocol (CoAP. We describe the design of our solution to create and manipulate a group of CoAP resources using a single client request. Furthermore we introduce the concept of profiles for the created groups. The use of profiles allows the client to specify in more detail how the group should behave. We have implemented our solution and demonstrate that it covers the complete group life-cycle, i.e., creation, validation, flexible usage and deletion. Finally, we quantitatively analyze the performance of our solution and compare it against multicast-based CoAP group communication. The results show that our solution improves reliability and flexibility with a trade-off in increased communication overhead.

  15. Flexible Unicast-Based Group Communication for CoAP-Enabled Devices †

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Van den Abeele, Floris; Rossey, Jen; Moerman, Ingrid; Demeester, Piet

    2014-01-01

    Smart embedded objects will become an important part of what is called the Internet of Things. Applications often require concurrent interactions with several of these objects and their resources. Existing solutions have several limitations in terms of reliability, flexibility and manageability of such groups of objects. To overcome these limitations we propose an intermediately level of intelligence to easily manipulate a group of resources across multiple smart objects, building upon the Constrained Application Protocol (CoAP). We describe the design of our solution to create and manipulate a group of CoAP resources using a single client request. Furthermore we introduce the concept of profiles for the created groups. The use of profiles allows the client to specify in more detail how the group should behave. We have implemented our solution and demonstrate that it covers the complete group life-cycle, i.e., creation, validation, flexible usage and deletion. Finally, we quantitatively analyze the performance of our solution and compare it against multicast-based CoAP group communication. The results show that our solution improves reliability and flexibility with a trade-off in increased communication overhead. PMID:24901978

  16. Experimental Evaluation of Unicast and Multicast CoAP Group Communication.

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Moerman, Ingrid; Demeester, Piet

    2016-07-21

    The Internet of Things (IoT) is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP) is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP), but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP.

  17. Experimental Evaluation of Unicast and Multicast CoAP Group Communication

    Directory of Open Access Journals (Sweden)

    Isam Ishaq

    2016-07-01

    Full Text Available The Internet of Things (IoT is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP, but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP.

  18. Experimental Evaluation of Unicast and Multicast CoAP Group Communication

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Moerman, Ingrid; Demeester, Piet

    2016-01-01

    The Internet of Things (IoT) is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP) is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP), but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP. PMID:27455262

  19. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Fall 2005

    CERN Document Server

    Pullin, J

    2005-01-01

    GGR News: The WYP speakers program, by Richard Price We hear that..., by Jorge Pullin 100 Years ago, by Jorge Pullin Research Briefs: What's new in LIGO, by David Shoemaker Recent developments in the information loss paradox, by Eanna Flanagan Gravity Probe B mission ends, by Bob Kahn Conference reports: 6th Edoardo Amaldi Meeting, by Matthew Benacquista Workshop on Numerical Relativity, BIRS, by Carsten Gundlach 8th Capra Meeting on Radiation Reaction, by Leor Barack Theory and experiment in quantum gravity, by Elizabeth Winstanley

  20. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Fall 2004

    CERN Document Server

    Pullin, J

    2004-01-01

    Contents: Community news: Message from the Chair, by Jim Isenberg We hear that..., by Jorge Pullin THE TGG WYP Speakers Program, by Richard Price Research Briefs: Gravity Probe B is launched, by Bill Hamilton Questions and progress in mathematical general relativity, by Jim Isenberg Summary of recent preliminary LIGO results, by Alan Wiseman for the LSC 100 Years ago, by Jorge Pullin Conference reports: Einstein 125, by Abhay Ashtekar The 7th Eastern Gravity Meeting, by Deirdre Shoemaker 2004 Aspen GWADW, by Syd Meshkov Fifth LISA Symposium, by Curt Cutler GR17, by Brien Nolan Loops and Spinfoams, by Carlo Rovelli 20th Pacific coast gravity meeting, by Michele Vallisneri

  1. LDA-Based Unified Topic Modeling for Similar TV User Grouping and TV Program Recommendation.

    Science.gov (United States)

    Pyo, Shinjee; Kim, Eunhui; Kim, Munchurl

    2015-08-01

    Social TV is a social media service via TV and social networks through which TV users exchange their experiences about TV programs that they are viewing. For social TV service, two technical aspects are envisioned: grouping of similar TV users to create social TV communities and recommending TV programs based on group and personal interests for personalizing TV. In this paper, we propose a unified topic model based on grouping of similar TV users and recommending TV programs as a social TV service. The proposed unified topic model employs two latent Dirichlet allocation (LDA) models. One is a topic model of TV users, and the other is a topic model of the description words for viewed TV programs. The two LDA models are then integrated via a topic proportion parameter for TV programs, which enforces the grouping of similar TV users and associated description words for watched TV programs at the same time in a unified topic modeling framework. The unified model identifies the semantic relation between TV user groups and TV program description word groups so that more meaningful TV program recommendations can be made. The unified topic model also overcomes an item ramp-up problem such that new TV programs can be reliably recommended to TV users. Furthermore, from the topic model of TV users, TV users with similar tastes can be grouped as topics, which can then be recommended as social TV communities. To verify our proposed method of unified topic-modeling-based TV user grouping and TV program recommendation for social TV services, in our experiments, we used real TV viewing history data and electronic program guide data from a seven-month period collected by a TV poll agency. The experimental results show that the proposed unified topic model yields an average 81.4% precision for 50 topics in TV program recommendation and its performance is an average of 6.5% higher than that of the topic model of TV users only. For TV user prediction with new TV programs, the average

  2. Leucodermia punctata após tratamento com Puvasol tópico Leukoderma punctata following topical PUVAsol treatment

    Directory of Open Access Journals (Sweden)

    Nurimar Conceição Fernandes

    2010-08-01

    Full Text Available Duas adolescentes e uma menina com vitiligo clinicamente diagnosticado foram tratadas com 8-metoxipsoraleno a 0,2% em creme Lanette com subsequente exposição solar. Um ano após, apresentaram máculas acrômicas na área do vitiligo. A biópsia de pele em um dos casos revelou melanócitos com escassa pigmentação melânica. Os achados clínicos e histológicos sugerem o diagnóstico de leucodermia punctata.Two adolescent females and a girl, all with clinically diagnosed vitiligo, were treated with 0.2% 8-methoxypsoralen cream followed by exposure to solar ultraviolet light. One year later, they developed hypopigmented and achromic spots on the areas affected by the vitiligo. Biopsy of skin tissue taken from one of these cases showed a marked reduction in melanin. Clinical and histological findings point to a diagnosis of leukoderma punctata.

  3. Tomorrow's Journalists: In-Groups, Out-Groups, and News Topic Preference

    Science.gov (United States)

    Netzley, Sara Baker; Banning, Stephen A.

    2011-01-01

    This study explored whether student journalists believed they shared news topic preferences with the public. Previous research suggests journalists are very different from the audiences they serve, which may influence their perceptions of audience story preferences because of the social identity theory and the social distance corollary. A national…

  4. What’s all the talk about? Topic modelling in a mental health Internet support group

    Directory of Open Access Journals (Sweden)

    Bradley Carron-Arthur

    2016-10-01

    Full Text Available Abstract Background The majority of content in an Internet Support Group (ISG is contributed by 1 % of the users (‘super users’. Computational methods, such as topic modelling, can provide a large-scale quantitative objective description of this content. Such methods may provide a new perspective on the nature of engagement on ISGs including the role of super users and their possible effect on other users. Methods A topic model was computed for all posts (N = 131,004 in the ISG BlueBoard using Latent Dirichlet Allocation. A model containing 25 topics was selected on the basis of intelligibility as determined by diagnostic metrics and qualitative investigation. This model yielded 21 substantive topics for further analysis. Two chi-square tests were conducted separately for each topic to ascertain: (i if the odds of super users’ and other users’ posting differed for each topic; and (ii if for super users the odds of posting differed depending on whether the response was to a super user or to another user. Results The 21 substantive topics covered a range of issues related to mental health and peer-support. There were significantly higher odds that super users wrote content on 13 topics, with the greatest effects being for Parenting Role (OR [95%CI] = 7.97 [7.85–8.10], Co-created Fiction (4.22 [4.17–4.27], Mental Illness (3.13 [3.11–3.16] and Positive Change (2.82 [2.79–2.84]. There were significantly lower odds for super users on 7 topics, with the greatest effects being for the topics Depression (OR = 0.27 [0.27–0.28], Medication (0.36 [0.36–0.37], Therapy (0.55 [0.54–0.55] and Anxiety (0.55 [0.55–0.55]. However, super users were significantly more likely to write content on 5 out of these 7 topics when responding to other users than when responding to fellow super users. Conclusions The findings suggest that super users serve the role of emotionally supportive companions with a focus on topics broadly

  5. A Topic Space Oriented User Group Discovering Scheme in Social Network: A Trust Chain Based Interest Measuring Perspective

    Directory of Open Access Journals (Sweden)

    Wang Dong

    2016-01-01

    Full Text Available Currently, user group has become an effective platform for information sharing and communicating among users in social network sites. In present work, we propose a single topic user group discovering scheme, which includes three phases: topic impact evaluation, interest degree measurement, and trust chain based discovering, to enable selecting influential topic and discovering users into a topic oriented group. Our main works include (1 an overview of proposed scheme and its related definitions; (2 topic space construction method based on topic relatedness clustering and its impact (influence degree and popularity degree evaluation; (3 a trust chain model to take user relation network topological information into account with a strength classification perspective; (4 an interest degree (user explicit and implicit interest degree evaluation method based on trust chain among users; and (5 a topic space oriented user group discovering method to group core users according to their explicit interest degrees and to predict ordinary users under implicit interest and user trust chain. Finally, experimental results are given to explain effectiveness and feasibility of our scheme.

  6. Climate change on Twitter: topics, communities and conversations about the 2013 IPCC Working Group 1 report.

    Directory of Open Access Journals (Sweden)

    Warren Pearce

    Full Text Available In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report.

  7. Climate Change on Twitter: Topics, Communities and Conversations about the 2013 IPCC Working Group 1 Report

    Science.gov (United States)

    Pearce, Warren; Holmberg, Kim; Hellsten, Iina; Nerlich, Brigitte

    2014-01-01

    In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report. PMID:24718388

  8. Climate change on Twitter: topics, communities and conversations about the 2013 IPCC Working Group 1 report.

    Science.gov (United States)

    Pearce, Warren; Holmberg, Kim; Hellsten, Iina; Nerlich, Brigitte

    2014-01-01

    In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report.

  9. APS Editorial Q&A: APS and Open Access

    Science.gov (United States)

    2011-04-01

    The movement toward Open Access continues to gain momentum. A brief review of APS efforts in this area will be presented by APS Editor in Chief, Gene Sprouse. Editors from Physical Review C, D, Letters, and X, Physical Review Special Topics - Accelerators and Beams, Physical Review Special Topics - Physics Education Research, and Reviews of Modern Physics will address your questions about publishing in this evolving environment.

  10. Topical hepatic hypothermia plus ischemic preconditioning: analysis of bile flow and ischemic injuries after initial reperfusion in rats Hipotermia hepática tópica mais pré-condicionamento isquêmico: análise do fluxo biliar e danos isquêmicos após a reperfusão inicial em ratos

    Directory of Open Access Journals (Sweden)

    Tomaz de Jesus Maria Grezzana Filho

    2011-06-01

    Full Text Available PURPOSE: To evaluate the effects of the topical liver hypothermia and IPC combination against I/R injury after initial reperfusion. METHODS: In 32 Wistar rats, partial liver ischemia was induced for 90 minutes in normothermia (IN, ischemic preconditioning (IPC, 26ºC topical hypothermia (H and 26ºC topical hypothermia plus IPC (H+IPC. MAP, body temperature and bile flow were recorded each 15 minutes. Plasmatic injury markers and tissue antioxidant defenses were assessed after 120 minutes of reperfusion. RESULTS: MAP and body temperature remained constant during all experiment. Bile flow returned to levels similar to controls after 45 minutes of reperfusion in the H and H+IPC groups and increased significantly in comparison to the NI and IPC groups after 105 and 120 minutes. AST and ALT increased significantly in the normothermic groups in comparison to controls. TBARS levels decreased significantly in the H+IPC group in comparison to the other groups whereas Catalase levels increased significantly in the IPC group. SOD levels were significantly higher in the H group in comparison to all groups. CONCLUSION: The induction of 26ºC topical hypothermia associated or not to IPC protected the ischemic liver against ischemia/reperfusion injuries and allowed an early recovery of the hepatic function.OBJETIVO: Avaliar os efeitos da hipotermia hepática tópica combinada ao pré-condicionamento isquêmico na proteção dos danos iniciais de isquemia e reperfusão. MÉTODOS: Trinta e dois ratos Wistar foram submetidos à isquemia hepática parcial durante 90 minutos em Normotermia (IN, Pré-condicionamento Isquêmico (IPC, Hipotermia a 26ºC (H e Hipotermia a 26ºC mais PCI (H+PCI. A PAM, a temperatura corporal e o fluxo biliar foram aferidos em intervalos de 15 minutos. Marcadores plasmáticos de danos hepáticos e as defesas antioxidantes foram avaliados após 120 minutos de reperfusão. RESULTADOS: A PAM e a temperatura corporal permaneceram constantes

  11. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  12. [Qualitative research: the systematization of the generating topics and group technics].

    Science.gov (United States)

    Laganá, M T

    1989-04-01

    This study describes the systematization of generating themes into social representations, followed by group works with interventions that go through the stages of identification, domestication, relearning and performance redefinitions.

  13. TOPICAL REVIEW: Group theory and biomolecular conformation: I. Mathematical and computational models

    Science.gov (United States)

    Chirikjian, Gregory S.

    2010-08-01

    Biological macromolecules, and the complexes that they form, can be described in a variety of ways ranging from quantum mechanical and atomic chemical models, to coarser grained models of secondary structure and domains, to continuum models. At each of these levels, group theory can be used to describe both geometric symmetries and conformational motion. In this survey, a detailed account is provided of how group theory has been applied across computational structural biology to analyze the conformational shape and motion of macromolecules and complexes.

  14. Developing clinical practice guidelines: target audiences, identifying topics for guidelines, guideline group composition and functioning and conflicts of interest.

    Science.gov (United States)

    Eccles, Martin P; Grimshaw, Jeremy M; Shekelle, Paul; Schünemann, Holger J; Woolf, Steven

    2012-07-04

    Clinical practice guidelines are one of the foundations of efforts to improve health care. In 1999, we authored a paper about methods to develop guidelines. Since it was published, the methods of guideline development have progressed both in terms of methods and necessary procedures and the context for guideline development has changed with the emergence of guideline clearing houses and large scale guideline production organisations (such as the UK National Institute for Health and Clinical Excellence). It therefore seems timely to, in a series of three articles, update and extend our earlier paper. In this first paper we discuss: the target audience(s) for guidelines and their use of guidelines; identifying topics for guidelines; guideline group composition (including consumer involvement) and the processes by which guideline groups function and the important procedural issue of managing conflicts of interest in guideline development.

  15. Developing clinical practice guidelines: target audiences, identifying topics for guidelines, guideline group composition and functioning and conflicts of interest

    Directory of Open Access Journals (Sweden)

    Eccles Martin P

    2012-07-01

    Full Text Available Abstract Clinical practice guidelines are one of the foundations of efforts to improve health care. In 1999, we authored a paper about methods to develop guidelines. Since it was published, the methods of guideline development have progressed both in terms of methods and necessary procedures and the context for guideline development has changed with the emergence of guideline clearing houses and large scale guideline production organisations (such as the UK National Institute for Health and Clinical Excellence. It therefore seems timely to, in a series of three articles, update and extend our earlier paper. In this first paper we discuss: the target audience(s for guidelines and their use of guidelines; identifying topics for guidelines; guideline group composition (including consumer involvement and the processes by which guideline groups function and the important procedural issue of managing conflicts of interest in guideline development.

  16. Complement-mediated opsonization of invasive group A Streptococcus pyogenes strain AP53 is regulated by the bacterial two-component cluster of virulence responder/sensor (CovRS) system.

    Science.gov (United States)

    Agrahari, Garima; Liang, Zhong; Mayfield, Jeffrey A; Balsara, Rashna D; Ploplis, Victoria A; Castellino, Francis J

    2013-09-20

    Group A Streptococcus pyogenes (GAS) strain AP53 is a primary isolate from a patient with necrotizing fasciitis. These AP53 cells contain an inactivating mutation in the sensor component of the cluster of virulence (cov) responder (R)/sensor (S) two-component gene regulatory system (covRS), which enhances the virulence of the primary strain, AP53/covR(+)S(-). However, specific mechanisms by which the covRS system regulates the survival of GAS in humans are incomplete. Here, we show a key role for covRS in the regulation of opsonophagocytosis of AP53 by human neutrophils. AP53/covR(+)S(-) cells displayed potent binding of host complement inhibitors of C3 convertase, viz. Factor H (FH) and C4-binding protein (C4BP), which concomitantly led to minimal C3b deposition on AP53 cells, further showing that these plasma protein inhibitors are active on GAS cells. This resulted in weak killing of the bacteria by human neutrophils and a corresponding high death rate of mice after injection of these cells. After targeted allelic alteration of covS(-) to wild-type covS (covS(+)), a dramatic loss of FH and C4BP binding to the AP53/covR(+)S(+) cells was observed. This resulted in elevated C3b deposition on AP53/covR(+)S(+) cells, a high level of opsonophagocytosis by human neutrophils, and a very low death rate of mice infected with AP53/covR(+)S(+). We show that covRS is a critical transcriptional regulator of genes directing AP53 killing by neutrophils and regulates the levels of the receptors for FH and C4BP, which we identify as the products of the fba and enn genes, respectively.

  17. Matters of Gravity, The Newsletter of the Topical Group in Gravitation of the American Physical Society, Volume 31, Winter 2008

    CERN Document Server

    Garfinkle, David

    2008-01-01

    GGR News: GGR program at the APS meeting in St. Louis we hear that... by David Garfinkle 100 years ago, by David Garfinkle Research Briefs: The Torsion Pendulum's Contribution to Dark Energy, by Bill Hamilton Conference Reports: 10th Capra Meeting on Radiation Reaction, by Carlos Sopuerta Quantum Gravity in the Southern Cone IV, by Rafael A. Porto

  18. Hot Topics in Noninvasive Ventilation : Report of a Working Group at the International Symposium on Sleep-Disordered Breathing in Leuven, Belgium

    NARCIS (Netherlands)

    Vrijsen, Bart; Chatwin, Michelle; Contal, Oliver; Derom, Eric; Janssens, Jean-Paul; Kampelmacher, Mike J.; Muir, Jean-Francois; Pinto, Susana; Rabec, Claudio; Ramsay, Michelle; Randerath, Winfried J.; Storre, Jan H.; Wijkstra, Peter J.; Windisch, Wolfram; Testelmans, Dries

    2015-01-01

    During the last few decades, attention has increasingly focused on noninvasive ventilation (NIV) in the treatment of chronic respiratory failure. The University of Leuven and the University Hospitals Leuven therefore chose this topic for a 2-day working group session during their International Sympo

  19. Effects of a Topical Saffron (Crocus sativus L) Gel on Erectile Dysfunction in Diabetics: A Randomized, Parallel-Group, Double-Blind, Placebo-Controlled Trial.

    Science.gov (United States)

    Mohammadzadeh-Moghadam, Hossein; Nazari, Seyed Mohammad; Shamsa, Ali; Kamalinejad, Mohammad; Esmaeeli, Habibollah; Asadpour, Amir Abbas; Khajavi, Abdoljavad

    2015-10-01

    Erectile dysfunction is a man's persistent or recurrent inability to achieve and maintain erection for a satisfactory sexual relationship. As diabetes is a major risk factor for erectile dysfunction, the prevalence of erectile dysfunction among diabetic men has been reported as 35% to 90%. This randomized, parallel-group, double-blind, placebo-controlled trial investigated the effects of a topical saffron (Crocus sativus L) gel on erectile dysfunction in diabetic men. Patients were randomly allocated to 2 equal groups (with 25 patients each). The intervention group was treated with topical saffron, and the control received a similar treatment with placebo. The 2 groups were assessed using the International Index of Erectile Function Questionnaire before the intervention and 1 month after the intervention. Compared to placebo, the prepared saffron gel could significantly improve erectile dysfunction in diabetic patients (P saffron can be considered as a treatment option for diabetic men with erectile dysfunction.

  20. Alkali-soluble fluoride deposition on enamel after professional application of topical fluoride in vitro Formação de flúor fracamente ligado ao esmalte após a aplicação tópica profissional de flúor in vitro

    Directory of Open Access Journals (Sweden)

    Mitsue Fujimaki Hayacibara

    2004-03-01

    Full Text Available Since the efficacy of topical fluoride products is related to the fluoride (F availability and its reactivity with enamel, this study was conducted. The F concentration of the following materials was verified: I- acidulated phosphate fluoride (APF gel (1.23% F, II- APF foam (1.23% F and III- Varnish (2.26% F. Forty blocks of bovine enamel were divided into 4 groups and treated according to the materials described, being one of them used as control. Loosely bound fluoride (''CaF2'' was determined on enamel after extraction with 1.0M KOH and analyzed by ion-selective electrode. Total F concentration found in gel was 12,642, in foam 12,755 and in varnish 23,183 mg F/g. All products formed statistically higher amounts of ''CaF2'' on enamel compared to the control group (p 0.05. Thus, ''CaF2'' formation was not proportional to the total F content in the products, suggesting that the pH and the vehicle used are more important.Considerando que a eficácia dos produtos para aplicação tópica profissional de flúor (géis, espumas e vernizes está relacionada com a reatividade do flúor (F com o esmalte e sendo esta dependente da disponibilidade do F em cada produto, este estudo foi conduzido. A concentração de F nos seguintes produtos foi estudada: I - Flúor Fosfato Acidulado (FFA gel (1,23% F, II - FFA espuma (1,23% F e III- Verniz fluoretado (2,26% F. Foram confeccionados 40 blocos de esmalte bovino, tratados de acordo com os grupos descritos, sendo um deles utilizado como controle. O F fracamente ligado (''CaF2'' ao esmalte foi determinado após a extração com 1.0 M KOH e analisado em eletrodo específico. A concentração de F encontrada no gel foi de 12.642, na espuma 12.755 e no verniz 23.183 mg F/g. Todos os produtos formaram uma quantidade significantemente maior de ''CaF2'' na superfície do esmalte, comparado ao grupo controle (p 0,05. Assim, a formação de ''CaF2'' na superfície do esmalte não foi proporcional ao conteúdo de F nos

  1. Bimatoprost Topical

    Science.gov (United States)

    Topical bimatoprost is used to treat hypotrichosis (less than the normal amount of hair) of the eyelashes by promoting ... growth of longer, thicker, and darker lashes. Topical bimatoprost is in a class of medications called prostaglandin ...

  2. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  3. Grupo terapêutico para tabagistas: resultados após seguimento de dois anos Therapeutic group for smokers: results after two-year follow-up

    Directory of Open Access Journals (Sweden)

    Renata Cruz Soares de Azevedo

    2009-01-01

    Full Text Available OBJETIVO: Descrever os pacientes atendidos em ambulatório de tratamento de tabagistas em serviço universitário, resultados de tratamento imediatos e de seguimento de dois anos. MÉTODOS: Levantamento dos 171 tabagistas avaliados para tratamento no Grupo Terapêutico do Ambulatório de Substâncias Psicoativas do HC/UNICAMP. Avaliaram-se variáveis sociodemográficas, história do tabagismo, presença de comorbidades clínicas e sintomas psiquiátricos e desfecho inicial e tardio (mediana de 25 meses, por contato telefônico. Realizaram-se análises de frequência e, para identificar fatores associados, análise de regressão logística múltipla, com nível de significância de 5%. RESULTADOS: População com maioria de mulheres (73,4%, casada (48%, escolaridade fundamental (74,6%, trabalhando (57%, 65,2% começaram a fumar antes dos 15 anos, 63,8% tinham mais de 30 anos de tabagismo, 76% já tinham tentado parar de fumar, 46,2% com dependência grave, 72,1% apresentavam comorbidade clínica e 36% sintomas psiquiátricos; 51% procuraram espontaneamente o serviço, principalmente por preocupação com a saúde. Com relação à cessação do tabagismo, 79,1% pararam de fumar durante o tratamento; após 25 meses, 62% continuavam sem fumar. A variável associada a não-cessação foi presença de sintomas psiquiátricos. As variáveis relacionadas à recaída foram sintomas psiquiátricos e menor número de sessões no Grupo de Motivação. Houve associação entre comorbidade clínica e tempo de tabagismo e inatividade profissional. CONCLUSÃO: Este estudo reforça a importância do reconhecimento das características da clientela atendida para avaliação das estratégias empregadas e adequação das propostas de tratamento para tabagistas visando melhora das taxas de cessação e redução dos índices de recaída.OBJECTIVE: To evaluate the smokers' profile, immediate results and outcome after 25 months of treatment at a university public

  4. Selective traditions in group discussions: teachers' views about good science and the possible obstacles when encountering a new topic

    Science.gov (United States)

    Lundqvist, Eva; Sund, Per

    2016-11-01

    There is an ongoing discussion about what content that should be taught in science education and there are different views among teachers about what represent good science content. However, teachers are not isolated individuals making their own interpretations, but are part of institutionalised systems building on patterns in the selection of teaching goals and content. Earlier research shows that teachers teach in alignment with different selective traditions, which can be understood as well-developed teaching habits. Individual teachers seem to develop their personal habits on the basis of the contextual situations created by earlier generations of teachers. In order to find out which content teachers find representative for science education, we asked nine teachers to take part in group interviews to talk about what they value as "good" science content. The participants were grouped according to their selective traditions expressed in earlier studies. The method was used to dynamically explore, challenge and highlight teachers' views. The starting point for the group discussions is national tests in science. In Sweden, national tests in biology, physics and chemistry were introduced in secondary school science (year 9) in 2009. One overarching aim of these tests is to support the implementation of the science curricula and to include for example knowledge about socio-scientific issues (SSI). The content of the tests can consequently be seen as important for teachers to consider. The findings show that `resistance' to including SSI is not just an issue for individual teachers. As individuals teachers can create many kinds of obstacles, but still be interested in integrating SSI in their science teaching. However, in group discussions the teachers tend to collectively adopt the scientific rational discourse. This discourse is what joins them and creates their common identity as science teachers. In turn, they seek to free scientific knowledge from social knowledge

  5. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    Energy Technology Data Exchange (ETDEWEB)

    Demetri, K. J.; Leipner, C. I.; Marshall, M. L., E-mail: demetrkj@westinghouse.com [Westinghouse Electric Company, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2015-09-15

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  6. Comparative study in swines' vocal cords healing after excision of fragment with CO2 laser with mitomycin and 5-fluorouracil postoperative topical application Estudo comparado da cicatrização da prega vocal de suínos após exérese de fragmento com laser de CO2 e aplicação tópica pós-operatória de mitomicina e 5-fluorouracil

    Directory of Open Access Journals (Sweden)

    Eduardo Baptistella

    2009-02-01

    Full Text Available PURPOSE: To evaluate the deposition of collagen fibers at pig's vocal folds after topical use of mitomycin or 5-fluorouracil, when partial exeresis of mucosa layer had been promoted by CO2 laser. METHODS: There were used 18 Larger white pigs which were anesthetized and submitted to mucosa fragment's exeresis, bilaterally, at its free border. The animals were divided into 3 groups, each one with 6 animals: control group, without topical drug application; mitomycin group; and 5-fluorouracil group. After 30 days, the animals were subjected to euthanasia, and samples of the vocal folds were collected and stained by picrosirius red technique with polarization for quantification of total collagen deposition. RESULTS: In control group, the mean rate of right vocal fold's collagen deposition at submucosa consisted in a 3428.66 micrometers area. There was found an area whose size had, in average, 2196.36 micrometers, in mitomycin group, and 2269.19 micrometers, in 5-fluorouracil group. CONCLUSION: Mitomycin and 5-fluorouracil had promoted beneficial change in vocal fold's cicatrization with less collagen deposition, but there was no significant statistically difference when they were compared between themselves.OBJETIVO: Avaliar a deposição das fibras de colágeno total em pregas vocais suínas após o uso tópico de mitomicina ou 5-fluorouracil nas exéreses parciais de mucosa com laser de CO2. MÉTODOS: Foram utilizados 18 porcos da raça Larger white anestesiados e submetidos à exérese de fragmento de mucosa de borda livre da prega vocal direita e prega vocal esquerda. Os animais foram divididos em 3 grupos com 6 animais cada: grupo controle, sem aplicação de medicação tópica; grupo mitomicina, com uso tópico dessa substância; grupo 5-fluorouracil, uso tópico. Após 30 dias do experimento os animais foram submetidos à eutanásia, coletadas amostras das pregas vocais e coradas pela técnica do picrosirius red com polarização para a

  7. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  8. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  9. Current topics in red cell biology: report on the Red Cell Special Interest Group meeting held at NHS Blood and Transplant Bristol on 30 October 2015.

    Science.gov (United States)

    Bullock, T; Bruce, L J; Ridgwell, K

    2016-08-01

    The Red Cell Special Interest Group (SIG) meeting, hosted by the British Blood Transfusion Society, provides an annual forum for the presentation of UK- and European-based red cell research. The 2015 meeting was held on Friday 30 October at the National Health Service Blood & Transplant (NHSBT) facility in Filton, Bristol and provided an exciting and varied programme on the themes of erythropoiesis, malaria biology and pathophysiology and red cells properties in stress and disease. Ten speakers presented on these topics over the course of one day. The meeting was well attended by over 90 delegates. Posters were presented during the lunch break, and abstracts from the posters are published at the end of this issue.

  10. APS and Open Access

    Science.gov (United States)

    2011-03-01

    The movement toward Open Access continues to gain momentum. A brief review of APS efforts in this area will be presented by APS Editor in Chief, Gene Sprouse. Editors from Physical Review A, B, E, Focus, Letters, and X, Reviews of Modern Physics, and Physics will address your questions about publishing in this evolving environment.

  11. HEAD - TO - HEAD COMPARISON OF TOLERABILITY AND ACCEPTABILITY OF SINGLE DOSE OF FOUR TOPICAL NSAIDS IN PATIENTS UNDERGOING CATARACT SURGERY : A RANDOMIZED OPEN LABEL PARALLEL GROUP STUDY

    Directory of Open Access Journals (Sweden)

    Chandra Sekhar

    2015-07-01

    Full Text Available INTRODUCTION : Ophthalmic NSAIDs are used to control pain , discomfort and inflammation associated with ocular conditions and also , following ophthalmic cataract surgeries. These drugs can cause ocular discomfort following administration which lasts for a short duration. However , there exist differences in the intensity and duration of burning sensation among the c ommonly used ophthalmic NSAIDs. Hence , we evaluated the tolerability and acceptability of four topical NSAIDS i.e. , 0.3% nepafenac (N , 0.5% ketorolac (K , 0.4% ketorolac (K LS and 0.09% bromfenac (B after instilling a single drop. METHODS: This randomized , open label , parallel group study was conducted in the department of Ophthalmology in Narayana Medical College , Nellore. A total number of 80 patients participated in the study. Randomization list was computer generated in a ratio of 1:1:1:1 of N , K , K L Sand B. Each patient received one drop of the study drug either in right or left eye which was also decidedat random.Patients of either gender above21 years of age , having no ocular surface pathology and eligible for cataract surgery were include d in the study. Outcome variables included ocular burning intensity on VAS (0 - 100 mm at 0 min (immediately , 2 min and 6 min after administration of medications , time to complete pain relief and global medication performance rated by patient as 0 (bad , 1 (fair , 2(good or 3 (severe . RESULTS: The mean age of patients was 52.85±17.46 years. All groups were age matched , however there were more females than males (pN>K LS >K on global medication performance. CONCLUSION: Bromfenac had better tolerability and acceptability as compared to other tested topical NSAIDs , which was in the order of B>N> K LS >K.

  12. Clindamycin Topical

    Science.gov (United States)

    ... topical clindamycin.you should know that abrasive or medicated soaps and skin products that contain alcohol may ... in, tightly closed, and out of reach of children. Store it at room temperature and away from ...

  13. Tretinoin Topical

    Science.gov (United States)

    ... lotions, astringents, and perfumes); they can sting your skin, especially when you first use tretinoin.Do not use any other topical medications, especially benzoyl peroxide, salicylic acid (wart remover), and dandruff shampoos containing sulfur or ...

  14. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  15. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  16. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  17. Topical anesthesia

    Directory of Open Access Journals (Sweden)

    Mritunjay Kumar

    2015-01-01

    Full Text Available Topical anesthetics are being widely used in numerous medical and surgical sub-specialties such as anesthesia, ophthalmology, otorhinolaryngology, dentistry, urology, and aesthetic surgery. They cause superficial loss of pain sensation after direct application. Their delivery and effectiveness can be enhanced by using free bases; by increasing the drug concentration, lowering the melting point; by using physical and chemical permeation enhancers and lipid delivery vesicles. Various topical anesthetic agents available for use are eutectic mixture of local anesthetics, ELA-max, lidocaine, epinephrine, tetracaine, bupivanor, 4% tetracaine, benzocaine, proparacaine, Betacaine-LA, topicaine, lidoderm, S-caine patch™ and local anesthetic peel. While using them, careful attention must be paid to their pharmacology, area and duration of application, age and weight of the patients and possible side-effects.

  18. Angiogenesis, fibrinogenesis and presence of synechiae after exeresis of a swine vocal fold mucosal microflap and use of topical mitomycin-C Estudo da angiogênese, fibrogênese e presença de sinéquias após exérese de fragmento de mucosa de pregas vocais de suínos utilizando instrumental frio e mitomicina-C tópica

    Directory of Open Access Journals (Sweden)

    Vinicius Ribas de Carvalho Duarte Fonseca

    2010-02-01

    Full Text Available PURPOSE: To evaluate swine vocal fold healing in a period of 30 days after topical mitomycin-C application. METHODS: Twelve swine underwent exeresis of mucosal flaps from the free edge of the anterior third of both vocal folds with a cold instrument (laryngeal scissors. The animals were divided into two groups: EG (Experimental Group, consisting of 6 animals undergoing topical MMC application (4 mg/dL on the operated area for 4 minutes; CG (Control Group, 6 animals undergoing topical saline solution application on the operated area for 4 minutes. After 30 days, the animals were sacrificed and the larynges were collected and examined for the presence of synechiae as well as a histological immunohistochemical assessment of immature and mature collagen deposition, number of blood vessels and myofibroblasts. RESULTS: Mature collagen deposition in the EG was 452.12 μm² and 1332.31μm² in the CG; immature collagen deposition was 1511.73μm² in the EG and 1020.61μm² in the CG. The number of myofibroblasts was 1.556 in the EG and 3.583 in the CG. The number of blood vessels was 2.565 in EG and 6.917 in the CG. There were no synechiae in the two studied groups. CONCLUSIONS: There was an increase in immature collagen deposition in the experimental group when compared with the control group. There was a decrease in mature collagen deposition in the experimental group when compared with the control group. There was a decrease in the number of myofibroblasts in the experimental group when compared with the control group. A decrease in blood vessels was observed in the experimental group when compared with the control group. There was no synechia formation in either studied group.OBJETIVO: Avaliar a cicatrização de pregas vocais de suínos utilizando mitomicina-C tópica, em 30 dias. MÉTODOS: Doze suínos foram submetidos à exérese de mucosa do bordo livre do terço anterior de ambas as pregas vocais com instrumental frio (tesoura curva e divididos

  19. Comparative efficacy of oral rifampin and topical chloramphenicol in eradicating conjunctival carriage of Haemophilus influenzae biogroup aegyptius. Brazilian Purpuric Fever Study Group.

    Science.gov (United States)

    Perkins, B A; Tondella, M L; Bortolotto, I M; Takano, O A; da Silva, G A; Irino, K; Brandileone, M C; Harrison, L H; Wenger, J D; Broome, C V

    1992-09-01

    Persistent conjunctival carriage of the Haemophilus influenzae biogroup aegyptius (Hae) strain (BPF clone) responsible for Brazilian purpuric fever (BPF) has been documented. Topical chloramphenicol is routinely used to treat conjunctivitis in areas affected by BPF in Brazil. Although the BPF clone is susceptible to chloramphenicol, we observed a number of children treated with topical chloramphenicol for conjunctivitis who still developed BPF. During an investigation of an outbreak of BPF in Mato Grosso State, Brazil, we compared oral rifampin (20 mg/kg/day for 4 days) with topical chloramphenicol for eradication of conjunctival carriage of H. influenzae biogroup aegyptius among children with presumed BPF clone conjunctivitis. Conjunctival samples were taken for culture on the day treatment was initiated and a mean of 8 and 21 days later. At 8 days the eradication rates for oral rifampin and topical chloramphenicol were 100 and 44%, respectively (P = 0.003); at 21 days they were 100 and 50% (P = 0.01). Oral rifampin was more effective than topical chloramphenicol for eradication of the BPF clone and may be useful in prevention of BPF.

  20. GeoDCAT-AP: Use cases and open issues

    OpenAIRE

    PEREGO ANDREA; FRIIS-CHRISTENSEN Anders; Lutz, Michael

    2016-01-01

    This paper illustrates some issues and use cases identified during the design and implementation of GeoDCAT-AP, a metadata profile aiming to provide a representation of geospatial metadata compliant with the DCAT application profile for European data portals (DCAT-AP). In particular, the paper focuses on those issues that may have a possible relevance also outside the geospatial domain, covering topics concerning metadata profile-based negotiation, publishing metadata on the Web, represen...

  1. Mathematics Teaching from a Constructivist Point of View. Proceedings of Topic Group 6 at the International Congress on Mathematical Education (8th, Seville, Spain, July 14-21, 1996). Faculty of Education Report No. 3.

    Science.gov (United States)

    Bjorkqvist, Ole, Ed.

    The nationalities of the authors reflect the purpose of the Topic Group, to give an overview of international research on mathematics teaching within a constructivist framework as of 1996. The studies are theoretical as well as empirical, and show a variety of research interests. There is, however, evidence for an emphasis on social aspects within…

  2. Topics for Mathematics Clubs.

    Science.gov (United States)

    Dalton, LeRoy C., Ed.; Snyder, Henry D., Ed.

    The ten chapters in this booklet cover topics not ordinarily discussed in the classroom: Fibonacci sequences, projective geometry, groups, infinity and transfinite numbers, Pascal's Triangle, topology, experiments with natural numbers, non-Euclidean geometries, Boolean algebras, and the imaginary and the infinite in geometry. Each chapter is…

  3. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  4. Preface: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik; Buttler, William; Furlanetto, Michael; Evans, William

    2014-05-01

    The 18th Biennial International Conference of the APS Topical Group on Shock Compression of Condensed Matter in conjunction with the 24th Biennial International Conference of the International Association for the Advancement of High Pressure Science & Technology (AIRAPT) was held at the Westin Hotel in Seattle, Washington from 7-12 July, 2013. This is only the second time that these two organizations have held a Joint Conference — the first was 20 years previous (1993) in Colorado Springs, Colorado. Seattle was chosen for this joint conference because of its central location for the world-wide attendees as well as its metropolitan vibrancy. The scientific program consisted of 858 scheduled presentations organized into 23 topical areas and included contributed (537), invited (95), and plenary (6) lectures, as well as two poster sessions with 110 posters each. The scientific focus of the Joint Conference was on fundamental and applied research topics related to the static or dynamic compression of condensed matter. This multidisciplinary field of research encompasses areas of physics, chemistry, materials science, mechanics, geophysics and planetary physics, and applied mathematics. Experimental, computational and theoretical studies all play important roles. The organizers endeavored to intertwine static and dynamic experimental alongside computational and theoretical studies of similar materials in the organization of the sessions. This goal was aided by the addition of three special focus sessions on deep carbon budget, high energy density materials, and dynamic response of materials. 722 scientists and engineers from 25 countries registered at the conference, including 132 students from 12 countries. The attendee countries represented included: Argentina (2), Australia (2), Brazil (3), Canada (25), China (22), Czech Republic (2), France (35), Germany (19), India (6), Israel (21), Italy (10), Japan (49), Netherlands (1), Poland (1), Portugal (2), Russia (26

  5. Thermodynamics of Damaged DNA Binding and Catalysis by Human AP Endonuclease 1.

    Science.gov (United States)

    Miroshnikova, A D; Kuznetsova, A A; Kuznetsov, N A; Fedorova, O S

    2016-01-01

    Apurinic/apyrimidinic (AP) endonucleases play an important role in DNA repair and initiation of AP site elimination. One of the most topical problems in the field of DNA repair is to understand the mechanism of the enzymatic process involving the human enzyme APE1 that provides recognition of AP sites and efficient cleavage of the 5'-phosphodiester bond. In this study, a thermodynamic analysis of the interaction between APE1 and a DNA substrate containing a stable AP site analog lacking the C1' hydroxyl group (F site) was performed. Based on stopped-flow kinetic data at different temperatures, the steps of DNA binding, catalysis, and DNA product release were characterized. The changes in the standard Gibbs energy, enthalpy, and entropy of sequential specific steps of the repair process were determined. The thermodynamic analysis of the data suggests that the initial step of the DNA substrate binding includes formation of non-specific contacts between the enzyme binding surface and DNA, as well as insertion of the amino acid residues Arg177 and Met270 into the duplex, which results in the removal of "crystalline" water molecules from DNA grooves. The second binding step involves the F site flipping-out process and formation of specific contacts between the enzyme active site and the everted 5'-phosphate-2'-deoxyribose residue. It was shown that non-specific interactions between the binding surfaces of the enzyme and DNA provide the main contribution into the thermodynamic parameters of the DNA product release step.

  6. The APS ceramic chambers

    Energy Technology Data Exchange (ETDEWEB)

    Milton, S.; Warner, D.

    1994-07-01

    Ceramics chambers are used in the Advanced Photon Source (APS) machines at the locations of the pulsed kicker and bumper magnets. The ceramic will be coated internally with a resistive paste. The resistance is chosen to allow the low frequency pulsed magnet field to penetrate but not the high frequency components of the circulating beam. Another design goal was to keep the power density experienced by the resistive coating to a minimum. These ceramics, their associated hardware, the coating process, and our recent experiences with them are described.

  7. Two Successful Approaches to Teaching AP Government

    Science.gov (United States)

    Ladd, Brian; Stepp, Heidi

    2013-01-01

    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  8. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine

    2013-01-01

    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  9. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  10. Safety and Health Topics: Asbestos

    Science.gov (United States)

    ... Videos E-Tools Safety and Health Topics / Asbestos Asbestos This page requires that javascript be enabled for ... Hazards and Toxic Substances Hazardous Waste What is asbestos? Asbestos is the name given to a group ...

  11. Do scientists trace hot topics?

    Science.gov (United States)

    Wei, Tian; Li, Menghui; Wu, Chensheng; Yan, Xiao-Yong; Fan, Ying; Di, Zengru; Wu, Jinshan

    2013-01-01

    Do scientists follow hot topics in their scientific investigations? In this paper, by performing analysis to papers published in the American Physical Society (APS) Physical Review journals, it is found that papers are more likely to be attracted by hot fields, where the hotness of a field is measured by the number of papers belonging to the field. This indicates that scientists generally do follow hot topics. However, there are qualitative differences among scientists from various countries, among research works regarding different number of authors, different number of affiliations and different number of references. These observations could be valuable for policy makers when deciding research funding and also for individual researchers when searching for scientific projects.

  12. AP physics B crash course

    CERN Document Server

    Howell, Rebecca

    2012-01-01

    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  13. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  14. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  15. AP1000进度管理研究%The study on AP1000 Schedule management

    Institute of Scientific and Technical Information of China (English)

    李阳; 王飞鸣

    2015-01-01

    核电建设进度管理非常重要,本文针对核电站进度管理的内容、体系、管理方式等进行介绍,并结合AP1000核电技术的特点——模块化,分析其对进度管理的影响和目前存在的问题。并结合影响和问题提出了在后续AP1000建设进度管理中的几项建议。%Nuclear power plant construction progress management is very important. This paper addresses important topics including the content, system and manage methods of nuclear power plants construction. Combining the characteristics of AP1000 nuclear power technology-modular, the paper analyzed its impact on progress management and the existing problems. Depending on the impacts and problems, the paper also raised several suggestions in AP1000 modular construction.

  16. An AP4B1 frameshift mutation in siblings with intellectual disability and spastic tetraplegia further delineates the AP-4 deficiency syndrome.

    Science.gov (United States)

    Abdollahpour, Hengameh; Alawi, Malik; Kortüm, Fanny; Beckstette, Michael; Seemanova, Eva; Komárek, Vladimír; Rosenberger, Georg; Kutsche, Kerstin

    2015-02-01

    The recently proposed adaptor protein 4 (AP-4) deficiency syndrome comprises a group of congenital neurological disorders characterized by severe intellectual disability (ID), delayed or absent speech, hereditary spastic paraplegia, and growth retardation. AP-4 is a heterotetrameric protein complex with important functions in vesicle trafficking. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been reported in patients with the AP-4 deficiency phenotype. We describe two siblings from a non-consanguineous couple who presented with severe ID, absent speech, microcephaly, growth retardation, and progressive spastic tetraplegia. Whole-exome sequencing in the two patients identified the novel homozygous 2-bp deletion c.1160_1161delCA (p.(Thr387Argfs*30)) in AP4B1. Sanger sequencing confirmed the mutation in the siblings and revealed it in the heterozygous state in both parents. The AP4B1-associated phenotype has previously been assigned to spastic paraplegia-47. Identification of a novel AP4B1 alteration in two patients with clinical manifestations highly similar to other individuals with mutations affecting one of the four AP-4 subunits further supports the observation that loss of AP-4 assembly or functionality underlies the common clinical features in these patients and underscores the existence of the clinically recognizable AP-4 deficiency syndrome.

  17. Randomized, parallel-group, double-blind, controlled study to evaluate the efficacy and safety of carbohydrate-derived fulvic acid in topical treatment of eczema

    Directory of Open Access Journals (Sweden)

    Gandy JJ

    2011-09-01

    Full Text Available Justin J Gandy, Jacques R Snyman, Constance EJ van RensburgDepartment of Pharmacology, Faculty of Health Sciences, University of Pretoria, Pretoria, South AfricaBackground: The purpose of this study was to evaluate the efficacy and safety of carbohydrate-derived fulvic acid (CHD-FA in the treatment of eczema in patients two years and older.Methods: In this single-center, double-blind, placebo-controlled, parallel-group comparative study, 36 volunteers with predetermined eczema were randomly assigned to receive either the study drug or placebo twice daily for four weeks.Results: All safety parameters remained within normal limits, with no significant differences in either group. Significant differences were observed for both severity and erythema in the placebo and CHD-FA treated groups, and a significant difference was observed for scaling in the placebo-treated group. With regard to the investigator assessment of global response to treatment, a significant improvement was observed in the CHD-FA group when compared with the placebo group. A statistically significant decrease in visual analog scale score was observed in both groups, when comparing the baseline with the final results.Conclusion: CHD-FA was well tolerated, with no difference in reported side effects other than a short-lived burning sensation on application. CHD-FA significantly improved some aspects of eczema. Investigator assessment of global response to treatment with CHD-FA was significantly better than that with emollient therapy alone. The results of this small exploratory study suggest that CHD-FA warrants further investigation in the treatment of eczema.Keywords: fulvic acid, eczema, anti-inflammatory, efficacy, safety

  18. Learning about Antiphospholipid Syndrome (APS)

    Science.gov (United States)

    ... other autoimmune disorders, including myasthenia gravis, Graves' disease, autoimmune hemolytic anemia, and Evan's syndrome. Top of page How is APS diagnosed? A diagnosis of APS is made based on both clinical and ... Autoimmune Related Diseases Association, Inc. [aarda.org] An organization ...

  19. Enfrentamento da violência doméstica por um grupo de mulheres após a denúncia A group of women coping with domestic violence after the denouncements

    Directory of Open Access Journals (Sweden)

    Eriza de Oliveira Parente

    2009-08-01

    Full Text Available Este estudo analisa as formas de enfrentamento encontradas por mulheres vítimas da violência doméstica, no decorrer e após a denúncia, em Fortaleza, Ceará, Brasil. Com abordagem qualitativa e caracterizando-se como pesquisa participante, nove mulheres, que se denominaram vítimas de violência doméstica e romperam com o silêncio fazendo a denúncia, participaram do estudo, de agosto a outubro de 2007, no Centro Estadual de Referência e Apoio à Mulher (CERAM. Grupo focal, anotações no diário de campo e observações foram as técnicas de coleta de dados, e estes foram submetidos à análise categorial e discutidos com suporte no Modelo de Crenças em Saúde. O medo, a falta de apoio, a dependência financeira, a vergonha, a maternidade e a cultura emergiram do estudo como percepção da suscetibilidade e das barreiras identificadas; o risco de morte foi percebido como severidade; o apoio da família e de amigos, a lei, os setores de proteção e Deus foram os benefícios relatados, configurando-se como formas de enfrentamento. Para elas, a violência ultrapassou os limites da natureza física, pois envolveu sofrimento psicológico, emocional, econômico e social. Desse modo, essas mulheres romperam o silêncio presente nas relações violentas e procuraram estratégias para minimizar o sofrimento.This paper provides an analysis of confrontation ways that female victims of domestic violence found during and after denunciation in Fortaleza, Ceará, Brazil. Nine women self-denominated victims of violence who broke silence and denunciated their aggressors participated in this qualitative and participative research from August to October 2007, in the State Center of Reference for Women Support (CERAM. The data collectors used the focal group, the reports in the field diary and observation, and the data were submitted to categorical analysis, and discussed based on Health Belief Model. Fear, lack of support, financial dependence, shame

  20. Topics in field theory

    CERN Document Server

    Karpilovsky, G

    1989-01-01

    This monograph gives a systematic account of certain important topics pertaining to field theory, including the central ideas, basic results and fundamental methods.Avoiding excessive technical detail, the book is intended for the student who has completed the equivalent of a standard first-year graduate algebra course. Thus it is assumed that the reader is familiar with basic ring-theoretic and group-theoretic concepts. A chapter on algebraic preliminaries is included, as well as a fairly large bibliography of works which are either directly relevant to the text or offer supplementary material of interest.

  1. Credibility improves topical blog post retrieval

    NARCIS (Netherlands)

    Weerkamp, W.; de Rijke, M.

    2008-01-01

    Topical blog post retrieval is the task of ranking blog posts with respect to their relevance for a given topic. To improve topical blog post retrieval we incorporate textual credibility indicators in the retrieval process. We consider two groups of indicators: post level (determined using informati

  2. Topics in orbit equivalence

    CERN Document Server

    Kechris, Alexander S

    2004-01-01

    This volume provides a self-contained introduction to some topics in orbit equivalence theory, a branch of ergodic theory. The first two chapters focus on hyperfiniteness and amenability. Included here are proofs of Dye's theorem that probability measure-preserving, ergodic actions of the integers are orbit equivalent and of the theorem of Connes-Feldman-Weiss identifying amenability and hyperfiniteness for non-singular equivalence relations. The presentation here is often influenced by descriptive set theory, and Borel and generic analogs of various results are discussed. The final chapter is a detailed account of Gaboriau's recent results on the theory of costs for equivalence relations and groups and its applications to proving rigidity theorems for actions of free groups.

  3. Topical report review status

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-08-01

    This report provides industry with procedures for submitting topical reports, guidance on how the U.S. Nuclear Regulatory Commission (NRC) processes and responds to topical report submittals, and an accounting, with review schedules, of all topical reports currently accepted for review schedules, of all topical reports currently accepted for review by the NRC. This report will be published annually. Each sponsoring organization with one or more topical reports accepted for review copies.

  4. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (I): catastrophic APS, APS nephropathy and heart valve lesions.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyse the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analysed on the catastrophic APS, APS nephropathy and heart valve lesions, and presents the recommendations elaborated by the Task Force after this analysis.

  5. [Apheresis in antiphospholipid syndrome (APS)].

    Science.gov (United States)

    De Silvestro, Giustina; Tison, Tiziana; Marson, Piero

    2012-01-01

    Antiphospholipid syndrome (APS) is a rare clinical disorder characterized by thromboembolic manifestations and/or obstetric complications. Along with the clinical symptoms and signs, serum antiphospholipid antibodies have to be detected. APS can be primary, i.e., without any concomitant disorders, or secondary to other autoimmune diseases, particularly systemic lupus erythematosus. Criteria for the diagnosis of APS have been clearly established. Hyperacute APS (or catastrophic antiphospholipid syndrome), often with a poor prognosis, must meet four criteria: involvement of three or more organs, rapid evolution of clinical manifestations, microangiopathic occlusion of small blood vessels at biopsy, and presence of antiphospholipid antibodies. The rationale for apheresis treatment is the removal of pathogenetic antibodies involved in the development of tissue damage. Our experience includes 23 patients, in particular 15 women treated for 19 pregnancies. According to the National Guidelines Program, the effectiveness of apheresis in catastrophic syndrome has a level of evidence of V/VI, with a strength of recommendation A; in highrisk pregnancy it has a level of evidence of V with a strength of recommendation B. It will be necessary to better define the prognosis of various categories of pregnant patients with APS, as well as useful laboratory parameters to monitor its clinical course and anticipate any complications of pregnancy.

  6. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  7. Foreword: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik

    2014-05-01

    This second joint conference between the APS Topical Group on Shock Compression of Condensed Matter and the International Association for the Advancement of High Pressure Science and Technology (AIRAPT) demonstrates that static and dynamic compression of condensed matter continues to be a vibrant field of science and engineering. It is also by its nature an interdisciplinary field, incorporating chemistry, materials science, solid mechanics, plasma physics, and condensed matter physics, and utilizes theoretical, computational, and experimental tools. Recent years have brought about many advances in loading platforms, diagnostics, and computations that are leading to the emergence of many new avenues of research. These advances are also breathing new life into traditional topics such as equations of state, phase transformations, and chemistry at extreme conditions. The plenary lectures by Gennady Kanel, Karl Syassen, David Ceperley, Jon Eggert, Duck Young Kim, and Richard Kraus spanned the disciplines of static and dynamic high pressure physics and illustrated the breadth of the field. They also showed that interesting and important problems remain for researchers of the future to solve. The main guiding principal in the organization of this conference was to intertwine static and dynamical experimental alongside computational and theoretical studies of similar materials. To achieve this goal, we arranged the conference to include static, dynamic, and computational components in the same sessions, quite often taking presenters out of their comfort zone. The three special sessions on Deep Carbon Budget (organized by Giulia Galli and Rus Hemley), High Energy Density Materials (organized by Raymond Jeanloz and Jon Eggert), and Dynamic Response of Materials (organized by Yogendra Gupta and John Sarrao) furthered this guiding principal. We also endeavored to represent the breadth of static and dynamic high pressure science and technology, notably beyond that done at

  8. Diclofenac Topical (osteoarthritis pain)

    Science.gov (United States)

    Diclofenac topical gel (Voltaren) is used to relieve pain from osteoarthritis (arthritis caused by a breakdown of the ... the knees, ankles, feet, elbows, wrists, and hands. Diclofenac topical liquid (Pennsaid) is used to relieve osteoarthritis pain ...

  9. Syntacticized topics in Kurmuk

    DEFF Research Database (Denmark)

    Andersen, Torben

    2015-01-01

    This article argues that Kurmuk, a little-described Western Nilotic language, is characterized by a syntacticized topic whose grammatical relation is variable. In this language, declarative clauses have as topic an obligatory preverbal NP which is either a subject, an object or an adjunct....... The grammatical relation of the topic is expressed by a voice-like inflection of the verb, here called orientation. While subject-orientation is morphologically unmarked, object-oriented and adjunct-oriented verbs are marked by a subject suffix or by a suffix indicating that the topic is not subject, and adjunct......-orientation differs from object-orientation by a marked tone pattern. Topic choice largely reflects information structure by indicating topic continuity. The topic also plays a crucial role in relative clauses and in clauses with contrastive constituent focus, in that objects and adjuncts can only be relativized...

  10. FRANX. Application for analysis and quantification of the APS fire; FRANK. Aplicacion para el analisis y cuantificacion de los APS de incendios

    Energy Technology Data Exchange (ETDEWEB)

    Snchez, A.; Osorio, F.; Ontoso, N.

    2014-07-01

    The FRANX application has been developed by EPRI within the Risk and Reliability User Group in order to facilitate the process of quantification and updating APS Fire (also covers floods and earthquakes). By applying fire scenarios are quantified in the central integrating the tasks performed during the APS fire. This paper describes the main features of the program to allow quantification of an APS Fire. (Author)

  11. Women's Health Topics

    Science.gov (United States)

    ... Health Diabetes Healthy Aging Heart Health Mammograms Caregiving Menopause Pregnancy Safe Medication Use Other Topics like cosmetics and nutrition Other Resources womenshealth.gov Federal Citizen Information Center ...

  12. [Topical therapy of rosacea].

    Science.gov (United States)

    Schöfer, H

    2013-07-01

    Metronidazole and azelaic acid are the only topical medications approved for rosacea. All other topical treatments for rosacea and its special forms are used off-label. Topical steroids are not indicated in rosacea, because of their side effects (induction of steroid rosacea, high risk of facial skin atrophy, and high risk of rebound after cessation of therapy). Topical as well as systemic steroids are allowed only as initial and short term therapy for acute forms of rosacea (e.g. rosacea fulminans). Papular and pustular rosacea is the major indication for topical therapy. Sebaceous gland and connective tissue hyperplasia in glandular-hypertrophic rosacea as well as erythema in erythematous rosacea do not respond well to topical measures. A new active substance, the alpha-2-adrenoreceptor agonist brimonidine, will be approved soon for the topical treatment of erythema in rosacea. All severe forms of rosacea should initially be treated with a combination of topical and systemic agents. After improvement of the clinical symptoms, topical treatment alone is usually adequate to maintain the control.

  13. Panel Discussion : Report of the APS Ad-Hoc Committee on LGBT Issues

    Science.gov (United States)

    Atherton, Tim; Barthelemy, Ramon; Garmon, Savannah; Reeves, Kyle; APS Ad-Hoc Committee on LGBT Issues Team

    Following the presentation of the findings and recommendations of the APS Ad-Hoc Committee on LGBT Issues (C-LGBT) by Committee Chair Michael Falk, a panel discussion will be held featuring several members of the committee. The discussion will focus on how APS can best ensure the recommendations of the committee are carried out in a timely fashion and other ideas on future APS efforts toward LGBT inclusion in physics. Discussion topics will also include the research and other input that shaped the committee's findings and recommendations.

  14. Topic Identification in Discourse

    CERN Document Server

    Chen, K

    1995-01-01

    This paper proposes a corpus-based language model for topic identification. We analyze the association of noun-noun and noun-verb pairs in LOB Corpus. The word association norms are based on three factors: 1) word importance, 2) pair co-occurrence, and 3) distance. They are trained on the paragraph and sentence levels for noun-noun and noun-verb pairs, respectively. Under the topic coherence postulation, the nouns that have the strongest connectivities with the other nouns and verbs in the discourse form the preferred topic set. The collocational semantics then is used to identify the topics from paragraphs and to discuss the topic shift phenomenon among paragraphs.

  15. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  16. PREFACE: CEWQO Topical Issue CEWQO Topical Issue

    Science.gov (United States)

    Bozic, Mirjana; Man'ko, Margarita

    2009-09-01

    Sascha Wallentowitz), 2004 (Trieste, Italy, by Naseem Rahman and Sascha Wallentowitz), 2005 (Bilkent, Ankara, by Alexander Shumovsky), 2006 (Vienna, by Helmut Rauch), 2007 (Palermo, Italy, by Antonino Messina) and 2008 (Belgrade, by Mirjana Bozic). The CEWQO series developed in two directions following the rapid development of quantum optics and the transitional development of the scientific collaboration of Central European researchers with researchers from old and new emerging Central European countries, and from all over the world. The topics discussed at CEWQO 08 were divided into ten groups that aimed to cover the broad scope of modern quantum optics: Fundamental aspects of quantum optics and quantum mechanics Single photons and photon pairs Cavity and circuit QED Atoms in intense fields Neutron, atom and molecular quantum optics Quantum gases and fluids Coherence, entanglement and decoherence Optical properties of condensed matter and nanostructures Open quantum systems and chaos Quantum information processing Central European Workshops on Quantum Optics realize and are consistent with a wider idea, and a social, economical, cultural and political program promoted since 1989 by the Central European Initiative (CEI), the main goal of which was to help transition countries in Central Europe to become closer to the EU. The resulting support of the CEI, first obtained thanks to the scientific reputation, organizing activities, and efforts of Helmut Rauch, has been very important for the organization of the CEWQO in recent years, particularly in 2008. The support of the Sixth and Seventh Framework Programs of the European Commission was also very important. A short review of papers in this topical issue A principal role in this topical issue is played by the photon. Vuletic et al describe the mapping of the photon-polarization state onto a single collective-spin excitation (magnon) shared between two atomic ensembles. A heralded quantum memory based on this mapping is

  17. Fellow's Apéro

    CERN Multimedia

    Staff Association

    2017-01-01

    Let's get together, meet each other, exchange experiences and ideas, and share useful information on CERN and the Staff Association. Join us for Fellow's Apéro, organised by the Staff Association on Tuesday 21 February at 16.30 in Restaurant 1. There will be drinks and snacks for everybody! We look forward to seeing you there! Please confirm your participation on Doodle http://doodle.com/poll/skvm7ucm2z78i6bt or alternatively on Facebook https://www.facebook.com/events/1862757017340069/. Your delegates in the Staff Association, Barbora & Jiri

  18. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  19. Advanced Topics in Aerodynamics

    DEFF Research Database (Denmark)

    Filippone, Antonino

    1999-01-01

    "Advanced Topics in Aerodynamics" is a comprehensive electronic guide to aerodynamics,computational fluid dynamics, aeronautics, aerospace propulsion systems, design and relatedtechnology. We report data, tables, graphics, sketches,examples, results, photos, technical andscientific literature...

  20. Research on the Grouping Discussion-based Teaching Ap-proach for VB Programming Design%VB程序设计课程分组讨论式教学方式的研究

    Institute of Scientific and Technical Information of China (English)

    王慧娟

    2014-01-01

    Visual Basic is an entry-level programming language easy to learn, generally as a computer public course for non-computer majors. In view of the difficulties which economic management non-computer majors are faced with in learning VB programming language, this paper put forward the grouping dis-cussion-based teaching approach, in order to help students better grasp the VB course.%Visual Basic是一门简单易学的入门级程序语言,一般作为非计算机专业的计算机公共课程。针对经管类等非计算机专业学生在学习VB程序语言中遇到的困难,提出了分组讨论式教学的方式,帮助学生更好地掌握VB这门课程。

  1. Supplemental topics on voids

    Energy Technology Data Exchange (ETDEWEB)

    Rood, H.J.

    1988-09-01

    Several topics concerning voids are presented, supplementing the report of Rood (1988). The discovery of the Coma supercluster and void and the recognition of the cosmological significance of superclusters and voids are reviewed. Galaxy redshift surveys and redshift surveys for the Abell clusters and very distant objects are discussed. Solar system and extragalactic dynamics are examined. Also, topics for future observational research on voids are recommended. 50 references.

  2. Topical treatment of melasma

    Directory of Open Access Journals (Sweden)

    Bandyopadhyay Debabrata

    2009-01-01

    Full Text Available Melasma is a common hypermelanotic disorder affecting the face that is associated with considerable psychological impacts. The management of melasma is challenging and requires a long-term treatment plan. In addition to avoidance of aggravating factors like oral pills and ultraviolet exposure, topical therapy has remained the mainstay of treatment. Multiple options for topical treatment are available, of which hydroquinone (HQ is the most commonly prescribed agent. Besides HQ, other topical agents for which varying degrees of evidence for clinical efficacy exist include azelaic acid, kojic acid, retinoids, topical steroids, glycolic acid, mequinol, and arbutin. Topical medications modify various stages of melanogenesis, the most common mode of action being inhibition of the enzyme, tyrosinase. Combination therapy is the preferred mode of treatment for the synergism and reduction of untoward effects. The most popular combination consists of HQ, a topical steroid, and retinoic acid. Prolonged HQ usage may lead to untoward effects like depigmentation and exogenous ochronosis. The search for safer alternatives has given rise to the development of many newer agents, several of them from natural sources. Well-designed controlled clinical trials are needed to clarify their role in the routine management of melasma.

  3. TOPICAL TREATMENT OF MELASMA

    Science.gov (United States)

    Bandyopadhyay, Debabrata

    2009-01-01

    Melasma is a common hypermelanotic disorder affecting the face that is associated with considerable psychological impacts. The management of melasma is challenging and requires a long-term treatment plan. In addition to avoidance of aggravating factors like oral pills and ultraviolet exposure, topical therapy has remained the mainstay of treatment. Multiple options for topical treatment are available, of which hydroquinone (HQ) is the most commonly prescribed agent. Besides HQ, other topical agents for which varying degrees of evidence for clinical efficacy exist include azelaic acid, kojic acid, retinoids, topical steroids, glycolic acid, mequinol, and arbutin. Topical medications modify various stages of melanogenesis, the most common mode of action being inhibition of the enzyme, tyrosinase. Combination therapy is the preferred mode of treatment for the synergism and reduction of untoward effects. The most popular combination consists of HQ, a topical steroid, and retinoic acid. Prolonged HQ usage may lead to untoward effects like depigmentation and exogenous ochronosis. The search for safer alternatives has given rise to the development of many newer agents, several of them from natural sources. Well-designed controlled clinical trials are needed to clarify their role in the routine management of melasma. PMID:20101327

  4. Topical Drugs for Pain Relief

    Directory of Open Access Journals (Sweden)

    Anjali Srinivasan

    2015-03-01

    Full Text Available Topical therapy helps patients with oral and perioral pain problems such as ulcers, burning mouth syndrome, temporomandibular disorders, neuromas, neuropathies and neuralgias. Topical drugs used in the field of dentistry are topical anaesthetics, topical analgesics, topical antibiotics and topical corticosteroids. It provides symptomatic/curative effect. Topical drugs are easy to apply, avoids hepatic first pass metabolism and more sites specific. But it can only be used for medications that require low plasma concentrations to achieve a therapeutic effect.

  5. Topical Drugs for Pain Relief

    OpenAIRE

    Anjali Srinivasan; Prashanth Shenai; Laxmikanth Chatra; Veena KM; Prasanna Kumar Rao

    2015-01-01

    Topical therapy helps patients with oral and perioral pain problems such as ulcers, burning mouth syndrome, temporomandibular disorders, neuromas, neuropathies and neuralgias. Topical drugs used in the field of dentistry are topical anaesthetics, topical analgesics, topical antibiotics and topical corticosteroids. It provides symptomatic/curative effect. Topical drugs are easy to apply, avoids hepatic first pass metabolism and more sites specific. But it can only be used for medications that ...

  6. Implicit stage topics

    Directory of Open Access Journals (Sweden)

    Karen Lahousse

    2008-04-01

    Full Text Available Il a souvent été proposé que les éléments spatio-temporels en position initiale de phrase spécifient le cadre de l’événement dénoté par la proposition et ont une interprétation thématique ou topicale. Alors que les topiques spatio-temporels explicites ont souvent été étudiés, Erteschik-Schir (1997, 1999 propose l’idée que les topiques spatio-temporels, ou topiques scéniques (stage topics peuvent aussi être implicites.Dans cet article, nous offrons des arguments en faveur de la notion de topique scénique implicite. Nous montrons qu’un certain nombre de cas d’inversion nominale en français, une configuration syntaxique qui est favorisée par la présence d’un topique scénique explicite, s’expliquent par la présence d’un topique scénique implicite. Le fait que les topiques scéniques implicites interagissent avec la structure syntaxique de la même façon que les topiques scéniques explicites constitue un argument empirique en faveur de leur existence.It has often been proposed that sentence-initial spatio-temporal elements specify the frame in which the whole proposition takes place and are topical (i.e. thematic. Whereas considerable attention has been paid to explicit spatio-temporal topics, Erteschik-Shir (1997, 1999 argues that spatio-temporal topics, or stage topics, can also be implicit.In this article we provide evidence in favour of the notion of implicit stage topic. We show that a certain number of nominal inversion cases in French, a syntactic configuration which is triggered by the presence of an explicit stage topic, are explained by the presence of an implicit stage topic. The fact that implicit stage topics interact with syntactic structure the same way explicit stage topics do constitutes a strong empirical argument in favour of their existence.

  7. Edema pulmonar após absorção sistêmica de fenilefrina tópica durante cirurgia oftalmológica em criança: relato de caso Edema pulmonar después de absorción de fenilefrina tópica durante cirugía oftalmológica en niño: relato de caso Pulmonary edema after topic phenylephrine absorption during pediatric eye surgery: case report

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Savioli Fischer

    2004-12-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Soluções tópicas de fenilefrina são empregadas freqüentemente em cirurgia oftalmológica com o objetivo de promover descongestionamento capilar ou dilatação pupilar. Este artigo descreve um caso de hipertensão arterial grave seguida de edema pulmonar durante cirurgia para correção de estrabismo. A provável causa desta complicação foi a absorção sistêmica de fenilefrina administrada por via tópica ocular. O objetivo do relato é a discussão de meios de prevenção desta complicação, assim como do tratamento mais adequado. RELATO DO CASO: Paciente do sexo masculino, 12 anos, 50 kg, estado físico ASA I, admitido no centro cirúrgico para realização de correção de estrabismo convergente bilateral em regime ambulatorial. Foi submetido à anestesia geral venosa e a manutenção, realizada com infusão contínua de remifentanil e propofol. Após colocação do bléfaro, 6 gotas de fenilefrina a 10% foram aplicadas por via tópica. Decorridos 5 minutos do início da cirurgia, o paciente desenvolveu hipertensão arterial e taquicardia, refratárias à elevação da dose administrada de remifentanil e propofol, bem como à administração de droperidol. O controle da pressão arterial e da freqüência cardíaca foi possível após o emprego do sevoflurano, mas houve diminuição da saturação de oxigênio e o aparecimento de crepitações pulmonares difusas por provável desenvolvimento de edema pulmonar agudo. A furosemida foi administrada e os anestésicos foram suspensos. O paciente apresentou melhora progressiva do quadro pulmonar, enquanto os valores de pressão arterial permaneciam dentro da normalidade. Recebeu alta da sala de recuperação pós-anestésica 6 horas após a cirurgia, quando se apresentava em ventilação espontânea em ar ambiente, com saturação de O2, ausculta pulmonar e pressão arterial normais. CONCLUSÕES: A administração de fenilefrina tópica deve ser realizada com

  8. Characters and Topical Diversity

    DEFF Research Database (Denmark)

    Eriksson, Rune

    2014-01-01

    The purpose of this article is to contribute to our understanding of the difference between the bestseller and the non-bestseller in nonfiction. It is noticed that many bestsellers in nonfiction belongs to the sub-genre of creative nonfiction, but also that the topics in this kind of literature...... is largely ignored by the critics. Thus, the article tests how topics may work in creative nonfiction. Two Danish bestsellers belonging to the genre, Frank’s Mit smukke genom ( My Beautiful Genome), about genomics, and Buk-Swienty’s Slagtebænk Dybbøl ( ‘Slaughter-bench Dybbøl’), a history book, are chosen...... as cases and analysed using a slightly modified motif model by Johansen. The result is that in both books the main topic is treated from a double perspective, but also that six out of seven secondary topics, or motifs, are treated as well. It is concluded that also in a topical sense creative nonfiction...

  9. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin

    2012-01-01

    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  10. Topical ketoprofen patch.

    Science.gov (United States)

    Mazières, Bernard

    2005-01-01

    Although oral nonsteroidal anti-inflammatory drugs (NSAIDs) are effective in the treatment of a variety of acute and chronic pain conditions, their use may be associated with serious systemic adverse effects, particularly gastrointestinal disorders. In order to minimise the incidence of systemic events related to such agents, topical NSAIDs have been developed. Topical NSAIDs, applied as gels, creams or sprays, penetrate the skin, subcutaneous fatty tissue and muscle in amounts that are sufficient to exert a therapeutic effect on peripheral and central mechanisms in the absence of high plasma concentrations. Data indicate that topical NSAIDs are effective at relieving pain in a number of acute and chronic pain indications. This review article discusses the pharmacokinetics, efficacy and tolerability of a new formulation of ketoprofen available as a topical patch. The topical patch containing ketoprofen 100mg as the active principle has been developed using a novel delivery system that dispenses therapeutic doses of the drug directly to the site of injury. Pharmacokinetic data indicate that although plasma levels of ketoprofen are higher when the drug is administered as a patch versus a gel, the total systemic bioavailability of ketoprofen 100 mg administered via a patch is no more than 10% of that reported for ketoprofen 100 mg administered orally. Because the patch facilitates ketoprofen delivery over a 24-hour period, the drug remains continually present in the tissue subjacent to the site of application. High tissue but low plasma ketoprofen concentrations mean that while tissue concentrations are high enough to exert a therapeutic effect, plasma concentrations remain low enough to not result in systemic adverse events caused by elevated serum NSAID levels. Phase III clinical trials in patients with non-articular rheumatism and traumatic painful soft tissue injuries showed that the topical ketoprofen patch was significantly more effective than placebo at

  11. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  12. Characters and Topical Diversity

    DEFF Research Database (Denmark)

    Eriksson, Rune

    2014-01-01

    The purpose of this article is to contribute to our understanding of the difference between the bestseller and the non-bestseller in nonfiction. It is noticed that many bestsellers in nonfiction belongs to the sub-genre of creative nonfiction, but also that the topics in this kind of literature i...

  13. Selected topics in magnetism

    CERN Document Server

    Gupta, L C

    1993-01-01

    Part of the ""Frontiers in Solid State Sciences"" series, this volume presents essays on such topics as spin fluctuations in Heisenberg magnets, quenching of spin fluctuations by high magnetic fields, and kondo effect and heavy fermions in rare earths amongst others.

  14. Contrastive topics decomposed

    Directory of Open Access Journals (Sweden)

    Michael Wagner

    2012-12-01

    Full Text Available The analysis of contrastive topics introduced in Büring 1997b and further developed in Büring 2003 relies on distinguishing two types of constituents that introduce alternatives: the sentence focus, which is marked by a FOC feature, and the contrastive topic, which is marked by a CT feature. A non-compositional rule of interpretation that refers to these features is used to derive a topic semantic value, a nested set of sets of propositions. This paper presents evidence for a correlation between the restrictive syntax of nested focus operators and the syntax of contrastive topics, a correlation which is unexpected under this analysis. A compositional analysis is proposed that only makes use of the flatter focus semantic values introduced by focus operators. The analysis aims at integrating insights from the original analysis while at the same time capturing the observed syntactic restrictions. http://dx.doi.org/10.3765/sp.5.8 BibTeX info

  15. Topics in Nonlinear Dynamics

    DEFF Research Database (Denmark)

    Mosekilde, Erik

    Through a significant number of detailed and realistic examples this book illustrates how the insights gained over the past couple of decades in the fields of nonlinear dynamics and chaos theory can be applied in practice. Aomng the topics considered are microbiological reaction systems, ecological...

  16. Transportation: Topic Paper E.

    Science.gov (United States)

    National Council on the Handicapped, Washington, DC.

    As one of a series of topic papers assessing federal laws and programs affecting persons with disabilities, this paper reviews the issue of transportation services. In the area of urban mass transit, four relevant pieces of legislation and public transportation accessibility regulations are cited, and cost issues are explored. Paratransit systems,…

  17. Digital Social Network Mining for Topic Discovery

    Science.gov (United States)

    Moradianzadeh, Pooya; Mohi, Maryam; Sadighi Moshkenani, Mohsen

    Networked computers are expanding more and more around the world, and digital social networks becoming of great importance for many people's work and leisure. This paper mainly focused on discovering the topic of exchanging information in digital social network. In brief, our method is to use a hierarchical dictionary of related topics and words that mapped to a graph. Then, with comparing the extracted keywords from the context of social network with graph nodes, probability of relation between context and desired topics will be computed. This model can be used in many applications such as advertising, viral marketing and high-risk group detection.

  18. Berberine inhibits cyclin D1 expression via suppressed binding of AP-1 transcription factors to CCND1 AP-1 motif

    Institute of Scientific and Technical Information of China (English)

    Ye LUO; Yu HAO; Tai-ping SHI; Wei-wei DENG; Na LI

    2008-01-01

    Aim: To verify the suppressive effect of berberine on the proliferation of the human pulmonary giant cell carcinoma cell line PG and to demonstrate the mecha-nisms behind the antitumoral effects of berberine. Methods: The proliferative effects of PG cells were detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide colorimetry. The cell cycle was examined by flow cytometry. The expression level of cyclin D1 was detected by RT-PCR. The activities of the activating protein-1 (AP-1) and NF-κB signaling pathways related to cyclin D1 were examined by luciferase assay. The cytoplasmic level of c-Jun was detected by Western blot analysis. An electrophoretic mobility shift assay was used to examiae the binding of transcription factors to the cyclin D1 gene (CCNDl) AP-1 motif. Results: The results showed that the proliferation of PG cells treated with different concentrations (10, 20, and 40 μg/mL) of berberine for 24 and 48 h was suppressed significantly compared to the control group. After treatment with berberine, the proportion of PG cells at the G0/G1 phase increased, while cells at the S and G2/M phases decreased. Berberine could inhibit the expression of cyclin D1 in PG cells. Berberine inhibited the activity of the AP-1 signaling pathway, but had no significant effect on the NF-κB signaling pathway. Berberine suppressed the expression of c-Jun and decreased the binding of tran-scription factors to the CCND1 AP-1 motif. Conclusion: Berberine suppresses the activity of the AP-1 signaling pathway and decreases the binding of transcrip-tion factors to the CCND1 AP-1 motif. This is one of the important mechanisms behind the antitumoral effects of berberine as a regulator of cyclin D1.

  19. Comparison of topical tretinoin and betamethasone in oral lichen planus

    Directory of Open Access Journals (Sweden)

    Kar H

    1996-01-01

    Full Text Available Thirty-one patients of oral lichen planus were enrolled in this study and two groups were made. Group 1 consisting of 16 patients who applied topical tretinoin 0.05% and Group 2 comprising of 15 patients who were given topical betamethasone dipropionate 0.05%. The patients applying tretinoin showed statistically significant improvement as compared to patients applying betamethasone.

  20. Topical Conference on Oportunities in Biology for Physicists II

    Energy Technology Data Exchange (ETDEWEB)

    Franz, Judy R.

    2004-02-01

    In 2002, the American Physical Society (APS) organized and held the first topical conference in Boston, MA, as a way of informing physicists, particularly those just entering the field, of opportunities emerging at the interface of physics and biology. Because of the tremendous success of the first conference, it was decided to organize a second conference, similar in nature and focus, but with different presentation topic areas. Again the intended audience would be graduate students and postdocs considering applying methods of physics to biological research, and those who advise others on such opportunities.

  1. Novel Topic Authorship Attribution

    Science.gov (United States)

    2011-03-01

    cross-validation, genre shift, vector projection, singular value decomposition, principal component analysis Unclassified Unclassified Unclassified...by eight students. Each student wrote a total of 24 documents in three different genres about three different topics. They found that compensating for...Baayen, H. Halteren, A. Neijt, and F. Tweedie, “Outside the cave of shadows: Using syntactic annotation to enhance authorship attribution,” Literary

  2. Research on Network Public Opinion Evolution Topics Subdivision and Grouping Law%网络舆情信息的衍变话题细分及组配规律研究

    Institute of Scientific and Technical Information of China (English)

    黄微; 李瑞; 高俊峰

    2016-01-01

    文章以新浪网站真实数据为基础,通过识别热门事件衍变子话题的互信息度构建衍变话题网络,进而通过复杂网络分析的方法测度衍变话题网络中结点的中介中心性以及可视化衍变话题的次第组配网络拓扑,达到细分热点事件衍变话题,明确其组配规律的研究目标,以期为热点事件舆情的危机定性、技术干预、舆情跟踪反馈等工作提供实践依据。%This paper takes the real data in Sina as object, constructing the topic network by measure the mutual information degree of subtopic evolutionary from online event. Then complex network analysis been used to measure the nodes’ betweenness centrality and visualize the sub network topology of topic relation, achieve the target of seg-ment the developed topic and clear the polarity transition rules of public opinion. The result can provide the practice reference of crisis qualitative, technical intervention, event tracking and other crisis management work.

  3. Duplication of AP1 within the Spinacia oleracea L. AP1/FUL clade is followed by rapid amino acid and regulatory evolution.

    Science.gov (United States)

    Sather, D Noah; Golenberg, Edward M

    2009-02-01

    The AP1/FUL clade of MADS box genes have undergone multiple duplication events among angiosperm species. While initially identified as having floral meristem identity and floral organ identity function in Arabidopsis, the role of AP1 homologs does not appear to be universally conserved even among eudicots. In comparison, the role of FRUITFULL has not been extensively explored in non-model species. We report on the isolation of three AP1/FUL genes from cultivated spinach, Spinacia oleracea L. Two genes, designated SpAPETALA1-1 (SpAP1-1) and SpAPETALA1-2 (SpAP1-2), cluster as paralogous genes within the Caryophyllales AP1 clade. They are highly differentiated in the 3', carboxyl-end encoding region of the gene following the third amphipathic alpha-helix region, while still retaining some elements of a signature AP1 carboxyl motifs. In situ hybridization studies also demonstrate that the two paralogs have evolved different temporal and spatial expression patterns, and that neither gene is expressed in the developing sepal whorl, suggesting that the AP1 floral organ identity function is not conserved in spinach. The spinach FRUITFULL homolog, SpFRUITFULL (SpFUL), has retained the conserved motif and groups with Caryophyllales FRUITFULL homologs. SpFUL is expressed in leaf as well as in floral tissue, and shows strong expression late in flower development, particularly in the tapetal layer in males, and in the endothecium layer and stigma, in the females. The combined evidence of high rates of non-synonymous substitutions and differential expression patterns supports a scenario in which the AP1 homologs in the spinach AP1/FUL gene family have experienced rapid evolution following duplication.

  4. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  5. Topics in Operator Theory

    CERN Document Server

    Ball, Joseph A; Helton, JWilliam; Rodman, Leiba; Spitkovsky, Iiya

    2010-01-01

    This is the first volume of a collection of original and review articles on recent advances and new directions in a multifaceted and interconnected area of mathematics and its applications. It encompasses many topics in theoretical developments in operator theory and its diverse applications in applied mathematics, physics, engineering, and other disciplines. The purpose is to bring in one volume many important original results of cutting edge research as well as authoritative review of recent achievements, challenges, and future directions in the area of operator theory and its applications.

  6. New Protein Vector ApE1 for Targeted Delivery of Anticancer Drugs

    Directory of Open Access Journals (Sweden)

    N. V. Pozdniakova

    2012-01-01

    Full Text Available A new chimeric gene ApE1 encoding the receptor-binding domain of the human alpha-fetoprotein fused to a sequence of 22 glutamic acid residues was constructed. A new bacterial producer strain E. coli SHExT7 ApE1 was selected for ApE1 production in a soluble state. A simplified method was developed to purify ApE1 from bacterial biomass. It was shown that the new vector protein selectively interacts with AFP receptors on the tumor cell surface and can be efficiently accumulated in tumor cells. In addition, ApE1 was shown to be stable in storage and during its chemical modification. An increased number of carboxyl groups in the molecule allows the production of cytotoxic compound conjugates with higher drug-loading capacity and enhanced tumor targeting potential.

  7. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2016-09-14

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  8. Peculiar Traits of Coarse AP (Briefing Charts)

    Science.gov (United States)

    2014-12-01

    Self Combustion 3 Thom L. Boggs Parallel ridges and valley surfaces seen at 1000 to 1500 psi Isolated AP vertical needle pockets at 1500 and 1800 psi...Negative exponents, bouncing flamlets between 2000 to 4000 psi Extremely irregular AP surface regression Hightower and Price 16 Air Force Research...supported by vertical gas jetlets from active centers? Did Boggs burn a few samples at 1000 to 2000 psi with orthorhombic main axis normal to

  9. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  10. Hot topics for leadership development.

    Science.gov (United States)

    Bleich, Michael R

    2015-02-01

    Three areas stand out from a health systems perspective that should be on the development agenda for all leaders. These topics include population health, predictive analytics, and supply chain management. Together, these topics address access, quality, and cost management.

  11. Topics in atomic physics

    CERN Document Server

    Burkhardt, Charles E

    2006-01-01

    The study of atomic physics propelled us into the quantum age in the early twentieth century and carried us into the twenty-first century with a wealth of new and, in some cases, unexplained phenomena. Topics in Atomic Physics provides a foundation for students to begin research in modern atomic physics. It can also serve as a reference because it contains material that is not easily located in other sources. A distinguishing feature is the thorough exposition of the quantum mechanical hydrogen atom using both the traditional formulation and an alternative treatment not usually found in textbooks. The alternative treatment exploits the preeminent nature of the pure Coulomb potential and places the Lenz vector operator on an equal footing with other operators corresponding to classically conserved quantities. A number of difficult to find proofs and derivations are included as is development of operator formalism that permits facile solution of the Stark effect in hydrogen. Discussion of the classical hydrogen...

  12. Effect of Topical Probiotic on MMP-13 and Collagen III Expression in the Dermis Layer of Male Rats Irradiated with Ultraviolet-B

    Directory of Open Access Journals (Sweden)

    Vita M. Tawaran

    2016-06-01

    Full Text Available Nowadays, there is a big interest in the use of topical probiotic preparations for skin health. One of the probiotics therurapeutic benefits is used as anti-aging. During aging, there is stimulation of activator protein-1 (AP-1 which is a transcription factor that inhibits the production of collagen and AP-1 supports the breakdown of collagen by enzymes called matrix metalloproteinases (MMPs. As administration of oral Lactobacillus plantarum could inhibit skin aging by lowering the activity of MMP, so the collagen degradation can be derived so probably topical use of Lactobacillus plantarum may give more prominent effects. We used 24 male rats Sprague-Dawley strain as research objects. This study was divided into two groups, the treatment and control groups. The shaved dorsal skin of rats were irradiated with UVB three times a week for 4 weeks with total irradiation dose of 840 mJ/cm2. Skin cream, containing 247.27x107 CFU non-replicating Lactobacillus plantarum FNCC 0020, was smeared on the treatment group, two times daily, whereas the control group did not receive any treatment. Skin biopsies were done at the end of the study for examination of MMP-13 and collagen III expressions. Intensity, distribution, and histoscore of MMP-13 between the treatment and the control group showed no significant difference (p>0.05. The treatment group showed a significant different in the intensity of collagen III with the density distribution of 20–50% and the highest density was 80% (p<0.01. Administration of topical cream L. plantarum FNCC 0020 increased the expression of collagen III density distribution, but not the MMP-13 expression.

  13. Insect Cell Glycosylation and Its Impact on the Functionality of a Recombinant Intracrystalline Nacre Protein, AP24.

    Science.gov (United States)

    Chang, Eric P; Perovic, Iva; Rao, Ashit; Cölfen, Helmut; Evans, John Spencer

    2016-02-23

    The impacts of glycosylation on biomineralization protein function are largely unknown. This is certainly true for the mollusk shell, where glycosylated intracrystalline proteins such as AP24 (Haliotis rufescens) exist but their functions and the role of glycosylation remain elusive. To assess the effect of glycosylation on protein function, we expressed two recombinant variants of AP24: an unglycosylated bacteria-expressed version (rAP24N) and a glycosylated insect cell-expressed version (rAP24G). Our findings indicate that rAP24G is expressed as a single polypeptide containing variations in glycosylation that create microheterogeneity in rAP24G molecular masses. These post-translational modifications incorporate O- and N-glycans and anionic monosialylated and bisialylated, and monosulfated and bisulfated monosaccharides on the protein molecules. AFM and DLS experiments confirm that both rAP24N and rAP24G aggregate to form protein phases, with rAP24N exhibiting a higher degree of aggregation, compared to rAP24G. With regard to functionality, we observe that both recombinant proteins exhibit similar behavior within in vitro calcium carbonate mineralization assays and potentiometric titrations. However, rAP24G modifies crystal growth directions and is a stronger nucleation inhibitor, whereas rAP24N exhibits higher mineral phase stabilization and nanoparticle containment. We believe that the post-translational addition of anionic groups (via sialylation and sulfation), along with modifications to the protein surface topology, may explain the changes in glycosylated rAP24G aggregation and mineralization behavior, relative to rAP24N.

  14. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...... presence of both γ Dor and roAp pulsations and the unexpected detection of δ Sct and γ Dor pulsations in Ap stars present new opportunities and challenges for the interpretation of these stars. Since it is easy to confuse Am and Ap stars at classification dispersions, the nature of these Ap stars...

  15. Scientometrics: Untangling the topics

    CERN Document Server

    Szanto-Varnagy, Adam; Vicsek, Tamas; Farkas, Illes J

    2014-01-01

    Measuring science is based on comparing articles to similar others. However, keyword-based groups of thematically similar articles are dominantly small. This keeps statistical errors high. With the growing availability of bibliographic data these statistical errors can be reduced by merging methods of thematic grouping, citation networks and keyword co-usage networks.

  16. An Analysis of Media’s Role: Case Study of Army Public School (APS Peshawar Attack

    Directory of Open Access Journals (Sweden)

    Qureshi Rameesha

    2016-12-01

    Full Text Available The study aimed at analyzing the role of media during and after terrorist attacks by examining the media handling of APS Peshawar attack. The sample consisted of males and females selected on convenience basis from universities of Rawalpindi and Islamabad. It was hypothesized that (1 Extensive media coverage of terrorist attacks leads to greater publicity/recognition of terrorist groups (2 Media coverage of APS Peshawar attack increased fear and anxiety in public (3 Positive media handling/coverage of APS Peshawar attack led to public solidarity and peace. The results indicate that i Media coverage of terrorist attacks does help terrorist groups to gain publicity and recognition amongst public ii Media coverage of Aps Peshawar attack did not increase fear/anxiety in fact it directed the Pakistani nation towards public solidarity and peace.

  17. In situ gel-forming AP-57 peptide delivery system for cutaneous wound healing.

    Science.gov (United States)

    Li, Xiaoling; Fan, Rangrang; Tong, Aiping; Yang, Meijia; Deng, Jiaojiao; Zhou, Liangxue; Zhang, Xiaoning; Guo, Gang

    2015-11-10

    In situ gel-forming system as local drug delivery system in dermal traumas has generated a great interest. Accumulating evidence shows that antimicrobial peptides play pivotal roles in the process of wound healing. Here in this study, to explore the potential application of antimicrobial peptide in wound healing, biodegradable poly(L-lactic acid)-Pluronic L35-poly(L-lactic acid) (PLLA-L35-PLLA) was developed at first. Then based on this polymer, an injectable in situ gel-forming system composed of human antimicrobial peptides 57 (AP-57) loaded nanoparticles and thermosensitive hydrogel was prepared and applied for cutaneous wound healing. AP-57 peptides were enclosed with biocompatible nanoparticles (AP-57-NPs) with high drug loading and encapsulation efficiency. AP-57-NPs were further encapsulated in a thermosensitive hydrogel (AP-57-NPs-H) to facilitate its application in cutaneous wound repair. As a result, AP-57-NPs-H released AP-57 in an extended period and exhibited quite low cytotoxicity and high anti-oxidant activity in vitro. Moreover, AP-57-NPs-H was free-flowing liquid at room temperature, and can form non-flowing gel without any crosslink agent upon applied on the wounds. In vivo wound healing assay using full-thickness dermal defect model of SD rats indicated that AP-57-NPs-H could significantly promote wound healing. At day 14 after operation, AP-57-NPs-H treated group showed nearly complete wound closure of 96.78 ± 3.12%, whereas NS, NPs-H and AP-57-NPs group recovered by about 68.78 ± 4.93%, 81.96 ± 3.26% and 87.80 ± 4.62%, respectively. Histopathological examination suggested that AP-57-NPs-H could promote cutaneous wound healing through enhancing granulation tissue formation, increasing collagen deposition and promoting angiogenesis in the wound tissue. Therefore, AP-57-NPs-H might have potential application in wound healing.

  18. Stratification in Ap star atmospheres: Simulations

    Science.gov (United States)

    Cowley, Charles R.; Castelli, Fiorella

    2017-01-01

    It is now well established that the atmospheres of Ap stars can be chemically stratified (cf. Babel, A\\&A 258, 645, 1992; Ryabchikova et al. A\\&A 384, 545, 2002). The most convincing cases have been made with the profiles of very strong lines, such as Ca II K. Weaker line profiles are less obvious indicators. The collective behavior of sets or groups of lines have also been used. For example, if higher abundances are derived for strong lines in an atmosphere with zero microturbulence, one may assume that the absorbing species has been pushed into the higher photospheres. An example are the medium-strong Mn II lines in HgMn stars. In this paper, we probe this assumption by calculating line strengths with various assumed stratification models, and then determining abundances from those lines using an {\\bf unstratified} model with the same Teff and log(g). We use the model from Castelli, Kurucz \\& and Hubrig (A\\&A, 508, 401, 2009) for HR 6000, whose spectrum shows numerous indications of stratification. A variety of stratification models are considered, for example, ones where the majority of an absorbing species is concentrated above (or below) $log(\\tau_{5000}$ = -2.0. Cloud models are also investigated, where a species is concentrated within a range of photospheric depths. Curves of growth are generated in unstratified atmospheres for lines by holding the abundance fixed, and increasing log(gf). Similar curves are made in stratified models, and the ratios of strong to weak linesare compared with and without stratification. The effects of stratification on ionization are also investigated, as well as on the profiles of strong lines. We find, in agreement with previous work, that severe abundance jumps are sometimes required to account for some of the observed peculiarities.

  19. Multiplicity of rapidly oscillating Ap stars

    CERN Document Server

    Schoeller, M; Hubrig, S; Kurtz, D W

    2012-01-01

    Rapidly oscillating Ap (roAp) stars have rarely been found in binary or higher order multiple systems. This might have implications for their origin. We intend to study the multiplicity of this type of chemically peculiar stars, looking for visual companions in the range of angular separation between 0.05" and 8". We carried out a survey of 28 roAp stars using diffraction-limited near-infrared imaging with NAOS-CONICA at the VLT. Additionally, we observed three non-oscillating magnetic Ap stars. We detected a total of six companion candidates with low chance projection probabilities. Four of these are new detections, the other two are confirmations. An additional 39 companion candidates are very likely chance projections. We also found one binary system among the non-oscillating magnetic Ap stars. The detected companion candidates have apparent K magnitudes between 6.8 and 19.5 and angular separations ranging from 0.23" to 8.9", corresponding to linear projected separations of 30-2400AU. While our study confi...

  20. Advanced verification topics

    CERN Document Server

    Bhattacharya, Bishnupriya; Hall, Gary; Heaton, Nick; Kashai, Yaron; Khan Neyaz; Kirshenbaum, Zeev; Shneydor, Efrat

    2011-01-01

    The Accellera Universal Verification Methodology (UVM) standard is architected to scale, but verification is growing and in more than just the digital design dimension. It is growing in the SoC dimension to include low-power and mixed-signal and the system integration dimension to include multi-language support and acceleration. These items and others all contribute to the quality of the SOC so the Metric-Driven Verification (MDV) methodology is needed to unify it all into a coherent verification plan. This book is for verification engineers and managers familiar with the UVM and the benefits it brings to digital verification but who also need to tackle specialized tasks. It is also written for the SoC project manager that is tasked with building an efficient worldwide team. While the task continues to become more complex, Advanced Verification Topics describes methodologies outside of the Accellera UVM standard, but that build on it, to provide a way for SoC teams to stay productive and profitable.

  1. Topics in statistical mechanics

    Energy Technology Data Exchange (ETDEWEB)

    Elser, V.

    1984-05-01

    This thesis deals with four independent topics in statistical mechanics: (1) the dimer problem is solved exactly for a hexagonal lattice with general boundary using a known generating function from the theory of partitions. It is shown that the leading term in the entropy depends on the shape of the boundary; (2) continuum models of percolation and self-avoiding walks are introduced with the property that their series expansions are sums over linear graphs with intrinsic combinatorial weights and explicit dimension dependence; (3) a constrained SOS model is used to describe the edge of a simple cubic crystal. Low and high temperature results are derived as well as the detailed behavior near the crystal facet; (4) the microscopic model of the lambda-transition involving atomic permutation cycles is reexamined. In particular, a new derivation of the two-component field theory model of the critical behavior is presented. Results for a lattice model originally proposed by Kikuchi are extended with a high temperature series expansion and Monte Carlo simulation. 30 references.

  2. Superconcentration and related topics

    CERN Document Server

    Chatterjee, Sourav

    2014-01-01

    A certain curious feature of random objects, introduced by the author as “super concentration,” and two related topics, “chaos” and “multiple valleys,” are highlighted in this book. Although super concentration has established itself as a recognized feature in a number of areas of probability theory in the last twenty years (under a variety of names), the author was the first to discover and explore its connections with chaos and multiple valleys. He achieves a substantial degree of simplification and clarity in the presentation of these findings by using the spectral approach. Understanding the fluctuations of random objects is one of the major goals of probability theory and a whole subfield of probability and analysis, called concentration of measure, is devoted to understanding these fluctuations. This subfield offers a range of tools for computing upper bounds on the orders of fluctuations of very complicated random variables. Usually, concentration of measure is useful when more direct prob...

  3. Researching Distressing Topics

    Directory of Open Access Journals (Sweden)

    Sharon Jackson

    2013-05-01

    Full Text Available Qualitative researchers who explore sensitive topics may expose themselves to emotional distress. Consequently, researchers are often faced with the challenge of maintaining emotional equilibrium during the research process. However, discussion on the management of difficult emotions has occupied a peripheral place within accounts of research practice. With rare exceptions, the focus of published accounts is concentrated on the analysis of the emotional phenomena that emerge during the collection of primary research data. Hence, there is a comparative absence of a dialogue around the emotional dimensions of working with secondary data sources. This article highlights some of the complex ways in which emotions enter the research process during secondary analysis, and the ways in which we engaged with and managed emotional states such as anger, sadness, and horror. The concepts of emotional labor and emotional reflexivity are used to consider the ways in which we “worked with” and “worked on” emotion. In doing so, we draw on our collective experiences of working on two collaborative projects with ChildLine Scotland in which a secondary analysis was conducted on children’s narratives of distress, worry, abuse, and neglect.

  4. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  5. Discovering health topics in social media using topic models.

    Directory of Open Access Journals (Sweden)

    Michael J Paul

    Full Text Available By aggregating self-reported health statuses across millions of users, we seek to characterize the variety of health information discussed in Twitter. We describe a topic modeling framework for discovering health topics in Twitter, a social media website. This is an exploratory approach with the goal of understanding what health topics are commonly discussed in social media. This paper describes in detail a statistical topic model created for this purpose, the Ailment Topic Aspect Model (ATAM, as well as our system for filtering general Twitter data based on health keywords and supervised classification. We show how ATAM and other topic models can automatically infer health topics in 144 million Twitter messages from 2011 to 2013. ATAM discovered 13 coherent clusters of Twitter messages, some of which correlate with seasonal influenza (r = 0.689 and allergies (r = 0.810 temporal surveillance data, as well as exercise (r =  .534 and obesity (r =  -.631 related geographic survey data in the United States. These results demonstrate that it is possible to automatically discover topics that attain statistically significant correlations with ground truth data, despite using minimal human supervision and no historical data to train the model, in contrast to prior work. Additionally, these results demonstrate that a single general-purpose model can identify many different health topics in social media.

  6. AP Theory IV: Intrinsic Topological Quantum Langlands Theory

    CERN Document Server

    Winkelnkemper, H E

    2010-01-01

    Without using any moduli, sheaves, stacks, nor any analytic, nor category-type arguments, we exhibit an analogue to Geometric Langlands Theory in an entirely model-independent, non-perturbative,purely smooth topological context in Artin Presentation Theory. A basic initial feature is that AP Theory, as a whole, is already, ab initio, a universal canonical 2D sigma-model, targeting smooth, compact, simply-connected 4-manifolds with a connected boundary, and its topological Planckian quantum starting point, as well as its cone-like, infinitely-generated at each stage, graded group of homology-preserving, but topology-changing transitions/interactions, exhibit the most general qualitative S-duality. We first point out the numerous mathematically rigorous, model-free, (i.e., intrinsic), topological AP analogues with the heuristic Kapustin-Witten version of Geometric Langlands theory, as well as the crucial differences between the two theories. The latter have to exist since AP Theory deals, a priori, essentially ...

  7. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  8. Automated Word Puzzle Generation via Topic Dictionaries

    CERN Document Server

    Pinter, Balazs; Szabo, Zoltan; Lorincz, Andras

    2012-01-01

    We propose a general method for automated word puzzle generation. Contrary to previous approaches in this novel field, the presented method does not rely on highly structured datasets obtained with serious human annotation effort: it only needs an unstructured and unannotated corpus (i.e., document collection) as input. The method builds upon two additional pillars: (i) a topic model, which induces a topic dictionary from the input corpus (examples include e.g., latent semantic analysis, group-structured dictionaries or latent Dirichlet allocation), and (ii) a semantic similarity measure of word pairs. Our method can (i) generate automatically a large number of proper word puzzles of different types, including the odd one out, choose the related word and separate the topics puzzle. (ii) It can easily create domain-specific puzzles by replacing the corpus component. (iii) It is also capable of automatically generating puzzles with parameterizable levels of difficulty suitable for, e.g., beginners or intermedia...

  9. Assessing adherence factors in patients under topical treatment: development of the Topical Therapy Adherence Questionnaire (TTAQ).

    Science.gov (United States)

    Zschocke, Ina; Mrowietz, Ulrich; Lotzin, Annett; Karakasili, Eleni; Reich, Kristian

    2014-04-01

    Medication adherence rates strongly depend on favorable disease outcomes. It is known that medication adherence rates are lower for topical treatment than for systemic treatment. However, to date no validated instrument for the assessment of adherence factors in topical treatment is available. The aim of this study was to develop a new questionnaire to assess adherence risk factors in topical treatment. The development of the Topical Therapy Adherence Questionnaire (TTAQ) and Patient Preference Questionnaire (PPQ) was based on a systematic literature review, and qualitative patient focus interviews and expert focus groups' input. The psychometric properties and comprehensibility of the TTAQ and PPQ were assessed in a feasibility study with 59 psoriasis patients. Our first preliminary results indicate that the TTAQ and PPQ are psychometrically sound and reliable measures for the assessment of factors influencing topical treatment adherence. The questionnaires are currently being further developed and various parameters (e.g., time point of assessment) are currently being tested in an exploratory pilot study with ca. 2,000 psoriasis patients receiving topical treatment in a European clinical trial. The use of the final versions of TTAQ and PPQ in clinical practice may facilitate the early identification of specific non-adherence factors in patients under topical treatment, which could enable designing and applying adherence-enhancing interventions according to the patient's individual needs.

  10. Is benzoyl peroxide 3% topical gel effective and safe in the treatment of acne vulgaris in Japanese patients? A multicenter, randomized, double-blind, vehicle-controlled, parallel-group study.

    Science.gov (United States)

    Kawashima, Makoto; Hashimoto, Hirofumi; Alio Sáenz, Alessandra B; Ono, Makoto; Yamada, Masahiro

    2014-09-01

    Benzoyl peroxide (BPO) as an anti-acne medication is not yet approved in Japan. This study evaluated the efficacy and safety of a once-daily topical application of BPO 3% gel versus an inert vehicle gel in Japanese acne patients. Three hundred and sixty patients were randomized to receive BPO 3% or vehicle for 12 weeks. The primary efficacy end-point was absolute change in number of total lesions (TL) from baseline to week 12 to demonstrate the superiority of BPO 3% versus vehicle. Secondary efficacy end-points were absolute and percent change in TL, inflammatory lesions (IL), non-inflammatory lesions (non-IL) and Investigator's Static Global Assessment (ISGA). Change in TL counts from baseline to week 12 for BPO 3% was superior to vehicle (difference, -21.0; P BPO 3% at all study visits. The proportion of patients with improvement in ISGA scores was significantly higher with BPO 3% than with vehicle from week 2. All adverse events were mild or moderate. Adverse drug-related reactions were higher for BPO 3% (30%) than with vehicle (5%). Local tolerability scores of grade 1 or more (slight to moderate) were more frequent with BPO 3% than vehicle with the most significant differences observed in dryness (56% vs 27% at week 1-4), peeling (19% vs 9% at week 1-2) and burning/stinging (58% vs 15% at week 1-12). These results indicate that BPO 3% is effective while maintaining a favorable safety and tolerability profile in Japanese acne patients.

  11. Formalistic approaches to A&P

    Institute of Scientific and Technical Information of China (English)

    赵倩

    2014-01-01

    A&P is a famous short story. Its simple words, the unique point of view and skillful writing technique are expressed successfully. Besides, the first-person narrator is also a good point. From Sammy’s eyes, readers can learn the character’s characteristics. Another point is the usage of symbol, the name of the store, A&P, it shows that people’s life is rich, but their spirit is barren. This article tries to analyze it by formalistic approaches.

  12. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  13. Working with Groups.

    Science.gov (United States)

    Morris, Joan, Ed.

    1984-01-01

    Describes nine Canadian programs for counseling groups of students. Topics include introducing computer-assisted guidance, future challenges for counselors, sociometry, sexuality, parent counseling, reluctant students, shyness, peer groups, education for living, and guidance advisory committees. (JAC)

  14. 2000 Johnston Site 3A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  15. 2000 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  16. 2000 Johnston Site 2A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  17. 2006 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  18. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  19. Barron's AP English literature and composition

    CERN Document Server

    Ehrenhaft EdD, George

    2016-01-01

    Includes five full-length practice AP exams with all questions answered and explained. Also features additional reviews on poetry, fiction, and drama, definitions of 175 literary and rhetorical terms, and more. Can be purchased alone or with an optional CD-ROM with two additional practice tests.

  20. Ethernet ring protection with managed FDB using APS payload

    Science.gov (United States)

    Im, Jinsung; Ryoo, Jeong-dong; Joo, Bheom Soon; Rhee, J.-K. Kevin

    2007-11-01

    Ethernet ring protection (ERP) is a new technology based on OAM (operations, administration, and maintenance) being standardized by the ITU-T G.8032 working group. In this paper, we present the recent development of Ethernet ring protection which is called FDB (filtering database) flush scheme and propose a new Ethernet ring protection technique introducing a managed FDB using APS to deliver information how to fix FDB selectively. We discuss the current development of the ERP technology at ITU-T and performance comparisons between different proposals.

  1. Comparative efficacy and safety of topical permethrin, topical ivermectin, and oral ivermectin in patients of uncomplicated scabies

    Directory of Open Access Journals (Sweden)

    Sunita B Chhaiya

    2012-01-01

    Full Text Available Background: Ivermectin has opened a new era in the management of scabies as orally effective drug. However, topical route has been little explored for ivermectin. Aims: To compare the efficacy and safety of topical permethrin, oral ivermectin, and topical ivermectin in the treatment of uncomplicated scabies. Methods: This was an open-label, randomized, comparative, parallel clinical trial conducted in 315 patients, randomly allocated to 3 groups. First group received permethrin 5% cream as single application, second group received tablet ivermectin 200 mcg/kg as single dose, and third group received ivermectin 1% lotion as single application. All the patients received anti-histaminic for pruritus. The patients were followed up at intervals of 1, 2, 3, and 4 weeks. If there were no signs of cure, the same intervention was repeated at each follow up. Primary efficacy variable was clinical cure of lesions. Statistical analysis was done by chi square test and one way ANOVA test using SPSS version 12. Results: At the end of first week, cure rate was 74.8% in permethrin group, 30% in oral ivermectin group, and 69.3% in topical ivermectin group (P < 0.05. At the end of second week, cure rate was 99% in permethrin group, 63% in oral ivermectin group, and 100% in topical ivermectin group (P < 0.05. At the end of third week, 100% cure rate was observed in permethrin and topical ivermectin group while 99% in oral ivermectin group (P = 0.367. No serious adverse events were observed. Conclusions: Permethrin and topical ivermectin were equally effective against scabies while oral ivermectin was significantly less effective up to 2 weeks. Topical ivermectin can be used as an alternative to permethrin.

  2. The topical treatment of psoriasis.

    NARCIS (Netherlands)

    Kerkhof, P.C.M. van de; Vissers, W.H.P.M.

    2003-01-01

    According to the patients, improvement of efficacy, long-term safety and improvement of compliance are needed. The topical treatment has been innovated during the last decade. Most important are the introduction of two new classes of treatments: topical vitamin D(3) analogues and the retinoid tazaro

  3. Topics of Evolutionary Computation 2001

    DEFF Research Database (Denmark)

    Ursem, Rasmus Kjær

    This booklet contains the student reports from the course: Topics of Evolutionary Computation, Fall 2001, given by Thiemo Krink, Rene Thomsen and Rasmus K. Ursem......This booklet contains the student reports from the course: Topics of Evolutionary Computation, Fall 2001, given by Thiemo Krink, Rene Thomsen and Rasmus K. Ursem...

  4. Group typicality, group loyalty and cognitive development.

    Science.gov (United States)

    Patterson, Meagan M

    2014-09-01

    Over the course of childhood, children's thinking about social groups changes in a variety of ways. Developmental Subjective Group Dynamics (DSGD) theory emphasizes children's understanding of the importance of conforming to group norms. Abrams et al.'s study, which uses DSGD theory as a framework, demonstrates the social cognitive skills underlying young elementary school children's thinking about group norms. Future research on children's thinking about groups and group norms should explore additional elements of this topic, including aspects of typicality beyond loyalty.

  5. Modern topics in theoretical nuclear physics

    OpenAIRE

    Jennings, B. K.; Schwenk, A.

    2005-01-01

    Over the past five years there have been profound advances in nuclear physics based on effective field theory and the renormalization group. In this brief, we summarize these advances and discuss how they impact our understanding of nuclear systems and experiments that seek to unravel their unknowns. We discuss future opportunities and focus on modern topics in low-energy nuclear physics, with special attention to the strong connections to many-body atomic and condensed matter physics, as wel...

  6. AE8/AP8 Implementations in AE9/AP9, IRBEM, and SPENVIS

    Science.gov (United States)

    2014-02-18

    period applies to orbit generation only; AE8/AP8 utilizes geomagnetic field models from other epochs as specified in the table below.) SHIELDOSE2 model...Cain, J. C., S. J. Hendricks, R. A. Langel, and W. V. Hudson (1967), A proposed model for the international geomagnetic reference field, 1965, J...trapped particle fluxes with the NASA models AP-8 and AE-8, Radiat. Meas., 26, pp. 947-952. International Association of Geomagnetism and Aeronomy

  7. Mental Mechanisms for Topics Identification

    Directory of Open Access Journals (Sweden)

    Louis Massey

    2014-01-01

    Full Text Available Topics identification (TI is the process that consists in determining the main themes present in natural language documents. The current TI modeling paradigm aims at acquiring semantic information from statistic properties of large text datasets. We investigate the mental mechanisms responsible for the identification of topics in a single document given existing knowledge. Our main hypothesis is that topics are the result of accumulated neural activation of loosely organized information stored in long-term memory (LTM. We experimentally tested our hypothesis with a computational model that simulates LTM activation. The model assumes activation decay as an unavoidable phenomenon originating from the bioelectric nature of neural systems. Since decay should negatively affect the quality of topics, the model predicts the presence of short-term memory (STM to keep the focus of attention on a few words, with the expected outcome of restoring quality to a baseline level. Our experiments measured topics quality of over 300 documents with various decay rates and STM capacity. Our results showed that accumulated activation of loosely organized information was an effective mental computational commodity to identify topics. It was furthermore confirmed that rapid decay is detrimental to topics quality but that limited capacity STM restores quality to a baseline level, even exceeding it slightly.

  8. Dosimetry: an ARDENT topic

    CERN Multimedia

    CERN Bulletin

    2012-01-01

    The first annual ARDENT workshop took place in Vienna from 20 to 23 November. The workshop gathered together the Early-Stage Researchers (ESR) and their supervisors, plus other people involved from all the participating institutions.   “The meeting, which was organised with the local support of the Austrian Institute of Technology, was a nice opportunity for the ESRs to get together, meet each other, and present their research plans and some preliminary results of their work,” says Marco Silari, a member of CERN Radiation Protection Group and the scientist in charge of the programme. Two full days were devoted to a training course on radiation dosimetry, delivered by renowned experts. The workshop closed with a half-day visit to the MedAustron facility in Wiener Neustadt. ARDENT (Advanced Radiation Dosimetry European Network Training) is a Marie Curie ITN project funded under EU FP7 with €4 million. The project focuses on radiation dosimetry exploiting se...

  9. AP stars with resolved Zeeman split lines

    Science.gov (United States)

    Mathys, G.

    1990-06-01

    High-resolution, high SNR observations of a sample of sharp-lined A stars and of Ap stars showing resolved Zeeman split lines are presented. The Fe II lines 6147.7 A and 6149.2 A unexpectedly appear to be asymmetric in all stars where they are resolved. The blue component of the 6149.2 line, which is a Zeeman doublet, is deeper and narrower than its red component. For line 6147.7, whose Zeeman pattern does not differ much from a quadruplet, the red components are deeper than the blue ones. It is shown that a partial Paschen-Back effect can account for these properties. The potential implications of this finding for studies of magnetic Ap stars are discussed.

  10. Seven topics in functional magnetic resonance imaging.

    Science.gov (United States)

    Bandettini, Peter A

    2009-09-01

    Functional MRI (fMRI) is a non-invasive brain imaging methodology that started in 1991 and allows human brain activation to be imaged at high resolution within only a few minutes. Because it has extremely high sensitivity, is relatively easy to implement, and can be performed on most standard clinical MRI scanners. It continues to grow at an explosive rate throughout the world. Over the years, at any given time, fMRI has been defined by only a handful of major topics that have been the focus of researchers using and developing the methodology. In this review, I attempt to take a snapshot of the field of fMRI as it is in mid-2009 by discussing the seven topics that I feel are most on the minds of fMRI researchers. The topics are, in no particular order or grouping: (1) Clinical impact, (2) Utilization of individual functional maps, (3) fMRI signal interpretation, (4) Pattern effect mapping and decoding, (5) Endogenous oscillations, (6) MRI technology, and (7) Alternative functional contrast mechanisms. Most of these topics are highly interdependent, each advancing as the others advance. While most fMRI involves applications towards clinical or neuroscience questions, all applications are fundamentally dependent on advances in basic methodology as well as advances in our understanding of the relationship between neuronal activity and fMRI signal changes. This review neglects almost completely an in-depth discussion of applications. Rather the discussions are on the methods and interpretation.

  11. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-04-19

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report.

  12. An Updated AP2 Beamline TURTLE Model

    Energy Technology Data Exchange (ETDEWEB)

    Gormley, M.; O' Day, S.

    1991-08-23

    This note describes a TURTLE model of the AP2 beamline. This model was created by D. Johnson and improved by J. Hangst. The authors of this note have made additional improvements which reflect recent element and magnet setting changes. The magnet characteristics measurements and survey data compiled to update the model will be presented. A printout of the actual TURTLE deck may be found in appendix A.

  13. Using DCAT-AP for research data

    OpenAIRE

    PEREGO ANDREA; FRIIS-CHRISTENSEN Anders; VACCARI LORENZINO; TSINARAKI CHRYSI

    2016-01-01

    This paper outlines a set cross-domain requirements for the documentation of scientific data, identified during the development of the corporate data catalogue of the European Commission's Joint Research Centre (JRC). In particular, we illustrate how we have extended the DCAT application profile for European data portals (DCAT-AP) to accomodate requirements for scientific datasets, and we discuss a number of issues still to be addressed.

  14. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  15. The use of focus groups to investigate sensitive topics: an example taken from research on adolescent girls' perceptions about sexual risks O uso de grupos focais para investigar temas de natureza íntima: exemplo de uma pesquisa sobre pontos de vista de meninas adolescentes acerca dos riscos do sexo

    Directory of Open Access Journals (Sweden)

    Dora Lucia de Oliveira

    2011-07-01

    Full Text Available The methodology of focus groups has been increasingly employed in the context of research in the social sciences, particularly in health-related inquiries. Considerations about the sensitive aspects of such research are not, however, very often seen in research reports or discussion on ways of conducting sensitive research. The scope of this paper is to share an experience of conducting focus group research on sensitive topics, such as AIDS, risk and sexual issues, highlighting some methodological issues. More specifically, it suggests ways of working with teenage girls in focus groups about sensitive topics. The advantages of the use of focus groups to explore views on HIV/AIDS and other sexual risks are also discussed. Socio-cultural approaches to risk and feminist thinking permeate the main arguments.A metodologia de grupos focais tem sido cada vez mais usada em pesquisas no campo das ciências sociais, particularmente em investigações relacionadas à saúde. Considerações sobre os aspectos de natureza íntima que permeiam estas pesquisas não são, contudo, muito frequentemente vistas em relatórios de pesquisa, nem em discussões sobre as maneiras de se conduzir tais pesquisas. O objetivo deste artigo é compartilhar uma experiência de pesquisa com grupos focais sobre temas de natureza íntima, tais como AIDS, risco e sexualidade, destacando algumas questões metodológicas. Mais especificamente, o artigo sugere maneiras para desenvolver este tipo de pesquisa com meninas adolescentes. As vantagens do uso de grupos focais para explorar pontos de vista sobre HIV/AIDS e outros riscos sexuais são também discutidas. Abordagens sócio-culturais sobre risco e o pensamento feminista formam os principais argumentos.

  16. Structural Determinants of DNA Binding by a P. falciparum ApiAP2 Transcriptional Regulator

    Energy Technology Data Exchange (ETDEWEB)

    Lindner, Scott E.; De Silva, Erandi K.; Keck, James L.; Llinás, Manuel (Princeton); (UW-MED)

    2010-11-05

    Putative transcription factors have only recently been identified in the Plasmodium spp., with the major family of regulators comprising the Apicomplexan Apetala2 (AP2) proteins. To better understand the DNA-binding mechanisms of these transcriptional regulators, we characterized the structure and in vitro function of an AP2 DNA-binding domain from a prototypical Apicomplexan AP2 protein, PF14{_}0633 from Plasmodium falciparum. The X-ray crystal structure of the PF14{_}0633 AP2 domain bound to DNA reveals a {beta}-sheet fold that binds the DNA major groove through base-specific and backbone contacts; a prominent {alpha}-helix supports the {beta}-sheet structure. Substitution of predicted DNA-binding residues with alanine weakened or eliminated DNA binding in solution. In contrast to plant AP2 domains, the PF14{_}0633 AP2 domain dimerizes upon binding to DNA through a domain-swapping mechanism in which the {alpha}-helices of the AP2 domains pack against the {beta}-sheets of the dimer mates. DNA-induced dimerization of PF14{_}0633 may be important for tethering two distal DNA loci together in the nucleus and/or for inducing functional rearrangements of its domains to facilitate transcriptional regulation. Consistent with a multisite binding mode, at least two copies of the consensus sequence recognized by PF14{_}0633 are present upstream of a previously identified group of sporozoite-stage genes. Taken together, these findings illustrate how Plasmodium has adapted the AP2 DNA-binding domain for genome-wide transcriptional regulation.

  17. Color stability of esthetic restorative material after topical fluoride application

    OpenAIRE

    2015-01-01

    AIM: Present study was conducted to compare the effect of topical fluoride agents on color change of three aesthetic restorative materials. MATERIAL AND METHODS: Restorative material used were Ketac Fill type II (GIC), Filtek Z350(Composite) and Beuttifull II (Giomer). Topical Fluorides used were Pascal (1.23% APF gel) and Fluoride Varnish (Bifluoride). 24 samples of each restorative material were prepared, which were divided into 8 each, among three groups. Treatment of Group A with APF gel,...

  18. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (II): thrombocytopenia and skin manifestations.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyze the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations, and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analyzed on thrombocytopenia and skin manifestations, and presents the recommendations elaborated by the Task Force after this analysis.

  19. Erythromycin and Benzoyl Peroxide Topical

    Science.gov (United States)

    The combination of erythromycin and benzoyl peroxide is used to treat acne. Erythromycin and benzoyl peroxide are in a class of medications called topical antibiotics. The combination of erythromycin ...

  20. Clindamycin and Benzoyl Peroxide Topical

    Science.gov (United States)

    The combination of clindamycin and benzoyl peroxide is used to treat acne. Clindamycin and benzoyl peroxide are in a class of medications called topical antibiotics. The combination of clindamycin ...

  1. Cotidiano de portadores de esquizofrenia após uso de clozapina e acompanhamento grupal El cotidiano de portadores de esquizofrenia después del uso de clozapina y acompañamiento del grupo Daily life of schizofrenia patients after the use of clozapine and group follow up

    Directory of Open Access Journals (Sweden)

    Ana Maria Sertori Durão

    2007-06-01

    Full Text Available Este estudo descreve a visão do portador de esquizofrenia sobre seu cotidiano após o uso da clozapina e acompanhamento em grupo. A amostra foi constituída por 11 pacientes que participam do grupo de medicações atípicas (GRUMA do Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto-USP. Para coleta de dados, utilizou-se uma entrevista semi-estruturada, guiada por um roteiro, em abril de 2003. As entrevistas foram gravadas e, posteriormente, transcritas na íntegra. Obteve-se, como resultados, melhora do paciente quanto aos sintomas da doença, evidenciada pela diminuição do isolamento social, retomada das atividades domésticas/trabalho, estudo e participação em atividades de convívio social. Tais resultados apontam para a necessidade de um novo olhar dirigido ao portador de transtorno mental, no sentido de buscar atitudes terapêuticas adequadas, que atuem na produção de vida, visando a um novo sentido para a existência, nas diferentes formas de convivência e de sociabilidade.Este estudio describió el punto de vista de los portadores de esquizofrenia en su cotidiano después del uso de clozapina y acompañamiento en grupo. La muestra fue constituida por 11 portadores de esquizofrenia que participaron del grupo de medicación clozapina del Hospital das Clínicas de Ribeirao Preto/USP. Para la colección de datos se utilizó una entrevista orientada por guión, en abril de 2003. Las entrevistas fueron registradas y después transcritas por entero. Los resultados indicaron la mejoría de los pacientes con respecto a los síntomas de la enfermedad, evidenciada por la disminución del aislamiento social, recomienzo de actividades domésticas/trabajo, estudio y participación en actividades de convivencia social. Tales resultados señalan la necesidad de una nueva manera de mirar el portador de trastorno mental y sus familiares en el sentido de buscar actitudes terapéuticas que actúen en la producción de vida, en un

  2. Linguistic Extensions of Topic Models

    Science.gov (United States)

    2010-09-01

    class of corpora and would help monolingual users to explore and understand multilingual corpora. In this chapter, we develop multilingual LDAWN, an... Multilingual Priors As in the case of a monolingual walk over the concept hierarchy, we want to provide guidance to the multilingual model as to which parts...topic models for new datasets, such as unaligned multilingual corpora, and combine topic models with other sources of information about documents’ context

  3. Topics of Bioengineering in Wikipedia

    Directory of Open Access Journals (Sweden)

    Vassia Atanassova

    2009-10-01

    Full Text Available The present report aims to give a snapshot of how topics from the field of bioengineering (bioinformatics, bioprocess systems, biomedical engineering, biotechnology, etc. are currently covered in the free electronic encyclopedia Wikipedia. It also offers insights and information about what Wikipedia is, how it functions, how and when to cite Wikipedian articles, if necessary. Several external wikis, devoted to topics of bioengineering, are also listed and reviewed.

  4. Topics in modern differential geometry

    CERN Document Server

    Verstraelen, Leopold

    2017-01-01

    A variety of introductory articles is provided on a wide range of topics, including variational problems on curves and surfaces with anisotropic curvature. Experts in the fields of Riemannian, Lorentzian and contact geometry present state-of-the-art reviews of their topics. The contributions are written on a graduate level and contain extended bibliographies. The ten chapters are the result of various doctoral courses which were held in 2009 and 2010 at universities in Leuven, Serbia, Romania and Spain.

  5. High death rate in mice treated topically with diclofenac

    DEFF Research Database (Denmark)

    Lerche, Catharina M; Philipsen, Peter A; Poulsen, Thomas

    2011-01-01

    Recently, 3% diclofenacnatrium gel (diclofenac) was introduced for the treatment of actinic keratoses. Data on photocarcinogenesis of topical diclofenac are limited, and we wished to investigate whether topical diclofenac can accelerate photocarcinogenesis using simulated solar radiation (SSR......). Diclofenac was applied topically on the backs of hairless, female, C3.Cg/TifBomTac immunocompetent mice three times weekly followed by ultraviolet radiation (2, 3, or 4 Standard Erythema Dose) until death. There was a significant difference in survival between diclofenac-treated groups and control groups (P...

  6. Inhibition of Corneal Neovascularization by Topical and Subconjunctival Tigecycline

    Directory of Open Access Journals (Sweden)

    Sertan Goktas

    2014-01-01

    Full Text Available Objective. To investigate the effects of topical and subconjunctival tigecycline on the prevention of corneal neovascularization. Materials and Methods. Following chemical burn, thirty-two rats were treated daily with topical instillation of 1 mg/mL tigecycline (group 1 or subconjunctival instillation of 1 mg/mL tigecycline (group 3 for 7 days. Control rats received topical (group 2 or subconjunctival (group 4 0.9% saline. Digital photographs of the cornea were taken on the eighth day after treatment and analyzed to determine the percentage area of the cornea covered by neovascularization. Corneal sections were analyzed histopathologically. Results. The median percentages of corneal neovascularization in groups 1 and 3 were 48% (95% confidence interval (CI, 44.2–55.8% and 33.5% (95% CI, 26.6–39.2%, respectively. The median percentages of corneal neovascularization of groups 1 and 3 were significantly lower than that of the control group (P=0.03 and P<0.001, resp.. Histologic examination of samples from groups 1 and 3 showed lower vascularity than that of control groups. Conclusion. Topical and subconjunctival administration of tigecycline seems to be showing promising therapeutic effects on the prevention of corneal neovascularization. Furthermore, subconjunctival administration of tigecycline is more potent than topical administration in the inhibition of corneal neovascularization.

  7. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms...... or copy number variations in the AIRE gene were associated with AAD and APS II. First, nine SNPs in the AIRE gene were analyzed in 311 patients with AAD and APS II and 521 healthy controls, identifying no associated risk. Second, in a subgroup of 25 of these patients, AIRE sequencing revealed three novel...... polymorphisms. Finally, the AIRE copy number was determined by duplex quantitative PCR in 14 patients with APS I, 161 patients with AAD and APS II and in 39 healthy subjects. In two Scandinavian APS I patients previously reported to be homozygous for common AIRE mutations, we identified large deletions...

  8. Analysis list: CASP8AP2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available CASP8AP2 Digestive tract + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CAS...P8AP2.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/CASP8AP2.5.tsv http://dbarchive.bi...osciencedbc.jp/kyushu-u/hg19/target/CASP8AP2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/CAS

  9. Representation Theory of Algebraic Groups and Quantum Groups

    CERN Document Server

    Gyoja, A; Shinoda, K-I; Shoji, T; Tanisaki, Toshiyuki

    2010-01-01

    Invited articles by top notch expertsFocus is on topics in representation theory of algebraic groups and quantum groupsOf interest to graduate students and researchers in representation theory, group theory, algebraic geometry, quantum theory and math physics

  10. Arsenic may be involved in fluoride-induced bone toxicity through PTH/PKA/AP1 signaling pathway.

    Science.gov (United States)

    Zeng, Qi-bing; Xu, Yu-yan; Yu, Xian; Yang, Jun; Hong, Feng; Zhang, Ai-hua

    2014-01-01

    Chronic exposure to combined fluoride and arsenic continues to be a major public health problem worldwide, affecting thousands of people. In recent years, more and more researchers began to focus on the interaction between the fluorine and the arsenic. In this study, the selected investigation site was located in China. The study group was selected from people living in fluoride-arsenic polluted areas due to burning coal. The total number of participants was 196; including the fluoride-arsenic anomaly group (130) and the fluoride-arsenic normal group (63). By observing the changes in gene and protein expression of PTH/PKA/AP1 signaling pathway, the results show that fluoride can increase the expression levels of PTH, PKA, and AP1, but arsenic can only affect the expression of AP1; fluoride and arsenic have an interaction on the expression of AP1. Further study found that fluoride and arsenic can affect the mRNA expression level of c-fos gene (AP1 family members), and have an interaction on the expression of c-fos, but not c-jun. The results indicate that PTH/PKA/AP1 signaling pathway may play an important role in bone toxicity of fluoride. Arsenic can affect the expression of c-fos, thereby affecting the expression of transcription factor AP1, indirectly involved in fluoride-induced bone toxicity.

  11. Topics in Theoretical Physics

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, Andrew [Boston Univ., MA (United States); Schmaltz, Martin [Boston Univ., MA (United States); Katz, Emmanuel [Boston Univ., MA (United States); Rebbi, Claudio [Boston Univ., MA (United States); Glashow, Sheldon [Boston Univ., MA (United States); Brower, Richard [Boston Univ., MA (United States); Pi, So-Young [Boston Univ., MA (United States)

    2016-09-30

    This award supported a broadly based research effort in theoretical particle physics, including research aimed at uncovering the laws of nature at short (subatomic) and long (cosmological) distances. These theoretical developments apply to experiments in laboratories such as CERN, the facility that operates the Large Hadron Collider outside Geneva, as well as to cosmological investigations done using telescopes and satellites. The results reported here apply to physics beyond the so-called Standard Model of particle physics; physics of high energy collisions such as those observed at the Large Hadron Collider; theoretical and mathematical tools and frameworks for describing the laws of nature at short distances; cosmology and astrophysics; and analytic and computational methods to solve theories of short distance physics. Some specific research accomplishments include + Theories of the electroweak interactions, the forces that give rise to many forms of radioactive decay; + Physics of the recently discovered Higgs boson. + Models and phenomenology of dark matter, the mysterious component of the universe, that has so far been detected only by its gravitational effects. + High energy particles in astrophysics and cosmology. + Algorithmic research and Computational methods for physics of and beyond the Standard Model. + Theory and applications of relativity and its possible limitations. + Topological effects in field theory and cosmology. + Conformally invariant systems and AdS/CFT. This award also supported significant training of students and postdoctoral fellows to lead the research effort in particle theory for the coming decades. These students and fellows worked closely with other members of the group as well as theoretical and experimental colleagues throughout the physics community. Many of the research projects funded by this grant arose in response to recently obtained experimental results in the areas of particle physics and cosmology. We describe a few of

  12. Selecting a Topic in Public Speaking

    Institute of Scientific and Technical Information of China (English)

    刘玉霞

    2013-01-01

    The first step in speechmaking is choosing a topic, which will decide the success of the speech. In the paper, we are go⁃ing to discuss how to select a topic in public speaking, and we’ll mainly talk about the following: the speaker, the occasion and the audience, selecting a topic, specific methods for choosing a topic and available topics.

  13. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  14. Topical agents in burn care

    Directory of Open Access Journals (Sweden)

    Momčilović Dragan

    2002-01-01

    Full Text Available Introduction Understanding of fluid shifts and recognition of the importance of early and appropriate fluid replacement therapy have significantly reduced mortality in the early post burn period. After the bum patient successfully passes the resuscitation period, the burn wound represents the greatest threat to survival. History Since the dawn of civilization, man has been trying to find an agent which would help burn wounds heal, and at the same time, not harm general condition of the injured. It was not until the XX century, after the discovery of antibiotics, when this condition was fulfilled. In 1968, combining silver and sulfadiazine, fox made silver-sulfadiazine, which is a 1% hydro-soluble cream and a superior agent in topical treatment of burns today. Current topical agents None of the topical antimicrobial agents available today, alone or combined, have the characteristics of ideal prophylactic agents, but they eliminate colonization of burn wound, and invasive infections are infrequent. With an excellent spectrum of activity, low toxicity, and ease of application with minimal pain, silver-sulfadiazine is still the most frequently used topical agent. Conclusion The incidence of invasive infections and overall mortality have been significantly reduced after introduction of topical burn wound antimicrobial agents into practice. In most burn patients the drug of choice for prophylaxis is silver sulfadiazine. Other agents may be useful in certain clinical situations.

  15. Prediction of three-dimensional femoral offset from AP pelvis radiographs in primary hip osteoarthritis

    Energy Technology Data Exchange (ETDEWEB)

    Merle, C., E-mail: christian.merle@med.uni-heidelberg.de [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Waldstein, W., E-mail: wwaldstein@gmail.com [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Pegg, E.C., E-mail: elise.pegg@ndorms.ox.ac.uk [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Streit, M.R., E-mail: marcus.streit@med.uni-heidelberg.de [Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Gotterbarm, T., E-mail: tobias.gotterbarm@med.uni-heidelberg.de [Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Aldinger, P.R., E-mail: peter.aldinger@diak-stuttgart.de [Department of Orthopaedic Surgery, Paulinenhilfe, Diakonieklinikum, Stuttgart (Germany); Murray, D.W., E-mail: david.murray@ndorms.ox.ac.uk [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Gill, H.S., E-mail: r.gill@bath.ac.uk [Department of Mechanical Engineering, University of Bath (United Kingdom)

    2013-08-15

    Background: In pre-operative planning for total hip arthroplasty (THA), femoral offset (FO) is frequently underestimated on AP pelvis radiographs as a result of inaccurate patient positioning, imprecise magnification, and radiographic beam divergence. The aim of the present study was to evaluate the accuracy and reliability of predicting three-dimensional (3-D) FO from standardised AP pelvis radiographs. Methods: In a retrospective cohort study, pre-operative AP pelvis radiographs, AP hip radiographs and CT scans of a consecutive series of 345 patients (345 hips, 146 males, 199 females, mean age 60 (range: 40–79) years, mean body-mass-index 27 (range: 19–57) kg/m{sup 2}) with primary end-stage hip OA were reviewed. Patients were positioned according to a standardised protocol and all images were calibrated. Using validated custom programmes, FO was measured on corresponding radiographs and CT scans. Measurement reliability was evaluated using intra-class-correlation-coefficients. To predict 3-D FO from AP pelvis measurements and to assess the accuracy compared to CT, the entire cohort was randomly split into subgroups A and B. Gender specific regression equations were derived from group A (245 patients) and the accuracy of prediction was evaluated in group B (100 patients) using Bland–Altman plots. Results: In the entire cohort, mean FO was 39.2 mm (95%CI: 38.5–40.0 mm) on AP pelvis radiographs, 44.1 mm (95%CI: 43.4–44.9 mm) on AP hip radiographs and 44.6 mm (95%CI: 44.0–45.2 mm) on CT scans. In group B, we observed no significant difference between gender specific predicted FO (males: 48.0 mm, 95%CI: 47.1–48.8 mm; females: 42.0 mm, 95%CI: 41.1–42.8 mm) and FO as measured on CT (males: 47.7 mm, 95%CI: 46.1–49.4 mm, p = 0.689; females: 41.6 mm, 95%CI: 40.3–43.0 mm, p = 0.607). Conclusions: The present study suggests that FO can be accurately and reliably predicted from AP pelvis radiographs in patients with primary end-stage hip osteoarthritis

  16. Ozone mitigation tests at the APS

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.; Collins, J.T.; Pisharody, M.; Job, P.K.; Wang Zhibi

    1996-09-01

    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented.

  17. Quantum mechanics II advanced topics

    CERN Document Server

    Rajasekar, S

    2015-01-01

    Quantum Mechanics II: Advanced Topics uses more than a decade of research and the authors’ own teaching experience to expound on some of the more advanced topics and current research in quantum mechanics. A follow-up to the authors introductory book Quantum Mechanics I: The Fundamentals, this book begins with a chapter on quantum field theory, and goes on to present basic principles, key features, and applications. It outlines recent quantum technologies and phenomena, and introduces growing topics of interest in quantum mechanics. The authors describe promising applications that include ghost imaging, detection of weak amplitude objects, entangled two-photon microscopy, detection of small displacements, lithography, metrology, and teleportation of optical images. They also present worked-out examples and provide numerous problems at the end of each chapter.

  18. Topical therapies in hyperhidrosis care.

    Science.gov (United States)

    Pariser, David M; Ballard, Angela

    2014-10-01

    Primary focal hyperhidrosis affects 3% of the US population; about the same number as psoriasis. More than half of these patients have primary focal axillary hyperhidrosis: sweating that is beyond what is anticipated or necessary for thermoregulation. Most topical therapies are based on aluminum salts, which work by a chemical reaction that forms plugs in the eccrine sweat ducts. Topical anticholinergics may also be used. Instruction on proper methods and timing of antiperspirants enhances effect and may be effective alone or in combination with other treatments in patients with hyperhidrosis.

  19. Topics in current aerosol research

    CERN Document Server

    Hidy, G M

    1971-01-01

    Topics in Current Aerosol Research deals with the fundamental aspects of aerosol science, with emphasis on experiment and theory describing highly dispersed aerosols (HDAs) as well as the dynamics of charged suspensions. Topics covered range from the basic properties of HDAs to their formation and methods of generation; sources of electric charges; interactions between fluid and aerosol particles; and one-dimensional motion of charged cloud of particles. This volume is comprised of 13 chapters and begins with an introduction to the basic properties of HDAs, followed by a discussion on the form

  20. Topics in millimeter wave technology

    CERN Document Server

    Button, Kenneth

    1988-01-01

    Topics in Millimeter Wave Technology, Volume 1 presents topics related to millimeter wave technology, including fin-lines and passive components realized in fin-lines, suspended striplines, suspended substrate microstrips, and modal power exchange in multimode fibers. A miniaturized monopulse assembly constructed in planar waveguide with multimode scalar horn feeds is also described. This volume is comprised of five chapters; the first of which deals with the analysis and synthesis techniques for fin-lines as well as the various passive components realized in fin-line. Tapers, discontinuities,

  1. Comparative evaluation of topical Sodium fusidate cream in common pyodermas with topical gentamicin ointment and systemic antibiotics

    Directory of Open Access Journals (Sweden)

    Roy AK

    1996-01-01

    Full Text Available ABSTRACT: One hundred cases of common pyodermas consisting of four groups, namely impetigo, furunculosis and chronic folliculitis were taken. Each group containing twenty five cases were divided again into three subgroups. From each group, 15 were treated with 2 percent Sodium fusidate cream, 5 were with 0.1 percent Gentamycin sulphate cream and the rest 5 with systemic Erythromycin stearate. In the group of Impetigo, Bockhart′s Impetigo and Furunculosis, topical Sodium fusidate cream showed excellent result, better than Gentamycin topical and equal to that of systemic Erythromycin stearate.

  2. The Electronic ApJ in Context

    Science.gov (United States)

    Biemesderfer, C. D.

    1995-12-01

    The on-line edition of the Astrophysical Journal provides the first opportunity for astronomical researchers to interact with the literature in a network context. Other electronic journals will follow. Astronomers will continue to develop ways to take advantage of information on the network, and these will be most effective when ApJ articles, observations from data centers, proposals for telescope time, communications with collaborators, and so on, are meshed. Astronomical literature, as a resource on the Internet, is not unique from the viewpoint of function or management, and astronomers are not unique as scholars in their desire to use the Internet as a tool to advance their work. We need to ensure as a community that all our resources for research --- journals and data --- fit in a global context on an Internet being used by everyone. In other words, we have to be sure that the ApJ fits into all the digital libraries of the future, including the ones we don't build. This paper will present a scenario in which many varied forms of information, astronomical and otherwise, can be catalogued and distributed so that they can be discovered and used by the research community.

  3. SN 2005ap: A Most Brilliant Explosion

    CERN Document Server

    Quimby, Robert M; Wheeler, J Craig; Höflich, Peter; Akerlof, Carl W; Rykoff, Eli S

    2007-01-01

    We present unfiltered photometric observations with ROTSE-III and optical spectroscopic follow-up with the HET and Keck of the most luminous supernova yet identified, SN 2005ap. The spectra taken about 3 days before and 6 days after maximum light show narrow emission lines (likely originating in the dwarf host) and absorption lines at a redshift of z=0.2832, which puts the peak unfiltered magnitude at -22.7 +/- 0.1 absolute. Broad P-Cygni features corresponding to H-alpha, CIII, NIII, and OIII, are further detected with a photospheric velocity of ~20,000 km/s. Unlike other highly luminous supernovae such as 2006gy and 2006tf that show slow photometric evolution, the light curve of SN 2005ap indicates a 1-3 week rise to peak followed by a relatively rapid decay. The spectra also lack the distinct emission peaks from moderately broadened (FWHM ~ 2,000 km/s) Balmer lines seen in SN 2006gy and SN 2006tf. We briefly discuss the origin of the extraordinary luminosity from a strong interaction as may be expected fro...

  4. Automatic Labelling of Topics with Neural Embeddings

    OpenAIRE

    Bhatia, Shraey; Lau, Jey Han; Baldwin, Timothy

    2016-01-01

    Topics generated by topic models are typically represented as list of terms. To reduce the cognitive overhead of interpreting these topics for end-users, we propose labelling a topic with a succinct phrase that summarises its theme or idea. Using Wikipedia document titles as label candidates, we compute neural embeddings for documents and words to select the most relevant labels for topics. Compared to a state-of-the-art topic labelling system, our methodology is simpler, more efficient, and ...

  5. Application of Topic Map on Knowledge Organization

    Directory of Open Access Journals (Sweden)

    Sou-shan Wu

    2003-06-01

    Full Text Available Knowledge management (KM has received much attention from both academics and practitioners in the past few years. Following the KM trend, many organizations have built their own knowledge repositories or data warehouses. However, information or knowledge is still scattered everywhere without being properly managed. The rapid growth of the Internet accelerates the creation of unstructured and unclassified information and causes the explosion of information overload. The effort of browsing information through general-purpose search engines turns out to be tedious and painstaking. Hence, an effective technology to solve this information retrieval problem is much needed. The purpose of this research is to explore the application of text mining technique in organizing knowledge stored in unstructured natural language text documents. Major components of text mining techniques required for topic map in particular will be presented in detail.Two sets of unstructured documents are utilized to demonstrate the usage of SOM for topic categorization. The first set of documents is a collection of speeches given by Y.C. Wang, Chairman of the Taiwan Plastics Group, and the other is the collection of all laws and regulations related to securities and future markets in Taiwan. We also try to apply text mining to these two sets of documents to generate their respective topic maps, thus revealing the differences between organizing explicit and tacit knowledge as well as the difficulties associated with tacit knowledge.[Article content in Chinese

  6. Trichomonas vaginalis: the adhesins AP51 and AP65 bind heme and hemoglobin.

    Science.gov (United States)

    Ardalan, Shahed; Lee, B Craig; Garber, Gary E

    2009-04-01

    Trichomonas vaginalis is the cause of human trichomoniasis, the most common non-viral sexually transmitted disease worldwide. Although acquisition of iron by binding to host hemoglobin through distinct receptor(s) has been described, no specific heme- or hemoglobin-binding site has been reported in this parasite. To determine the presence of hemoglobin-binding protein(s), membrane proteins were subjected to hemoglobin-affinity chromatography. Eluted proteins were analysed by SDS-PAGE. Two protein bands of 48 and 63 kDa were detected. Competition assay with an excess amount of hemoglobin or hemin in hemoglobin-affinity chromatography could block the 63- and 48-kDa bands, respectively. Further analysis by mass spectrometry indicated that the 48- and 63-kDa proteins had identity with two T. vaginalis adhesins: AP51 and AP65, respectively. This study confirms the existence of multifunctional proteins in T. vaginalis, and suggested that AP51 and AP65, besides serving as adhesion molecules, could also act as heme- and hemoglobin-binding proteins.

  7. Seven topics in perturbative QCD

    Energy Technology Data Exchange (ETDEWEB)

    Buras, A.J.

    1980-09-01

    The following topics of perturbative QCD are discussed: (1) deep inelastic scattering; (2) higher order corrections to e/sup +/e/sup -/ annihilation, to photon structure functions and to quarkonia decays; (3) higher order corrections to fragmentation functions and to various semi-inclusive processes; (4) higher twist contributions; (5) exclusive processes; (6) transverse momentum effects; (7) jet and photon physics.

  8. The Health Curriculum: 500 Topics.

    Science.gov (United States)

    Byrd, Oliver E.

    2001-01-01

    This 1958 paper divides 500 health topics into 20 categories: health as a social accomplishment/social problem; nutrition; physical fitness; mental health and disease; heredity/eugenics; infection/immunity; chronic and degenerative disease; substance abuse; skin care; vision, hearing, and speech; dental health; safety; physical environment; health…

  9. Topics in combinatorial pattern matching

    DEFF Research Database (Denmark)

    Vildhøj, Hjalte Wedel

    This dissertation studies problems in the general theme of combinatorial pattern matching. More specifically, we study the following topics: Longest Common Extensions. We revisit the longest common extension (LCE) problem, that is, preprocess a string T into a compact data structure that supports...

  10. The pharmacology of topical analgesics.

    Science.gov (United States)

    Barkin, Robert L

    2013-07-01

    Pain management of patients continues to pose challenges to clinicians. Given the multiple dimensions of pain--whether acute or chronic, mild, moderate, or severe, nociceptive or neuropathic--a multimodal approach may be needed. Fortunately, clinicians have an array of nonpharmacologic and pharmacologic treatment choices; however, each modality must be chosen carefully, because some often used oral agents are associated with safety and tolerability issues that restrict their use in certain patients. In particular, orally administered nonsteroidal antiinflammatory drugs, opioids, antidepressants, and anticonvulsants are known to cause systemic adverse effects in some patients. To address this problem, a number of topical therapies in various therapeutic classes have been developed to reduce systemic exposure and minimize the risks of patients developing adverse events. For example, topical nonsteroidal anti-inflammatory drug formulations produce a site-specific effect (ie, cyclo-oxygenase inhibition) while decreasing the systemic exposure that may lead to undesired effects in patients. Similarly, derivatives of acetylsalicylic acid (ie, salicylates) are used in topical analgesic formulations that do not significantly enter the patient's systemic circulation. Salicylates, along with capsaicin, menthol, and camphor, compose the counterirritant class of topical analgesics, which produce analgesia by activating and then desensitizing epidermal nociceptors. Additionally, patches and creams that contain the local anesthetic lidocaine, alone or co-formulated with other local anesthetics, are also used to manage patients with select acute and chronic pain states. Perhaps the most common topical analgesic modality is the cautious application of cutaneous cold and heat. Such treatments may decrease pain not by reaching the target tissue through systemic distribution, but by acting more directly on the affected tissue. Despite the tolerability benefits associated with avoiding

  11. Groups, combinatorics and geometry

    CERN Document Server

    Ivanov, A A; Saxl, J

    2003-01-01

    Over the past 20 years, the theory of groups in particular simplegroups, finite and algebraic has influenced a number of diverseareas of mathematics. Such areas include topics where groups have beentraditionally applied, such as algebraic combinatorics, finitegeometries, Galois theory and permutation groups, as well as severalmore recent developments.

  12. Anesthetic effectiveness of topical levobupivacaine 0.75% versus topical proparacaine 0.5% for intravitreal injections

    Directory of Open Access Journals (Sweden)

    Nurgül Örnek

    2014-01-01

    Full Text Available Background and Purpose: Today no method of topical anesthesia for intravitreal injection administration has been proven to make the patient comfortable yet. We compared the efficacy of topical levobupivacaine 0.75% and proparacaine 0.5% in patients undergoing intravitreal injections. Materials and Methods: A prospective, randomized study comparing two agents for topical anesthesia in intravitreal injections. Ninety-six consecutive patients were enrolled into two groups to receive either topical levobupivacaine 0.75% (n=48 or proparacaine 0.5% (n=48. Patients were asked to score their pain using a visual analog scale (VAS immediately following the injection. The average of these scores was used as the primary outcome. The surgeon performing the procedure scored his perception of the patients′ pain using the Wong-Baker FACES scale. Results: Mean VAS pain scores for two groups were found to be 44.77 ± 16.42 and 34.18 ± 14.83, respectively. Mean VAS pain score in the proparacaine group was significantly lower than that in the levobupivacaine group (P= 0.003. Mean Wong-Baker FACES scores for the two groups were 1.08 ± 0.49 and 1.10 ± 0.30, respectively. There was no statistically significant difference between levobupivacaine and proparacaine groups (P=0.824. Conclusions: Topical proparacaine 0.5% was more effective in preventing pain during intravitreal injections.

  13. Pharmacokinetics for topically applied caffeine in the rat.

    Science.gov (United States)

    Kronschläger, Martin; Forsman, Erik; Yu, Zhaohua; Talebizadeh, Nooshin; Löfgren, Stefan; Meyer, Linda M; Bergquist, Jonas; Söderberg, Per

    2014-05-01

    Topically applied caffeine was recently identified as a promising candidate molecule for cataract prevention. Little is known about the pharmacokinetics for topically applied caffeine. Potential toxicity of 72 mM caffeine on the ocular surface and the lens was qualitatively monitored and no toxic effects were observed. The concentration of caffeine was measured in the lens and the blood after topical application of 72 mM caffeine to groups of 10 animals sacrificed at 30, 60, 90 and 120 min after topical application. The lens concentration decreased throughout the observation period while the blood concentration increased up to 120 min. Further, the concentration of caffeine in the lens and blood was measured 30 min after topical application of caffeine, the concentration of caffeine being 0.72, 3.34, 15.51 and 72 mM depending on group belonging, in groups of 10 animals. The caffeine concentration in lens and blood, respectively, increased proportionally to the caffeine concentration topically applied. The rat blood concentrations achieved were far below the equivalent threshold dose of FDA recommended daily dose for humans. This information is important for further development of caffeine eye drops for cataract prevention.

  14. Topical nonsteroidal anti-inflammatory drugs for the treatment of pain due to soft tissue injury: diclofenac epolamine topical patch

    OpenAIRE

    Lionberger, David R; Brennan, Michael J.

    2010-01-01

    David R Lionberger1, Michael J Brennan21Southwest Orthopedic Group, Houston, TX, USA; 2Department of Medicine, Bridgeport Hospital, Bridgeport, CT, USAAbstract: The objective of this article is to review published clinical data on diclofenac epolamine topical patch 1.3% (DETP) in the treatment of acute soft tissue injuries, such as strains, sprains, and contusions. Review of published literature on topical nonsteroidal anti-inflammatory drugs (NSAIDs), diclofenac, and DETP in patients with ac...

  15. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models

    Science.gov (United States)

    Badavi, Francis F.; Walker, Steven A.; Santos Koos, Lindsey M.

    2015-04-01

    The completion of the International Space Station (ISS) in 2011 has provided the space research community with an ideal evaluation and testing facility for future long duration human activities in space. Ionized and secondary neutral particles radiation measurements inside ISS form the ideal tool for validation of radiation environmental models, nuclear reaction cross sections and transport codes. Studies using thermo-luminescent detectors (TLD), tissue equivalent proportional counter (TPEC), and computer aided design (CAD) models of early ISS configurations confirmed that, as input, computational dosimetry at low Earth orbit (LEO) requires an environmental model with directional (anisotropic) capability to properly describe the exposure of trapped protons within ISS. At LEO, ISS encounters exposure from trapped electrons, protons and geomagnetically attenuated galactic cosmic rays (GCR). For short duration studies at LEO, one can ignore trapped electrons and ever present GCR exposure contributions during quiet times. However, within the trapped proton field, a challenge arises from properly estimating the amount of proton exposure acquired. There exist a number of models to define the intensity of trapped particles. Among the established trapped models are the historic AE8/AP8, dating back to the 1980s and the recently released AE9/AP9/SPM. Since at LEO electrons have minimal exposure contribution to ISS, this work ignores the AE8 and AE9 components of the models and couples a measurement derived anisotropic trapped proton formalism to omnidirectional output from the AP8 and AP9 models, allowing the assessment of the differences between the two proton models. The assessment is done at a target point within the ISS-11A configuration (circa 2003) crew quarter (CQ) of Russian Zvezda service module (SM), during its ascending and descending nodes passes through the south Atlantic anomaly (SAA). The anisotropic formalism incorporates the contributions of proton narrow

  16. Low Earth orbit assessment of proton anisotropy using AP8 and AP9 trapped proton models.

    Science.gov (United States)

    Badavi, Francis F; Walker, Steven A; Santos Koos, Lindsey M

    2015-04-01

    The completion of the International Space Station (ISS) in 2011 has provided the space research community with an ideal evaluation and testing facility for future long duration human activities in space. Ionized and secondary neutral particles radiation measurements inside ISS form the ideal tool for validation of radiation environmental models, nuclear reaction cross sections and transport codes. Studies using thermo-luminescent detectors (TLD), tissue equivalent proportional counter (TPEC), and computer aided design (CAD) models of early ISS configurations confirmed that, as input, computational dosimetry at low Earth orbit (LEO) requires an environmental model with directional (anisotropic) capability to properly describe the exposure of trapped protons within ISS. At LEO, ISS encounters exposure from trapped electrons, protons and geomagnetically attenuated galactic cosmic rays (GCR). For short duration studies at LEO, one can ignore trapped electrons and ever present GCR exposure contributions during quiet times. However, within the trapped proton field, a challenge arises from properly estimating the amount of proton exposure acquired. There exist a number of models to define the intensity of trapped particles. Among the established trapped models are the historic AE8/AP8, dating back to the 1980s and the recently released AE9/AP9/SPM. Since at LEO electrons have minimal exposure contribution to ISS, this work ignores the AE8 and AE9 components of the models and couples a measurement derived anisotropic trapped proton formalism to omnidirectional output from the AP8 and AP9 models, allowing the assessment of the differences between the two proton models. The assessment is done at a target point within the ISS-11A configuration (circa 2003) crew quarter (CQ) of Russian Zvezda service module (SM), during its ascending and descending nodes passes through the south Atlantic anomaly (SAA). The anisotropic formalism incorporates the contributions of proton narrow

  17. Proximal femoral canal shape is more accurately assessed on AP hip radiographs than AP pelvis radiographs in primary hip osteoarthritis.

    Science.gov (United States)

    Merle, Christian; Waldstein, Wenzel; Gregory, Jennifer S; Goodyear, Simon R; Aspden, Richard M; Aldinger, Peter R; Murray, David W; Gill, Harinderjit S

    2013-01-01

    The objectives of the present study were to determine whether differences in the radiographic appearance of the of the proximal femoral canal exist on corresponding AP pelvis and AP hip radiographs, and whether radiographic assessment of canal shape is accurate with reference to computed tomography (CT). In a retrospective study, corresponding radiographs and CT scans of 100 consecutive patients with primary hip OA were evaluated. Active shape modelling (ASM) was performed to assess the variation in proximal femoral canal shape and to identify differences between AP hip and AP pelvis views. Differences in the medial cortical flare between radiographs and CT were quantified using least squares curve fitting. ASM identified significant differences in the assessment of canal shape on corresponding AP hip and AP pelvis views. Curve fitting demonstrated a good agreement between AP hip radiographs and CT. Agreement between AP pelvis radiographs and CT was less good. In contrast to AP pelvis radiographs, AP hip radiographs allow a more accurate and reliable assessment of proximal femoral canal shape in the frontal plane in primary hip OA. Our findings may improve stem fit in total hip arthroplasty without the routine use of CT.

  18. Abelian groups

    CERN Document Server

    Fuchs, László

    2015-01-01

    Written by one of the subject’s foremost experts, this book focuses on the central developments and modern methods of the advanced theory of abelian groups, while remaining accessible, as an introduction and reference, to the non-specialist. It provides a coherent source for results scattered throughout the research literature with lots of new proofs. The presentation highlights major trends that have radically changed the modern character of the subject, in particular, the use of homological methods in the structure theory of various classes of abelian groups, and the use of advanced set-theoretical methods in the study of undecidability problems. The treatment of the latter trend includes Shelah’s seminal work on the undecidability in ZFC of Whitehead’s Problem; while the treatment of the former trend includes an extensive (but non-exhaustive) study of p-groups, torsion-free groups, mixed groups, and important classes of groups arising from ring theory. To prepare the reader to tackle these topics, th...

  19. Hot topics in functional neuroradiology.

    Science.gov (United States)

    Faro, S H; Mohamed, F B; Helpern, J A; Jensen, J H; Thulborn, K R; Atkinson, I C; Sair, H I; Mikulis, D J

    2013-12-01

    Functional neuroradiology represents a relatively new and ever-growing subspecialty in the field of neuroradiology. Neuroradiology has evolved beyond anatomy and basic tissue signal characteristics and strives to understand the underlying physiologic processes of central nervous system disease. The American Society of Functional Neuroradiology sponsors a yearly educational and scientific meeting, and the educational committee was asked to suggest a few cutting-edge functional neuroradiology techniques (hot topics). The following is a review of several of these topics and includes "Diffusion Tensor Imaging of the Pediatric Spinal Cord"; "Diffusional Kurtosis Imaging"; "From Standardization to Quantification: Beyond Biomarkers toward Bioscales as Neuro MR Imaging Surrogates of Clinical End Points"; Resting-State Functional MR Imaging"; and "Current Use of Cerebrovascular Reserve Imaging."

  20. Retapamulin: A newer topical antibiotic

    Directory of Open Access Journals (Sweden)

    D Dhingra

    2013-01-01

    Full Text Available Impetigo is a common childhood skin infection. There are reports of increasing drug resistance to the currently used topical antibiotics including fusidic acid and mupirocin. Retapamulin is a newer topical agent of pleuromutilin class approved by the Food and Drug Administration for treatment of impetigo in children and has been recently made available in the Indian market. It has been demonstrated to have low potential for the development of antibacterial resistance and a high degree of potency against poly drug resistant Gram-positive bacteria found in skin infections including Staphylococcus aureus strains. The drug is safe owing to low systemic absorption and has only minimal side-effect of local irritation at the site of application.

  1. Topics on nonlinear generalized functions

    CERN Document Server

    Colombeau, J F

    2011-01-01

    The aim of this paper is to give the text of a recent introduction to nonlinear generalized functions exposed in my talk in the congress gf2011, which was asked by several participants. Three representative topics were presented: two recalls "Nonlinear generalized functions and their connections with distribution theory", "Examples of applications", and a recent development: "Locally convex topologies and compactness: a functional analysis of nonlinear generalized functions".

  2. Topical Ocular Delivery of NSAIDs

    OpenAIRE

    Ahuja, Munish; Avinash S Dhake; Sharma, Surendra K; Dipak K Majumdar

    2008-01-01

    In ocular tissue, arachidonic acid is metabolized by cyclooxygenase to prostaglandins which are the most important lipid derived mediators of inflammation. Presently nonsteroidal anti-inflammatory drugs (NSAIDs) which are cyclooxygenase (COX) inhibitors are being used for the treatment of inflammatory disorders. NSAIDs used in ophthalmology, topically, are salicylic-, indole acetic-, aryl acetic-, aryl propionic- and enolic acid derivatives. NSAIDs are weak acids with pKa mostly between 3.5 a...

  3. Topic Detection in Online Chat

    Science.gov (United States)

    2009-09-01

    including the time for reviewing instruction, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the...you. “ … Of making many books there is no end, and much study is a weariness of the flesh.” Ecclesiastes 12:12 , ESV xvi THIS PAGE INTENTIONALLY...topic detection," Online Information Review , vol. 30, pp. 496–516, 2006. [2] D. Jurafsky and J. H. Martin, Speech and Language Processing : An

  4. Probabilistic analysis and related topics

    CERN Document Server

    Bharucha-Reid, A T

    1983-01-01

    Probabilistic Analysis and Related Topics, Volume 3 focuses on the continuity, integrability, and differentiability of random functions, including operator theory, measure theory, and functional and numerical analysis. The selection first offers information on the qualitative theory of stochastic systems and Langevin equations with multiplicative noise. Discussions focus on phase-space evolution via direct integration, phase-space evolution, linear and nonlinear systems, linearization, and generalizations. The text then ponders on the stability theory of stochastic difference systems and Marko

  5. Stochastic Analysis and Related Topics

    CERN Document Server

    Ustunel, Ali

    1988-01-01

    The Silvri Workshop was divided into a short summer school and a working conference, producing lectures and research papers on recent developments in stochastic analysis on Wiener space. The topics treated in the lectures relate to the Malliavin calculus, the Skorohod integral and nonlinear functionals of white noise. Most of the research papers are applications of these subjects. This volume addresses researchers and graduate students in stochastic processes and theoretical physics.

  6. Hot topics from the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Glenzinski, D.; /Fermilab

    2008-01-01

    The Tevatron Run-II began in March 2001. To date, both the CDF and D0 experiments have collected 1 fb{sup -1} of data each. The results obtained from this data set were summarized at this conference in 39 parallel session presentations covering a wide range of topics. The author summarizes the most important of those results here and comments on some of the prospects for the future.

  7. Probabilistic analysis and related topics

    CERN Document Server

    Bharucha-Reid, A T

    1979-01-01

    Probabilistic Analysis and Related Topics, Volume 2 focuses on the integrability, continuity, and differentiability of random functions, as well as functional analysis, measure theory, operator theory, and numerical analysis.The selection first offers information on the optimal control of stochastic systems and Gleason measures. Discussions focus on convergence of Gleason measures, random Gleason measures, orthogonally scattered Gleason measures, existence of optimal controls without feedback, random necessary conditions, and Gleason measures in tensor products. The text then elaborates on an

  8. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  9. AP1000主系统先进性分析%The Progressiveness Analysis of the AP1000 Main System

    Institute of Scientific and Technical Information of China (English)

    李家杰

    2012-01-01

      本文总结了第三代先进非能动压水堆核电厂AP1000主系统的主要特点,对AP1000主系统的先进性进行了分析,核电厂主系统设计人员能够从该文中了解到 AP1000主系统与第二代核电厂主系统之间的差别。%  This paper summarizes the main features of the AP1000 main system of the third generation of advanced passive pressurized water reactor nuclear power plant , and analyzes the progressiveness of the AP1000 main system .From this paper, the main system designers of nuclear power factory can learn the difference between the second-generation nuclear power factory main system and AP1000 main system

  10. A Comparative Study On The Action Potential Simulation (APS Therapy And The Routine Physiotherapy Protocol In Knee Osteoarthritisin Elderly People

    Directory of Open Access Journals (Sweden)

    Abbas Rahimi

    2012-04-01

    Full Text Available Background and Aim: Knee osteoarthritis is the most common cause for which the elderly people refere to physiotherapy outpatient clinics. This study aimed to investigate the effects of the Action Potential Stimulation (APS Therapy and the routine physiotherapy (PT protocol on relieving pain and swelling as well as the duration of the relief period in patients with knee osteoarthritis. Materials and Methods: 69 patients (62 females & 7 males with knee osteoarthritis were recruited in this study. The subjects were divided into two groups including APS Therapy (n=37, mean age: 55±13 years old and the routine PT protocol (n=32, mean age: 61±14 years old groups. A 10-session treatment period was carried out for each group; and their pain and swelling were measured at the first, fifth and tenth sessions and also one-month after the last session (follow up. The swelling was measured using measuring the circumference of the knee on the patella, 5 Cm above and 5 Cm below the patella. The routine PT protocol consisted of hot pack, ultrasound, TENS and exercise; and the APS therapy protocol included hot pack, APS Therapy and the same exercise. During the follow up, 50 out of 61 subjects were called on the phone and any pain changes were recorded.Results: In terms of swelling, the results showed significant reduction just on the patella only in the APS Therapy group (P<0.05. Visual Analogue Pain Scale (VAPS indicated a significant pain reduction in both groups. However, the APS Therapy group showed significantly pain reduction at the end of sessions five, ten and the follow up session (P<0.05. It was also revealed that while routine PT subjects showed no significant pain changes between the tenth and the follow up session, a gradual pain reduction was seen in the APS therapy group during this period (P<0.05. A gradual dosage reduction was recorded only in the APS therapy group, indicating a slight correlation with pain reduction (r=0.4.Conclusion: The

  11. Top-up operation experience at APS.

    Energy Technology Data Exchange (ETDEWEB)

    Emery, L.

    1999-03-31

    The Advanced Photon Source (APS) is a 7-OeV, third-generation synchrotrons radiation source. To provide more stable beam for users, in September 1998 we began commissioning a new operating mode called ''top-up.'' In this mode, the beam current does not decay but is maintained at a high level using frequent injection, while photon shutters are open and photon beams are delivered to users. The hardware, software, and safety requirements for top-up will be reported. Safety issues related to injection with open photon shutters are covered in companion papers in this conference. Recent operational experience includes testing aspects of top-up injection and delivering beam to X-ray users for a few hours with fractional current stability of 10{sup {minus}3}. We expect to run several top-up operation shifts in Spring 1999. Issues of importance are orbit and emittance transients during the injection and scheduling of injection pulses for the convenience of users.

  12. Topical corticosteroids: clinical pharmacology and therapeutic use.

    Science.gov (United States)

    Miller, J A; Munro, D D

    1980-02-01

    The development of topical corticosteroids has enabled many dermatoses to be more effectively treated than previously, but there is also no doubt that misuse of these preparations can lead to troublesome local effects and potentially serious systemic problems. The most effective assay for comparing different compounds has been their vasoconstrictive activity, and this on the whole correlates well with clinical effect. To be effective, corticosteroid must be absorbed and the importance of concentration, occlusion, the type of vehicle, added penetrants such as urea and the anatomical site, on the amount of absorption and therefore on clinical activity has been demonstrated. Ointments have been shown to be more effective than creams but because of the considerable choice of potencies now available most dermatologists tend to prescribe the different formulations according to the wishes of the patient. For the same reason, dilution of the commercially marketed preparations is now not generally recommended. The main therapeutic activity of topical corticosteroids is their nonspecific anti-inflammatory effect, thought to be primarily a result of their action on the chemical mediators of inflammation. They have also been shown to be antimitotic which may well be relevant not only to the treatment of scaling dermatoses but also to their dermal thinning effect resulting from inhibition of fibroblasts. Combinations of corticosteroids with antibacterial and antifungal agents have been shown to be very effective in flexural eruptions and secondarily infected dermatoses. As a general rule, the use of topical corticosteroids in outpatients, unless badly misused, is not associated with any significant risk of adrenal axis suppression, but care must be exercised as to the amount prescribed, especially if large areas of the body are to be treated with highly potent preparations. Certain groups such as young children and patients with liver failure, and certain anatomical sites such

  13. Topic extraction from adverbial clauses

    Directory of Open Access Journals (Sweden)

    Carlos Rubio Alcalá

    2016-06-01

    Full Text Available This paper offers new data to support findings about Topic extraction from adverbial clauses. Since such clauses are strong islands, they should not allow extraction of any kind, but we show here that if the appropriate conditions are met, Topics of the CLLD kind in Romance can move out of them. We propose that two conditions must be met for such movement to be possible: the first is that the adverbial clause must have undergone topicalisation in the first place; the second is that the adverbial clause is inherently topical from a semantic viewpoint. Contrast with other language families (Germanic, Quechua and Japanese is provided and the semantic implications of the proposal are briefly discussed. Keywords: topicalisation; Clitic Left Dislocation; syntactic islands; adverbial clauses Este artículo ofrece nuevos datos sobre la extracción de Tópicos desde oraciones subordinadas adverbiales. Dado que dichas oraciones son islas fuertes, no deberían permitir extracción de ningún tipo, pero mostramos que si se dan las condiciones apropiadas, los Tópicos del tipo CLLD en lenguas románicas pueden desplazarse fuera de ellas. Proponemos que se deben cumplir dos condiciones para que ese movimiento sea posible: la primera es que la propia subordinada adverbial se haya topicalizado en primer lugar; la segunda es que la subordinada adverbial sea inherentemente un Tópico desde el punto de vista semántico. Proporcionamos también algunos contrastes con otras familias lingüísticas (germánica, quechua y japonés y se discuten brevemente las implicaciones semánticas de la propuesta. Palabras clave: topicalización; dislocación a la izquierda con clítico; islas sintácticas; oraciones adverbiales

  14. Potential theory—selected topics

    CERN Document Server

    Aikawwa, Hiroaki

    1996-01-01

    The first part of these lecture notes is an introduction to potential theory to prepare the reader for later parts, which can be used as the basis for a series of advanced lectures/seminars on potential theory/harmonic analysis. Topics covered in the book include minimal thinness, quasiadditivity of capacity, applications of singular integrals to potential theory, L(p)-capacity theory, fine limits of the Nagel-Stein boundary limit theorem and integrability of superharmonic functions. The notes are written for an audience familiar with the theory of integration, distributions and basic functional analysis.

  15. Topics in atomic collision theory

    CERN Document Server

    Geltman, Sydney; Brueckner, Keith A

    1969-01-01

    Topics in Atomic Collision Theory originated in a course of graduate lectures given at the University of Colorado and at University College in London. It is recommended for students in physics and related fields who are interested in the application of quantum scattering theory to low-energy atomic collision phenomena. No attention is given to the electromagnetic, nuclear, or elementary particle domains. The book is organized into three parts: static field scattering, electron-atom collisions, and atom-atom collisions. These are in the order of increasing physical complexity and hence necessar

  16. AP233: An Information Model for Systems Engineering

    Science.gov (United States)

    Siebes, Georg

    2009-01-01

    In today's world, information is abundant. We have no problems generating it. But we are challenged to find, organize, and exchange information. center dot A standardized model of information can help. Such a model nearly completed its development for Systems Engineering. It is referred to as AP233 (AP = Application Protocol).

  17. Topical cidofovir for plantar warts.

    Science.gov (United States)

    Padilla España, Laura; Del Boz, Javier; Fernández Morano, Teresa; Arenas Villafranca, Javier; de Troya Martín, Magdalena

    2014-01-01

    Plantar warts are a common reason for dermatological consultations and their treatment can occasionally be a challenge. Plantar warts are benign lesions produced by the human papillomavirus (HPV) that often fail to respond to habitual treatment. Cidofovir is a potent antiviral drug that acts competitively, inhibiting viral DNA polymerase. Our aim was to assess the efficacy and safety of cidofovir cream for the treatment of viral plantar warts. We undertook a retrospective observational study of patients with plantar warts who received treatment with topical cidofovir between July 2008 and July 2011 at the Dermatology Service of the Hospital Costa del Sol, Marbella, Spain. Data about the rate of treatment response, the adverse effects, and recurrences, as well as the characteristics of the patient cohort, were recorded. We identified 35 patients who had received some previous treatment. The usual concentration was 3% (in 33 of 35 cases), applied twice a day (in 31 of 35 cases). A greater or lesser response was noted in 28 cases. There were two recurrences. Topical cidofovir seems to be a useful alternative for the therapeutic management of recalcitrant plantar common warts that fail to respond to usual treatment.

  18. Topical Pain Relievers May Cause Burns

    Science.gov (United States)

    ... Consumers Consumer Updates Topical Pain Relievers May Cause Burns Share Tweet Linkedin Pin it More sharing options ... rare, have ranged from mild to severe chemical burns with use of such brand-name topical muscle ...

  19. Human-competitive automatic topic indexing

    CERN Document Server

    Medelyan, Olena

    2009-01-01

    Topic indexing is the task of identifying the main topics covered by a document. These are useful for many purposes: as subject headings in libraries, as keywords in academic publications and as tags on the web. Knowing a document’s topics helps people judge its relevance quickly. However, assigning topics manually is labor intensive. This thesis shows how to generate them automatically in a way that competes with human performance. Three kinds of indexing are investigated: term assignment, a task commonly performed by librarians, who select topics from a controlled vocabulary; tagging, a popular activity of web users, who choose topics freely; and a new method of keyphrase extraction, where topics are equated to Wikipedia article names. A general two-stage algorithm is introduced that first selects candidate topics and then ranks them by significance based on their properties. These properties draw on statistical, semantic, domain-specific and encyclopedic knowledge. They are combined using a machine learn...

  20. Topical erythromycin-zinc acetate complex lotion versus topical erythromycin gel in treatment of mild to moderate acne vulgaris

    Directory of Open Access Journals (Sweden)

    Hayder R. Al-Hamamy

    2014-10-01

    Full Text Available Introduction: Topical antibiotics are the main step in the treatment of mild to moderate acne vulgaris. Erythromycin is one of the effective topical therapies for this disease. Zinc sulfate 5% solution was reported to be effective in treatment of acne vulgaris and rosacea. Aim: To compare the effectiveness and side effects of topical erythromycin in combination with zinc and erythromycin alone in treatment of mild to moderate acne vulgaris. Material and Methods: This single, blind, therapeutic, comparative study was done in the Department of Dermatology – Baghdad Teaching Hospital, Baghdad, Iraq; from May 2012 – August 2013.Scoring of acne was carried out and the patients were examined every two weeks for 10 weeks of treatment. One month after stopping drugs, patients were evaluated for drug complications and disease recurrence. Eighty patients fulfilling enrollment criteria were included in this study. Patients were divided into two groups: Group A (40 patients treated twice daily with topical erythromycin-zinc complex lotion and Group B (40 patients treated twice daily with topical 2% erythromycin gel. Results: Both topical erythromycin-zinc lotion and erythromycin gel were statistically an effective therapy starting after 6 weeks treatment and up to 4 weeks after stopping treatment. Erythromycin-zinc lotion was more effective and act earlier than erythromycin gel starting from 4 weeks of therapy till the end of treatment (after 10 week and even after 4 weeks after stopping the treatment (p value <0.0001. Conclusions: Erythromycin-zinc complex lotion was an effective and well tolerated topical therapy for mild to moderate inflammatory acne vulgaris and was more effective than erythromycin gel alone.

  1. Facilities removal working group

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    This working group`s first objective is to identify major economic, technical, and regulatory constraints on operator practices and decisions relevant to offshore facilities removal. Then, the group will try to make recommendations as to regulatory and policy adjustments, additional research, or process improvements and/or technological advances, that may be needed to improve the efficiency and effectiveness of the removal process. The working group will focus primarily on issues dealing with Gulf of Mexico platform abandonments. In order to make the working group sessions as productive as possible, the Facilities Removal Working Group will focus on three topics that address a majority of the concerns and/or constraints relevant to facilities removal. The three areas are: (1) Explosive Severing and its Impact on Marine Life, (2) Pile and Conductor Severing, and (3) Deep Water Abandonments This paper will outline the current state of practice in the offshore industry, identifying current regulations and specific issues encountered when addressing each of the three main topics above. The intent of the paper is to highlight potential issues for panel discussion, not to provide a detailed review of all data relevant to the topic. Before each panel discussion, key speakers will review data and information to facilitate development and discussion of the main issues of each topic. Please refer to the attached agenda for the workshop format, key speakers, presentation topics, and panel participants. The goal of the panel discussions is to identify key issues for each of the three topics above. The working group will also make recommendations on how to proceed on these key issues.

  2. Efeito da mitomicina C tópica na cicatrização de prega vocal em modelo suíno Topical mitomycin C effect on swine vocal folds healing

    Directory of Open Access Journals (Sweden)

    Paulo Antônio Monteiro Camargo

    2006-10-01

    Full Text Available Várias terapias adjuvantes à cirurgia vêm sendo usadas para modular o processo cicatricial nas pregas vocais, entre elas a Mitomicina tópica (MTC. OBJETIVOS: Avaliar os efeitos da MTC no processo de cicatrização de pregas vocais de suínos 30 dias após exérese de fragmento de mucosa com laser de CO2 mediante a mensuração da deposição de colágeno. FORMA DE ESTUDO: Experimental em suínos. MATERIAIS E MÉTODOS: Dois grupos de 6 suínos cada foram avaliados após exérese de fragmento de mucosa de prega vocal a laser de CO2 (grupo controle sem uso e grupo experimento com uso de MTC tópica. Após 30 dias os animais foram submetidos à eutanásia, sendo coletadas amostras das pregas vocais para análise histológica, a fim de quantificar a deposição de colágeno mediante coloração de Picrosirius Red. RESULTADOS: A média da área do colágeno total das pregas vocais do grupo controle foi de 2648,03 µm2, enquanto a média do colágeno total das pregas vocais do grupo experimento foi de 2200,30 µm2 (p = 0,0043. CONCLUSÃO: A MTC usada topicamente após a exérese de fragmento de mucosa da prega vocal a laser de CO2 em suínos, diminui, significativamente, a deposição do colágeno total.several adjuvant therapies to surgery have been used to modulate the healing process of vocal folds, including topic mitomycin (MTC. AIM: to evaluate the effect of topical MTC in the healing process of vocal folds 30 days after the exeresis of a mucosal fragment with CO2 laser in a swine model (control group without mitomycin and study group with topical MTC, with collagen deposition measurement. STUDY TYPE: prospective experimental in swine. METHODS: two groups of 6 swine each were subjected to exeresis of a mucosal fragment of the vocal fold with CO2 laser. Immediately after the procedure MTC was applied topically for three minutes on the study group. Thirty days later the animals were slaughtered and samples of the vocal folds were collected for

  3. Misuse of topical corticosteroids: A clinical study of adverse effects

    Directory of Open Access Journals (Sweden)

    Vivek Kumar Dey

    2014-01-01

    Full Text Available Background: Misuse of topical corticosteroids is a widespread phenomenon among young people in India, especially women. The practice is associated with significant adverse effects and poor awareness of these effects among the general public. Aim: This study was conducted to examine the misuse and adverse effects of topical corticosteroids among the people in Bastar region in Chhattisgarh state of India. Materials and Methods: Data collected from patients presenting with at least one of the adverse effects of topical corticosteroids as the chief complaint, from November 2010 to October 2011. Results: Out of the 6723 new patients, 379 (5.63% had presented with misuse and adverse effects of topical corticosteroids, of whom 78.89% were females. More than 65% of the patients were in the age group 10-29 years. The main reason for using the topical corticosteroids was to lighten skin colour and treat melasma and suntan. Acne (37.99% and telangiectasia (18.99% were the most common adverse effects noted. Conclusions: Misuse of topical corticosteroids has a huge impact on dermatological practice, leading to a significant proportion of visits to the dermatologist. This hydra-headed problem needs multi-dimensional interventions, involving educational, legal and managerial approaches with cooperation from different sectors of society.

  4. Topics in Banach space theory

    CERN Document Server

    Albiac, Fernando

    2016-01-01

    This text provides the reader with the necessary technical tools and background to reach the frontiers of research without the introduction of too many extraneous concepts. Detailed and accessible proofs are included, as are a variety of exercises and problems. The two new chapters in this second edition are devoted to two topics of much current interest amongst functional analysts: Greedy approximation with respect to bases in Banach spaces and nonlinear geometry of Banach spaces. This new material is intended to present these two directions of research for their intrinsic importance within Banach space theory, and to motivate graduate students interested in learning more about them. This textbook assumes only a basic knowledge of functional analysis, giving the reader a self-contained overview of the ideas and techniques in the development of modern Banach space theory. Special emphasis is placed on the study of the classical Lebesgue spaces Lp (and their sequence space analogues) and spaces of continuous f...

  5. Topics in computational linear optimization

    DEFF Research Database (Denmark)

    Hultberg, Tim Helge

    2000-01-01

    of high quality solvers and the use of algebraic modelling systems to handle the communication between the modeller and the solver. This dissertation features four topics in computational linear optimization: A) automatic reformulation of mixed 0/1 linear programs, B) direct solution of sparse unsymmetric...... branch-and-bound algorithms depends heavily on the formulation of the problem. In seeking a better formulation, automatic reformulation employs a range of different techniques for obtaining an equivalent formulation of a given pure or mixed integer programming problem, such that the new formulation has...... a tighter LP-relaxation than the original formulation. The first paper surveys the use of automatic reformulation techniques for general mixed 0-1 linear programs. An implementation, Spiky, of a direct method for solving large sparse unsymmetric systems of linear equations is presented in the second paper...

  6. Topics in Open Topological Strings

    CERN Document Server

    Prudenziati, Andrea

    2010-01-01

    This thesis is based on some selected topics in open topological string theory which I have worked on during my Ph.D. It comprises an introductory part where I have focused on the points most needed for the later chapters, trading completeness for conciseness and clarity. Then, following [12], we discuss tadpole cancellation for topological strings where we mainly show how its implementation is needed for ensuring the same "odd" moduli decoupling encountered in the closed theory. Next we move to analyse how the open and closed effective field theories for the B model interact writing the complete Lagrangian. We first check it deriving some already known tree level amplitudes in term of target space quantities, and then we extend the recipe to new results; later we implement open closed duality from a target field theory perspective. This last subject is also analysed from a worldsheet point of view extending the analysis of [13]. Some ideas for future research are briefly reported.

  7. KEY TOPICS IN SPORTS MEDICINE

    Directory of Open Access Journals (Sweden)

    Amir Ali Narvani

    2006-12-01

    Full Text Available Key Topics in Sports Medicine is a single quick reference source for sports and exercise medicine. It presents the essential information from across relevant topic areas, and includes both the core and emerging issues in this rapidly developing field. It covers: 1 Sports injuries, rehabilitation and injury prevention, 2 Exercise physiology, fitness testing and training, 3 Drugs in sport, 4 Exercise and health promotion, 5 Sport and exercise for special and clinical populations, 6 The psychology of performance and injury. PURPOSE The Key Topics format provides extensive, concise information in an accessible, easy-to-follow manner. AUDIENCE The book is targeted the students and specialists in sports medicine and rehabilitation, athletic training, physiotherapy and orthopaedic surgery. The editors are authorities in their respective fields and this handbook depends on their extensive experience and knowledge accumulated over the years. FEATURES The book contains the information for clinical guidance, rapid access to concise details and facts. It is composed of 99 topics which present the information in an order that is considered logical and progressive as in most texts. Chapter headings are: 1. Functional Anatomy, 2. Training Principles / Development of Strength and Power, 3. Biomechanical Principles, 4. Biomechanical Analysis, 5. Physiology of Training, 6. Monitoring of Training Progress, 7. Nutrition, 8. Hot and Cold Climates, 9. Altitude, 10. Sport and Travelling, 11. Principles of Sport Injury Diagnosis, 12. Principles of Sport and Soft Tissue Management, 13. Principles of Physical Therapy and Rehabilitation, 14. Principles of Sport Injury Prevention, 15. Sports Psychology, 16. Team Sports, 17. Psychological Aspects of Injury in Sport, 18. Injury Repair Process, 19. Basic Biomechanics of Tissue Injury, 20. Plain Film Radiography in Sport, 21. Nuclear Medicine, 22. Diagnostic Ultrasound, 23. MRI Scan, 24. Other Imaging, 5. Head Injury, 26. Eye

  8. Synergetics introduction and advanced topics

    CERN Document Server

    Haken, Hermann

    2004-01-01

    This book is an often-requested reprint of two classic texts by H. Haken: "Synergetics. An Introduction" and "Advanced Synergetics". Synergetics, an interdisciplinary research program initiated by H. Haken in 1969, deals with the systematic and methodological approach to the rapidly growing field of complexity. Going well beyond qualitative analogies between complex systems in fields as diverse as physics, chemistry, biology, sociology and economics, Synergetics uses tools from theoretical physics and mathematics to construct an unifying framework within which quantitative descriptions of complex, self-organizing systems can be made. This may well explain the timelessness of H. Haken's original texts on this topic, which are now recognized as landmarks in the field of complex systems. They provide both the beginning graduate student and the seasoned researcher with solid knowledge of the basic concepts and mathematical tools. Moreover, they admirably convey the spirit of the pioneering work by the founder of ...

  9. Neutron transport simulation (selected topics)

    Science.gov (United States)

    Vaz, P.

    2009-10-01

    Neutron transport simulation is usually performed for criticality, power distribution, activation, scattering, dosimetry and shielding problems, among others. During the last fifteen years, innovative technological applications have been proposed (Accelerator Driven Systems, Energy Amplifiers, Spallation Neutron Sources, etc.), involving the utilization of intermediate energies (hundreds of MeV) and high-intensity (tens of mA) proton accelerators impinging in targets of high Z elements. Additionally, the use of protons, neutrons and light ions for medical applications (hadrontherapy) impose requirements on neutron dosimetry-related quantities (such as kerma factors) for biologically relevant materials, in the energy range starting at several tens of MeV. Shielding and activation related problems associated to the operation of high-energy proton accelerators, emerging space-related applications and aircrew dosimetry-related topics are also fields of intense activity requiring as accurate as possible medium- and high-energy neutron (and other hadrons) transport simulation. These applications impose specific requirements on cross-section data for structural materials, targets, actinides and biologically relevant materials. Emerging nuclear energy systems and next generation nuclear reactors also impose requirements on accurate neutron transport calculations and on cross-section data needs for structural materials, coolants and nuclear fuel materials, aiming at improved safety and detailed thermal-hydraulics and radiation damage studies. In this review paper, the state-of-the-art in the computational tools and methodologies available to perform neutron transport simulation is presented. Proton- and neutron-induced cross-section data needs and requirements are discussed. Hot topics are pinpointed, prospective views are provided and future trends identified.

  10. Neutron transport simulation (selected topics)

    Energy Technology Data Exchange (ETDEWEB)

    Vaz, P. [Instituto Tecnologico e Nuclear, Estrada Nacional 10, P-2686-953 Sacavem (Portugal)], E-mail: pedrovaz@itn.pt

    2009-10-15

    Neutron transport simulation is usually performed for criticality, power distribution, activation, scattering, dosimetry and shielding problems, among others. During the last fifteen years, innovative technological applications have been proposed (Accelerator Driven Systems, Energy Amplifiers, Spallation Neutron Sources, etc.), involving the utilization of intermediate energies (hundreds of MeV) and high-intensity (tens of mA) proton accelerators impinging in targets of high Z elements. Additionally, the use of protons, neutrons and light ions for medical applications (hadrontherapy) impose requirements on neutron dosimetry-related quantities (such as kerma factors) for biologically relevant materials, in the energy range starting at several tens of MeV. Shielding and activation related problems associated to the operation of high-energy proton accelerators, emerging space-related applications and aircrew dosimetry-related topics are also fields of intense activity requiring as accurate as possible medium- and high-energy neutron (and other hadrons) transport simulation. These applications impose specific requirements on cross-section data for structural materials, targets, actinides and biologically relevant materials. Emerging nuclear energy systems and next generation nuclear reactors also impose requirements on accurate neutron transport calculations and on cross-section data needs for structural materials, coolants and nuclear fuel materials, aiming at improved safety and detailed thermal-hydraulics and radiation damage studies. In this review paper, the state-of-the-art in the computational tools and methodologies available to perform neutron transport simulation is presented. Proton- and neutron-induced cross-section data needs and requirements are discussed. Hot topics are pinpointed, prospective views are provided and future trends identified.

  11. Genome-wide analysis of the AP2/ERF family in Musa species reveals divergence and neofunctionalisation during evolution.

    Science.gov (United States)

    Lakhwani, Deepika; Pandey, Ashutosh; Dhar, Yogeshwar Vikram; Bag, Sumit Kumar; Trivedi, Prabodh Kumar; Asif, Mehar Hasan

    2016-01-06

    AP2/ERF domain containing transcription factor super family is one of the important regulators in the plant kingdom. The involvement of AP2/ERF family members has been elucidated in various processes associated with plant growth, development as well as in response to hormones, biotic and abiotic stresses. In this study, we carried out genome-wide analysis to identify members of AP2/ERF family in Musa acuminata (A genome) and Musa balbisiana (B genome) and changes leading to neofunctionalisation of genes. Analysis identified 265 and 318 AP2/ERF encoding genes in M. acuminata and M. balbisiana respectively which were further classified into ERF, DREB, AP2, RAV and Soloist groups. Comparative analysis indicated that AP2/ERF family has undergone duplication, loss and divergence during evolution and speciation of the Musa A and B genomes. We identified nine genes which are up-regulated during fruit ripening and might be components of the regulatory machinery operating during ethylene-dependent ripening in banana. Tissue-specific expression analysis of the genes suggests that different regulatory mechanisms might be involved in peel and pulp ripening process through recruiting specific ERFs in these tissues. Analysis also suggests that MaRAV-6 and MaERF026 have structurally diverged from their M. balbisiana counterparts and have attained new functions during ripening.

  12. Genome-wide identification and phylogenetic analysis of the AP2/ERF gene superfamily in sweet orange (Citrus sinensis).

    Science.gov (United States)

    Ito, T M; Polido, P B; Rampim, M C; Kaschuk, G; Souza, S G H

    2014-09-26

    Sweet orange (Citrus sinensis) plays an important role in the economy of more than 140 countries, but it is grown in areas with intermittent stressful soil and climatic conditions. The stress tolerance could be addressed by manipulating the ethylene response factor (ERF) transcription factors because they orchestrate plant responses to environmental stress. We performed an in silico study on the ERFs in the expressed sequence tag database of C. sinensis to identify potential genes that regulate plant responses to stress. We identified 108 putative genes encoding protein sequences of the AP2/ERF superfamily distributed within 10 groups of amino acid sequences. Ninety-one genes were assembled from the ERF family containing only one AP2/ERF domain, 13 genes were assembled from the AP2 family containing two AP2/ERF domains, and four other genes were assembled from the RAV family containing one AP2/ERF domain and a B3 domain. Some conserved domains of the ERF family genes were disrupted into a few segments by introns. This irregular distribution of genes in the AP2/ERF superfamily in different plant species could be a result of genomic losses or duplication events in a common ancestor. The in silico gene expression revealed that 67% of AP2/ERF genes are expressed in tissues with usual plant development, and 14% were expressed in stressed tissues. Because the AP2/ERF superfamily is expressed in an orchestrated way, it is possible that the manipulation of only one gene may result in changes in the whole plant function, which could result in more tolerant crops.

  13. The A.P Møller shares, the US dollar and the price of oil

    DEFF Research Database (Denmark)

    Risager, Ole

    2003-01-01

    1. Brief IntroductionThe two companies D/S Svendborg and D/S 1912 have for almost a century been the parent companiesof the A.P. Møller Group. These companies were founded by Mr. Arnold Peter Møller and his fatherCaptain Peter Mærsk Møller. They were in the beginning entirely into shipping. In 19...

  14. "Two Cultures" Topics for General Studies Science Courses.

    Science.gov (United States)

    Larson, James H.

    1982-01-01

    Theses proposed in C. P. Snow's book "The Two Cultures," including uncommunicative scientific and literary groups, gap between rich and poor, overpopulation, and nuclear war remain viable topics. Discusses the scientific and literary cultural gap and what can be done in general studies science courses to ameliorate the condition.…

  15. "Two Cultures" Topics for General Studies Science Courses.

    Science.gov (United States)

    Larson, James H.

    1982-01-01

    Theses proposed in C. P. Snow's book "The Two Cultures," including uncommunicative scientific and literary groups, gap between rich and poor, overpopulation, and nuclear war remain viable topics. Discusses the scientific and literary cultural gap and what can be done in general studies science courses to ameliorate the condition. (Author/JN)

  16. Markers of topical discourse in child-directed speech.

    Science.gov (United States)

    Rohde, Hannah; Frank, Michael C

    2014-01-01

    Although the language we encounter is typically embedded in rich discourse contexts, many existing models of processing focus largely on phenomena that occur sentence-internally. Similarly, most work on children's language learning does not consider how information can accumulate as a discourse progresses. Research in pragmatics, however, points to ways in which each subsequent utterance provides new opportunities for listeners to infer speaker meaning. Such inferences allow the listener to build up a representation of the speakers' intended topic and more generally to identify relationships, structures, and messages that extend across multiple utterances. We address this issue by analyzing a video corpus of child-caregiver interactions. We use topic continuity as an index of discourse structure, examining how caregivers introduce and discuss objects across utterances. For the analysis, utterances are grouped into topical discourse sequences using three annotation strategies: raw annotations of speakers' referents, the output of a model that groups utterances based on those annotations, and the judgments of human coders. We analyze how the lexical, syntactic, and social properties of caregiver-child interaction change over the course of a sequence of topically related utterances. Our findings suggest that many cues used to signal topicality in adult discourse are also available in child-directed speech.

  17. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.

    1995-09-01

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  18. A new gap separation mechanism for APS insertion devices.

    Energy Technology Data Exchange (ETDEWEB)

    Trakhtenberg, E. M.; Tcheskidov, V.; Den Hartog, P. K.; Deriy, B.; Erdmann, M.; Makarov, O.; Moog, E. R.

    1999-10-25

    A new gap separation mechanism for use with the standard Advanced Photon Source (APS) 3.3-cm-period undulator magnetic structures has been designed and built and the first system has been installed in the APS storage ring. The system allows a minimum magnetic gap of 10 mm for use with the APS 8-mm insertion device vacuum chambers. The mechanism is a bolted steel frame structure with a simple 4-motor mechanical drive train. The control system uses servomotors with incremental rotary encoders and virtual absolute linear encoders.

  19. Multilingual Topic Models for Unaligned Text

    CERN Document Server

    Boyd-Graber, Jordan

    2012-01-01

    We develop the multilingual topic model for unaligned text (MuTo), a probabilistic model of text that is designed to analyze corpora composed of documents in two languages. From these documents, MuTo uses stochastic EM to simultaneously discover both a matching between the languages and multilingual latent topics. We demonstrate that MuTo is able to find shared topics on real-world multilingual corpora, successfully pairing related documents across languages. MuTo provides a new framework for creating multilingual topic models without needing carefully curated parallel corpora and allows applications built using the topic model formalism to be applied to a much wider class of corpora.

  20. Evaluation of topical n-acetylcysteine in diversion colitis

    Directory of Open Access Journals (Sweden)

    Marcos Gonçalves de Almeida

    2012-09-01

    Full Text Available INTRODUCTION: Diversion colitis (DC is a benign condition characterized by the appearance of inflammation in the mucosa of the colon or rectum devoid of fecal stream. Oxidative stress has been associated with the etiopathogenesis of the disease. N-acetylcysteine (NAC is a substance with antioxidant properties, used in different treatments of inflammatory diseases. The purpose of this study was to evaluate the effects of topical applications of NAC in an experimental model of DC. METHODS: Thirty-six Wistar rats were submitted to deviation of fecal stream by proximal colostomy and a distal mucosal fistula. They were distributed into 3 experimental groups of 12 animals according to the daily application of enemas containing 0.9% saline or 2 doses of NAC, 25 mg/kg and 100 mg/kg, respectively. In each group, half of the animals were sacrificed after two weeks of irrigation and half after four weeks of irrigation. The diagnosis of colitis was assessed by histopathological analysis and the grade of inflammation by inflammatory grading scale. The results were evaluated with the Mann-Whitney test, adopting significance level of 5% (pINTRODUÇÃO: Colite de exclusão (CE é uma condição benigna caracterizada pelo desenvolvimento de inflamação na mucosa do cólon desprovida de trânsito fecal. O estresse oxidativo tem sido implicado na patogênese da doença. A n-acetilcisteína (NAC é uma substância com efeitos antioxidantes, sendo utilizada no tratamento de várias doenças inflamatórias. OBJETIVO: Avaliar os efeitos da aplicação tópica de NAC em modelo de CE. MÉTODO: Trinta e seis ratos Wistar foram submetidos ao desvio do trânsito por meio de colostomia proximal e fístula mucosa distal. Os animais foram distribuídos em três grupos experimentais de igual tamanho segundo a aplicação de enemas diários contendo soro fisiológico 0,9% ou NAC nas concentrações de 25 mg/kg ou 100 mg/kg. Em cada grupo, metade dos animais foi sacrificada ap

  1. Algorithms and theoretical topics on selected combinatorial optimization problems

    OpenAIRE

    Kaveh, Arman

    2010-01-01

    We study the Quadratic Assignment Problem (QAP), Three Dimensional Assignment Problem (3AP) and Quadratic Three Dimensional Assignment Problem (Q3AP), which combines aspects of both QAP and 3AP. The three problems are known to be NP-hard. We propose new algorithms for obtaining near optimal solutions of QAP and 3AP and present computational results. Our algorithms obtain improved solutions in some benchmark instances of QAP and 3AP. We also discuss theoretical results on 3AP and Q3AP such as ...

  2. Identifying Topics in Microblogs Using Wikipedia.

    Science.gov (United States)

    Yıldırım, Ahmet; Üsküdarlı, Suzan; Özgür, Arzucan

    2016-01-01

    Twitter is an extremely high volume platform for user generated contributions regarding any topic. The wealth of content created at real-time in massive quantities calls for automated approaches to identify the topics of the contributions. Such topics can be utilized in numerous ways, such as public opinion mining, marketing, entertainment, and disaster management. Towards this end, approaches to relate single or partial posts to knowledge base items have been proposed. However, in microblogging systems like Twitter, topics emerge from the culmination of a large number of contributions. Therefore, identifying topics based on collections of posts, where individual posts contribute to some aspect of the greater topic is necessary. Models, such as Latent Dirichlet Allocation (LDA), propose algorithms for relating collections of posts to sets of keywords that represent underlying topics. In these approaches, figuring out what the specific topic(s) the keyword sets represent remains as a separate task. Another issue in topic detection is the scope, which is often limited to specific domain, such as health. This work proposes an approach for identifying domain-independent specific topics related to sets of posts. In this approach, individual posts are processed and then aggregated to identify key tokens, which are then mapped to specific topics. Wikipedia article titles are selected to represent topics, since they are up to date, user-generated, sophisticated articles that span topics of human interest. This paper describes the proposed approach, a prototype implementation, and a case study based on data gathered during the heavily contributed periods corresponding to the four US election debates in 2012. The manually evaluated results (0.96 precision) and other observations from the study are discussed in detail.

  3. Effect of multifunctional protein YB-1 on the AP site cleavage by AP endonuclease 1 and tyrosyl phosphodiesterase 1

    Directory of Open Access Journals (Sweden)

    Ovchinnikov L. P.

    2012-07-01

    Full Text Available Apurinic/apyrimidinic sites (AP sites which represent one of the most abundantly generated DNA lesions in the cell are generally repaired by base excision repair (BER pathway. Multifunctional protein YB-1 is known to participate in cellular response to genotoxic stress and was shown to interact with several components of BER – DNA glycosylases NTH1, NEIL2, DNA polymerase and DNA ligase III. Therefore, it is of great interest to investigate the influence of YB-1 on one of the major BER enzymes, responsible for AP site cleavage, AP endonuclease APE1, and on tyrosyl phosphodiesterase Tdp1, participating in APE1 independent pathway of AP site repair. Aim. Effect of multifunctional protein YB-1 on the AP site cleavage by the activities of APE1 and Tdp1 was studied. Methods. Gel-mobility shift assays and enzyme activity tests. Results. YB-1 was shown to inhibit the cleavage of AP site located in single-stranded DNA by both APE1 and Tdp1. Stimulation of APE1 activity on protruding double-stranded DNA in the presence of YB-1 was observed, whereas no effect on Tdp1-mediated cleavage of AP site in double-stranded DNA was found. Conclusions. YB-1 can modulate the repair of AP sites in DNA by both positively stimulating APE1 during the classic BER of AP sites and avoiding a possible generation of doublestrand breaks, arising from the cleavage of single-stranded portion of DNA substrate already used by different DNA-processing pathway

  4. Tank characterization report for double shell tank 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    Winkelman, W.D., Westinghouse Hanford

    1996-08-07

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AP-104. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  5. A hot-spare injector for the APS linac.

    Energy Technology Data Exchange (ETDEWEB)

    Lewellen, J. W.

    1999-04-13

    Last year a second-generation SSRL-type thermionic cathode rf gun was installed in the Advanced Photon Source (APS) linac. This gun (referred to as ''gun2'') has been successfully commissioned and now serves as the main injector for the APS linac, essentially replacing the Koontz-type DC gun. To help ensure injector availability, particularly with the advent of top-up mode operation at the APS, a second thermionic-cathode rf gun will be installed in the APS linac to act as a hot-spare beam source. The hot-spare installation includes several unique design features, including a deep-orbit Panofsky-style alpha magnet. Details of the hot-spare beamline design and projected performance are presented, along with some plans for future performance upgrades.

  6. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  7. Topics in Number Theory Conference

    CERN Document Server

    Andrews, George; Ono, Ken

    1999-01-01

    From July 31 through August 3,1997, the Pennsylvania State University hosted the Topics in Number Theory Conference. The conference was organized by Ken Ono and myself. By writing the preface, I am afforded the opportunity to express my gratitude to Ken for beng the inspiring and driving force behind the whole conference. Without his energy, enthusiasm and skill the entire event would never have occurred. We are extremely grateful to the sponsors of the conference: The National Sci­ ence Foundation, The Penn State Conference Center and the Penn State Depart­ ment of Mathematics. The object in this conference was to provide a variety of presentations giving a current picture of recent, significant work in number theory. There were eight plenary lectures: H. Darmon (McGill University), "Non-vanishing of L-functions and their derivatives modulo p. " A. Granville (University of Georgia), "Mean values of multiplicative functions. " C. Pomerance (University of Georgia), "Recent results in primality testing. " C. ...

  8. Decision Point 1 Topical Report

    Energy Technology Data Exchange (ETDEWEB)

    Yablonsky, Al; Barsoumian, Shant; Legere, David

    2013-05-01

    This Topical Report addresses accomplishments achieved during Phase 2a of the SkyMine® Carbon Mineralization Pilot Project. The primary objectives of this project are to design, construct, and operate a system to capture CO2 from a slipstream of flue gas from a commercial coal-fired cement kiln, convert that CO2 to products having commercial value (i.e., beneficial use), show the economic viability of the CO2 capture and conversion process, and thereby advance the technology to the point of readiness for commercial scale demonstration and proliferation. The overall process is carbon negative, resulting in mineralization of CO2 that would otherwise be released into the atmosphere. The project will also substantiate market opportunities for the technology by sales of chemicals into existing markets, and identify opportunities to improve technology performance and reduce costs at the commercial scale. The project is being conducted in two phases. The primary objectives of Phase 1 were to elaborate proven SkyMine® process chemistry to commercial pilot-scale operation and complete the preliminary design for the pilot plant to be built and operated in Phase 2, complete a NEPA evaluation, and develop a comprehensive carbon life cycle analysis. The objective of the current Phase (2a) is to complete the detailed design of the pilot plant to be built in Phase 2b.

  9. Roles of AP-2 in clathrin-mediated endocytosis.

    Directory of Open Access Journals (Sweden)

    Emmanuel Boucrot

    Full Text Available BACKGROUND: The notion that AP-2 clathrin adaptor is an essential component of an endocytic clathrin coat appears to conflict with recent observations that substantial AP-2 depletion, using RNA interference with synthesis of AP-2 subunits, fails to block uptake of certain ligands known to internalize through a clathrin-based pathway. METHODOLOGY/PRINCIPAL FINDINGS: We report here the use of in vivo imaging data obtained by spinning-disk confocal microscopy to study the formation of clathrin-coated structures at the plasma membranes of BSC1 and HeLa cells depleted by RNAi of the clathrin adaptor, AP-2. Very few clathrin coats continue to assemble after AP-2 knockdown. Moreover, there is a total absence of clathrin-containing structures completely lacking AP-2 while all the remaining coats still contain a small amount of AP-2. These observations suggest that AP-2 is essential for endocytic coated-pit and coated-vesicle formation. We also find that AP-2 knockdown strongly inhibits light-density lipoprotein (LDL receptor-mediated endocytosis, as long as cells are maintained in complete serum and at 37 degrees C. If cells are first incubated with LDL at 4 degrees C, followed by warming, there is little or no decrease in LDL uptake with respect to control cells. LDL uptake at 37 degrees C is also not affected in AP-2 depleted cells first deprived of LDL by incubation with either serum-starved or LDL-starved cells for 24 hr. The LDL-deprived cells display a significant increase in endocytic structures enriched on deeply invaginated tubes that contain LDL and we suggest that under this condition of stress, LDL might enter through this alternative pathway. CONCLUSIONS/SIGNIFICANCE: These results suggest that AP-2 is essential for endocytic clathrin coated-pit and coated-vesicle formation. They also indicate that under normal conditions, functional endocytic clathrin coated pits are required for LDL internalization. We also show that under certain

  10. Army and Marine Corps Active Protection System (APS) Efforts

    Science.gov (United States)

    2016-08-30

    Expedited NDI effort. The Marines have a number of unique APS requirements—including the ability to be transported by ship and withstand salt water...in urban environments. Such constraints could limit the usefulness of APS in certain combat scenarios. Collateral Damage In a manner similar to...fired at short range, in open area or urban environment, AT Guided Missiles, High Explosive AT and Kinetic Energy rounds. The Iron Fist is

  11. Army and Marine Corps Active Protection System (APS) Efforts

    Science.gov (United States)

    2016-08-30

    Summary Active Protection Systems (APSs) are subsystems integrated into or installed on a combat vehicle to automatically acquire, track, and respond...Protection System (APS) Efforts Congressional Research Service 1 Why This Issue Is Important for Congress Active Protection Systems (APSs) are...of these systems are highly susceptible to “soft kill” APS, which underlies the importance of both soft and hard kill capabilities. 20 In addition

  12. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov

    2005-06-01

    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  13. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-05-18

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  14. Renal effects of atriopeptin (AP) II in conscious SHR

    Energy Technology Data Exchange (ETDEWEB)

    Smits, J.F.; Debets, J.M.; Struyker-Boudier, H.A.; Daemen, M.J.

    1986-03-05

    Diuresis and natriuresis following APs has been suggested to depend upon increased renal blood flow (RBF). In a previous study, they found that APII infusions in conscious SHR decrease RBF. In this study, they report effects of APII on glomerular filtration rate (GFR) and renal excretory function in conscious SHR. Male SHR were equipped with arterial and venous catheters. Furthermore, a special catheter was implanted into the bladder to allow continuous urine sampling from conscious, freely moving rats. Animals were allowed at least 4 days to recover. In one group of SHR, APII (N=7) or saline (N=7) was infused to quantitate excretion of water, Na/sup +/, and K/sup +/. Two other groups of SHR (N=8 each) were infused with /sup 51/Cr-EDTA and /sup 125/I-PAH. GFR and renal plasma flow (ERPF) were calculated from urine and a mid-time plasma sample during APII or saline infusion. Following changes in infusion rates, urine from the first 5 min was discarded, after which a 10-min collection was made. APII (0.5-4 ..mu..g/kg/min) increased water, Na/sup +/ and K/sup +/ output maximally during 2 ..mu..g/kg/min. ERPF decreased from 10.7 +/- 1.1 ml/min to 7.9 +/- 0.5 ml/min. GFR did not change significantly. Filtration fraction increased from 24 +/- 1% to 33 +/- 2%. Fractional water excretion increased from 0.8 +/- 0.2% to 2.5 +/- 0.7%. Saline infusions did not affect renal function. The results indicate that in conscious SHR, APII causes diuresis and natriuresis which does not depend upon increased GFR, but, rather, upon a primary tubular effect.

  15. Recent Advances In Topical Therapy In Dermatology

    Directory of Open Access Journals (Sweden)

    Mohan Thappa Devinder

    2003-01-01

    Full Text Available With changing times various newer topical agents are introduced in the field of dermatology. Tacrolimus and pimecrolimus are immunisuppressants, which are effective topically and are tried in the management of atopic dermatitis as well as other disorders including allergic contact dermatitis, atrophic lichen planus, pyoderma gangrenosum. Imiquimod, an immune response modifier, is presently in use for genital warts but has potentials as anti- tumour agent and in various other dermatological conditions when used topically. Tazarotene is a newer addition to the list of topical reginoids, which is effective in psoriasis and has better effect in combination with calcipotriene, phototherapy and topical costicosteroids. Tazarotene and adapelene are also effective in inflammatory acne. Calcipotriol, a vitamin D analogue has been introduced as a topical agent in the treatment of psoriasis. Steroid components are also developed recently which will be devoid of the side effects but having adequate anti-inflammatory effect. Topical photodynamic therapy has also a wide range of use in dermatology. Newer topical agents including cidofovir, capsaicin, topical sensitizers, topical antifungal agents for onychomycosis are also of use in clinical practice. Other promising developments include skin substitutes and growth factors for wound care.

  16. Selected topics of fluid mechanics

    Science.gov (United States)

    Kindsvater, Carl E.

    1958-01-01

    the Euler, Froude, Reynolds, Weber, and Cauchy numbers are defined as essential tools for interpreting and using experimental data. The derivations of the energy and momentum equations are treated in detail. One-dimensional equations for steady nonuniform flow are developed, and the restrictions applicable to the equations are emphasized. Conditions of uniform and gradually varied flow are discussed, and the origin of the Chezy equation is examined in relation to both the energy and the momentum equations. The inadequacy of all uniform-flow equations as a means of describing gradually varied flow is explained. Thus, one of the definitive problems of river hydraulics is analyzed in the light of present knowledge. This report is the outgrowth of a series of short schools conducted during the spring and summer of 1953 for engineers of the Surface Water Branch, Water Resources Division, U. S. Geological Survey. The topics considered are essentially the same as the topics selected for inclusion in the schools. However, in order that they might serve better as a guide and outline for informal study, the arrangement of the writer's original lecture notes has been considerably altered. The purpose of the report, like the purpose of the schools which inspired it, is to build a simple but strong framework of the fundamentals of fluid mechanics. It is believed that this framework is capable of supporting a detailed analysis of most of the practical problems met by the engineers of the Geological Survey. It is hoped that the least accomplishment of this work will be to inspire the reader with the confidence and desire to read more of the recent and current technical literature of modern fluid mechanics.

  17. Topical ocular delivery of NSAIDs.

    Science.gov (United States)

    Ahuja, Munish; Dhake, Avinash S; Sharma, Surendra K; Majumdar, Dipak K

    2008-06-01

    In ocular tissue, arachidonic acid is metabolized by cyclooxygenase to prostaglandins which are the most important lipid derived mediators of inflammation. Presently nonsteroidal anti-inflammatory drugs (NSAIDs) which are cyclooxygenase (COX) inhibitors are being used for the treatment of inflammatory disorders. NSAIDs used in ophthalmology, topically, are salicylic-, indole acetic-, aryl acetic-, aryl propionic- and enolic acid derivatives. NSAIDs are weak acids with pKa mostly between 3.5 and 4.5, and are poorly soluble in water. Aqueous ophthalmic solutions of NSAIDs have been made using sodium, potassium, tromethamine and lysine salts or complexing with cyclodextrins/solubilizer. Ocular penetration of NSAID demands an acidic ophthalmic solution where cyclodextrin could prevent precipitation of drug and minimize its ocular irritation potential. The incompatibility of NSAID with benzalkonium chloride is avoided by using polysorbate 80, cyclodextrins or tromethamine. Lysine salts and alpha-tocopheryl polyethylene glycol succinate disrupt corneal integrity, and their use requires caution. Thus a nonirritating ophthalmic solution of NSAID could be formulated by dissolving an appropriate water-soluble salt, in the presence of cyclodextrin or tromethamine (if needed) in mildly acidified purified water (if stability permits) with or without benzalkonium chloride and polyvinyl alcohol. Amide prodrugs met with mixed success due to incomplete intraocular hydrolysis. Suspension and ocular inserts appear irritating to the inflamed eye. Oil drop may be a suitable option for insoluble drugs and ointment may be used for sustained effect. Recent studies showed that the use of colloidal nanoparticle formulations and the potent COX 2 inhibitor bromfenac may enhance NSAID efficacy in eye preparations.

  18. AP1000模块化施工分析%Analysis of the AP1000 Modular Construction

    Institute of Scientific and Technical Information of China (English)

    邹玮

    2014-01-01

    文章针对AP1000机组模块化施工的技术和进度特点进行了分析,特别是对AP1000模块化施工面临的挑战和问题进行了深入的分析.这些挑战和问题有些是首台AP1000机组所特有的,有些将在后续AP1000机组建设过程中继续存在,文章分别阐述并提出了几项建议措施.

  19. A Comparative Clinical Trial of Topical Triamcinolone (Adcortyle and a Herbal Solution for the Treatment of Minor Aphthous Stomatitis

    Directory of Open Access Journals (Sweden)

    F Rad

    2010-10-01

    The aim of this study was to compare the therapeutic effect of topical Myrtus communis (myrtle solution with topical triamcinolone (Adcortyle in the treatment of minor apotheosis. Materials & Methods: This clinical-trial study was conducted at Kurdistan University of Medical Sciences in 2009. 100 patients were randomly assigned into 2 groups. The 1st group received topical myrtle solution. The 2nd group received topical trimcinolone (Adcortyle. After one week, patients' declaration about time of the recovery of the pain and deterioration of oral lesion was recorded. The gathered data was then analyzed using the SPSS statistical software using t-test and chi-square. Results: After treatment, both groups showed response to topical medications with no significant difference between them (p>0.05. Conclusion: results of this study showed that topical myrtle solution is effective in the treatment of minor aphthous stomatitis and its therapeutic effect is comparable with topical triamcinolone (Adcortyle.

  20. Usage-Oriented Topic Maps Building Approach

    Science.gov (United States)

    Ellouze, Nebrasse; Lammari, Nadira; Métais, Elisabeth; Ben Ahmed, Mohamed

    In this paper, we present a collaborative and incremental construction approach of multilingual Topic Maps based on enrichment and merging techniques. In recent years, several Topic Map building approaches have been proposed endowed with different characteristics. Generally, they are dedicated to particular data types like text, semi-structured data, relational data, etc. We note also that most of these approaches take as input monolingual documents to build the Topic Map. The problem is that the large majority of resources available today are written in various languages, and these resources could be relevant even to non-native speakers. Thus, our work is driven towards a collaborative and incremental method for Topic Map construction from textual documents available in different languages. To enrich the Topic Map, we take as input a domain thesaurus and we propose also to explore the Topic Map usage which means available potential questions related to the source documents.

  1. Data of evolutionary structure change: 1AP4A-1CLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AP4A-1CLMA 1AP4 1CLM A A ---------------------------------------...DDS LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDR...36 1CLM A 1CLMA

  2. Tracking topic birth and death in LDA.

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Andrew T.; Robinson, David Gerald

    2011-09-01

    Most topic modeling algorithms that address the evolution of documents over time use the same number of topics at all times. This obscures the common occurrence in the data where new subjects arise and old ones diminish or disappear entirely. We propose an algorithm to model the birth and death of topics within an LDA-like framework. The user selects an initial number of topics, after which new topics are created and retired without further supervision. Our approach also accommodates many of the acceleration and parallelization schemes developed in recent years for standard LDA. In recent years, topic modeling algorithms such as latent semantic analysis (LSA)[17], latent Dirichlet allocation (LDA)[10] and their descendants have offered a powerful way to explore and interrogate corpora far too large for any human to grasp without assistance. Using such algorithms we are able to search for similar documents, model and track the volume of topics over time, search for correlated topics or model them with a hierarchy. Most of these algorithms are intended for use with static corpora where the number of documents and the size of the vocabulary are known in advance. Moreover, almost all current topic modeling algorithms fix the number of topics as one of the input parameters and keep it fixed across the entire corpus. While this is appropriate for static corpora, it becomes a serious handicap when analyzing time-varying data sets where topics come and go as a matter of course. This is doubly true for online algorithms that may not have the option of revising earlier results in light of new data. To be sure, these algorithms will account for changing data one way or another, but without the ability to adapt to structural changes such as entirely new topics they may do so in counterintuitive ways.

  3. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands.

    Science.gov (United States)

    Abe, Yukiko S; Sasaki, Shigeki

    2016-02-15

    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site.

  4. Identification of key research needs for topical therapy treatment of psoriasis - a consensus paper by the International Psoriasis Council.

    Science.gov (United States)

    Wu, J J; Lynde, C W; Kleyn, C E; Iversen, L; van der Walt, J M; Carvalho, A; Kirby, B; Bissonnette, R

    2016-07-01

    In this age of expanding choices of therapy for psoriasis, topical therapies still play an important part in the management of patients. There are many knowledge gaps in topical therapy for psoriasis with regard to efficacy and safety as well as various combinations including topical therapy with phototherapy or with systemic agents. Councillors of the International Psoriasis Council comprised a topical therapy working group to describe these gaps in order to help direct future research endeavours. Herein, we present the results of this analysis, discuss topical agents in clinical development and the attributes of the ideal topical treatment for psoriasis.

  5. The treatment of rosacea with topical ivermectin.

    Science.gov (United States)

    Ali, S T; Alinia, H; Feldman, S R

    2015-04-01

    The treatment of rosacea is challenging because several pathophysiologic processes may be involved, including neurovascular dysregulation and alterations in innate immune status. Demodex mites may play a role in the latter mechanism. Topical ivermectin is a new therapeutic modality which demonstrates antiparasitic and anti-inflammatory properties. This article reviews published evidence related to the efficacy and safety of topical ivermectin. PubMed was utilized to search for key words "topical ivermectin", "ivermectin cream" and "rosacea". Three clinical trials were found that studied topical ivermectin as a treatment option for rosacea. Ivermectin was effective, safe and well tolerated.

  6. Analysis of an accident type sbloca in reactor contention AP1000 with 8.0 Gothic code; Analisis de un accidente tipo Sbloca en la contencion del reactor AP1000 con el codigo Gothic 8.0

    Energy Technology Data Exchange (ETDEWEB)

    Goni, Z.; Jimenez Varas, G.; Fernandez, K.; Queral, C.; Montero, J.

    2016-08-01

    The analysis is based on the simulation of a Small Break Loss-of-Coolant-Accident in the AP1000 nuclear reactor using a Gothic 8.0 tri dimensional model created in the Science and Technology Group of Nuclear Fision Advanced Systems of the UPM. The SBLOCA has been simulated with TRACE 5.0 code. The main purpose of this work is the study of the thermo-hydraulic behaviour of the AP1000 containment during a SBLOCA. The transients simulated reveal close results to the realistic behaviour in case of an accident with similar characteristics. The pressure and temperature evolution enables the identification of the accident phases from the RCS point of view. Compared to the licensing calculations included in the AP1000 Safety Analysis, it has been proved that the average pressure and temperature evolution is similar, yet lower than the licensing calculations. However, the temperature and inventory distribution are significantly heterogeneous. (Author)

  7. Cotidiano de portadores de esquizofrenia, após uso de um antipsicótico atípico e acompanhamento em grupo: visão do familiar Cotidiano de los portadores de esquizofrenia después del uso del antipsicótico atípico y acompañamiento en grupo: el punto de vista del familiar Schizophrenia patients' daily life after the use of clozapine and group accompaniment: family's view

    Directory of Open Access Journals (Sweden)

    Ana Maria Sertori Durão

    2006-08-01

    Full Text Available Este estudo descreveu o cotidiano do portador de esquizofrenia, após o uso de antipsicótico atípico e acompanhamento em grupo, na visão do familiar. A população foi constituída por 11 familiares que acompanharam com maior freqüência os 11 portadores de esquizofrenia que participam do grupo e utilizam antipisicótico. Para coleta de dados utilizou-se de entrevista semi-estruturada, guiada por roteiro, no mês de abril de 2003. Essas foram gravadas e, posteriormente, transcritas na íntegra. Obteve-se, como resultados, melhora do paciente quanto aos sintomas da doença evidenciada, pela diminuição do isolamento social, retomada de atividades domésticas/trabalho e estudo e participação em atividades de convívio social. Tais resultados apontam a necessidade de um novo olhar para o portador de transtorno mental e seus familiares, no sentido de buscar atitudes terapêuticas mais adequadas que atuem na produção de vida visando novo sentido para a existência, nas diferentes formas de convivência e de sociabilidade.Este estudio describió el cotidiano del portador de esquizofrenia después del uso de clozapina y acompañamiento en grupo de acuerdo con el punto de vista de los familiares. La población fue constituida por 11 familiares que acompañaron de manera más frecuente los 11 portadores de esquizofrenia que participaron del grupo y utilizan clozapina. Para la recopilación de datos se utilizó una entrevista orientada por guión, en abril de 2003. Las entrevistas fueron registradas y después transcritas por entero. Los resultados indicaron la mejoría de los pacientes con respecto a los síntomas de la enfermedad, evidenciada por la disminución del aislamiento social, recomienzo de actividades domésticas/trabajo y estudio y participación en actividades de convivencia social. Tales resultados señalan la necesidad de una nueva manera de mirar el portador de trastorno mental y sus familiares en el sentido de buscar actitudes

  8. Special Operations Research Topics 2016

    Science.gov (United States)

    2015-01-01

    intermediate leaders and selected other national and international security decision makers, both military and civilian, through teaching , outreach, and... Anthropology Galisteo Consulting Group and JSOU Senior Fellow Francisco R. Wong-Diaz J.D., Ph.D., Political Science Professor of international...warfare (UW) missions, how critical are language capabilities? How does culture and cultural intelligence play a role? Should training be broadened

  9. Topical tranexamic acid as a promising treatment for melasma

    Science.gov (United States)

    Ebrahimi, Bahareh; Naeini, Farahnaz Fatemi

    2014-01-01

    Background: In recent times, tranexamic acid (TA) is claimed to have whitening effects especially for ultraviolet-induced hyperpigmentation including melasma. The aim of our study was to evaluate the efficacy and safety of topical solution of TA and compare it with combined solution of hydroquinone and dexamethasone as the gold standard treatment of melasma in Iranian women. Materials and Methods: This was a double-blind split-face trial of 12 weeks which was conducted in Isfahan, Iran. Fifty Iranian melasma patients applied topical solution of 3% TA on one side of the face, and topical solution of 3% hydroquinone + 0.01% dexamethasone on the other side two times a day. The Melasma Area and Severity Index (MASI) and the side effects were evaluated at baseline and every 4 weeks before and after photographs to be compared by a dermatologist were taken. The patient satisfaction was documented at week 12. Results: A repeated measurement analysis was used to evaluate the changes in the MASI score before and after treatments. A significant decreasing trend was observed in the MASI score of both groups with no significant difference between them during the study (P < 0.05). No differences were seen in patients’ and investigator's satisfaction of melasma improvement between two groups (P < 0.05). However, the side effects of hydroquinone + dexamethasone were significantly prominent compared with TA (P = 0.01). Conclusion: This study's results introduce the topical TA as an effective and safe medication for the treatment of melasma. PMID:25422661

  10. 5-Substituents in the uridine moiety and their effect on the conformation of ApU-type dinucleoside phosphates.

    Science.gov (United States)

    Hillen, W; Gassen, G

    1978-03-29

    The ApU analogues ApT, Apcl5U, Apbr5U, Apa5U and Apno5(2)U were synthesized with the aid of ribonuclease U2 starting from 2',3'-cyclic Ap and the respective uridine derivatives. For these compounds the ultraviolet data, the difference spectra, the hypochromism and the temperature dependence of the CD spectra are reported. The dimerisation shifts of the pyrimidine protons which were obtained from the 100 MHz PMR spectra confirm the optical results. The influence of the substituents in the 5 position of the uracil ring on base-base interaction and the conformation of the dinucleoside phosphates is discussed with respect to the van der Waals radii and the electronic effects of these groups. As calculated from the hypochromism the dinucleoside phosphates can be arranged according to decreasing base-base interaction: Apno5(2)U greater than Apbr5U approximately ApT greater than Apcl5U greater than ApU greater than Apa5U.

  11. Groups, rings, modules

    CERN Document Server

    Auslander, Maurice

    2014-01-01

    This classic monograph is geared toward advanced undergraduates and graduate students. The treatment presupposes some familiarity with sets, groups, rings, and vector spaces. The four-part approach begins with examinations of sets and maps, monoids and groups, categories, and rings. The second part explores unique factorization domains, general module theory, semisimple rings and modules, and Artinian rings. Part three's topics include localization and tensor products, principal ideal domains, and applications of fundamental theorem. The fourth and final part covers algebraic field extensions

  12. SU-E-T-14: A Feasibility Study of Using Modified AP Proton Beam for Post-Operative Pancreatic Cancer Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Ding, X; Witztum, A; Kenton, O; Younan, F; Dormer, J; Kremmel, E; Lin, H; Liu, H; Tang, S; Both, S; Kassaee, A; Avery, S [UniversityPennsylvania, Philadelphia, PA (United States)

    2014-06-01

    Purpose: Due to the unpredictability of bowel gas movement, the PA beam direction is always favored for robust proton therapy in post-operative pancreatic cancer treatment. We investigate the feasibility of replacing PA beam with a modified AP beam to take the bowel gas uncertainty into account. Methods: Nine post-operative pancreatic cancer patients treated with proton therapy (5040cGy, 28 fractions) in our institution were randomly selected. The original plan uses PA and lateral direction passive-scattering proton beams. Beam weighting is about 1:1. All patients received weekly verification CTs to assess the daily variations(total 17 verification CTs). The PA direction beam was replaced by two other groups of AP direction beam. Group AP: takes 3.5% range uncertainty into account. Group APmod: compensates the bowel gas uncertainty by expanding the proximal margin to 2cm more. The 2cm margin was acquired from the average bowel diameter in from 100 adult abdominal CT scans near pancreatic region (+/- 5cm superiorly and inferiorly). Dose Volume Histograms(DVHs) of the verification CTs were acquired for robustness study. Results: Without the lateral beam, Group APmod is as robust as Group PA. In Group AP, more than 10% of iCTV D98/D95 were reduced by 4–8%. LT kidney and Liver dose robustness are not affected by the AP/PA beam direction. There is 10% of chance that RT kidney and cord will be hit by AP proton beam due to the bowel gas. Compared to Group PA, APmod plan reduced the dose to kidneys and cord max significantly, while there is no statistical significant increase in bowel mean dose. Conclusion: APmod proton beam for the target coverage could be as robust as the PA direction without sacrificing too much of bowel dose. When the AP direction beam has to be selected, a 2cm proximal margin should be considered.

  13. Nuffield Advanced Chemistry Courses Topic 10

    Science.gov (United States)

    Education in Science, 1975

    1975-01-01

    Presents an alternative series of investigations replacing the propanone-trichloromethane system (Topic 10) in the Nuffield A-Level course. A trichloromethane-ethyl ethanoate (acetate) system presented in four experiments give good results and removed the dangers arising from the other system. Topic 10 need not be re-written, just the replacement…

  14. Topic Maps Based Project Knowledge Management

    Institute of Scientific and Technical Information of China (English)

    Wu Xiaofan; Zhou Liang; Zhang Lei; Li Lingzhi; Ding Qiulin

    2006-01-01

    Based on topic maps, a preprocessing scheme using similarity comparision is presented and applied in knowledge management.Topic and occurrence-oriented merging algorithm is also introduced to implement knowledge integration for the sub-system. An Omnigator-supported example from an aeroaustic institute is utilised to validate the preprocessing method and the result indicates it can speed up the research schedule.

  15. Severe photosensitivity reaction induced by topical diclofenac

    OpenAIRE

    Akat, Pramod B.

    2013-01-01

    Albeit uncommon, photosensitivity reaction induced by diclofenac can be an unfortunate adverse reaction complicating its use as a topical analgesic. We here present a case of a patient who suffered such a reaction as a result of exposure to diclofenac, employed as a topical analgesic for low backache. The lesions healed with conservative management without extensive scarring or other complications.

  16. Fostering Topic Knowledge: Essential for Academic Writing

    Science.gov (United States)

    Proske, Antje; Kapp, Felix

    2013-01-01

    Several researchers emphasize the role of the writer's topic knowledge for writing. In academic writing topic knowledge is often constructed by studying source texts. One possibility to support that essential phase of the writing process is to provide interactive learning questions which facilitate the construction of an adequate situation…

  17. Prioritizing dermatoses: rationally selecting guideline topics

    NARCIS (Netherlands)

    Borgonjen, R.J.; Everdingen, J.J. van; Kerkhof, P.C.M. van de; Spuls, P.I.

    2015-01-01

    BACKGROUND: Clinical practice guideline (CPG) development starts with selecting appropriate topics, as resources to develop a guideline are limited. However, a standardized method for topic selection is commonly missing and the way different criteria are used to prioritize is not clear. OBJECTIVES:

  18. Severe photosensitivity reaction induced by topical diclofenac

    Directory of Open Access Journals (Sweden)

    Pramod B Akat

    2013-01-01

    Full Text Available Albeit uncommon, photosensitivity reaction induced by diclofenac can be an unfortunate adverse reaction complicating its use as a topical analgesic. We here present a case of a patient who suffered such a reaction as a result of exposure to diclofenac, employed as a topical analgesic for low backache. The lesions healed with conservative management without extensive scarring or other complications.

  19. Corneal staining after treatment with topical tetracycline

    NARCIS (Netherlands)

    R. Lapid-Gortzak; C.P. Nieuwendaal; A.R. Slomovic; L. Spanjaard

    2006-01-01

    Purpose: The purpose of this paper is to report a case of corneal staining after treatment with topical tetracycline. Methods: A patient with crystalline keratopathy caused by Streptococcus viridans after corneal transplantation was treated topically with tetracycline eye drops, based on results of

  20. Psoriasis: improving adherence to topical therapy.

    NARCIS (Netherlands)

    Feldman, S.R.; Horn, E.J.; Balkrishnan, R.; Basra, M.K.; Finlay, A.Y.; McCoy, D.; Menter, A.; Kerkhof, P.C.M. van de

    2008-01-01

    Topical therapy has an important role in psoriasis treatment. It is efficacious and has a favorable safety profile as demonstrated in clinical trials. However, poor treatment outcomes from topical therapy regimens likely result from poor adherence and ineffective use of the medication. The Internati

  1. Aerodynamics of wind turbines emerging topics

    CERN Document Server

    Amano, R S

    2014-01-01

    Focusing on Aerodynamics of Wind Turbines with topics ranging from Fundamental to Application of horizontal axis wind turbines, this book presents advanced topics including: Basic Theory for Wind turbine Blade Aerodynamics, Computational Methods, and Special Structural Reinforcement Technique for Wind Turbine Blades.

  2. Histiocytosis X: treatment with topical nitrogen mustard.

    Science.gov (United States)

    Berman, B; Chang, D L; Shupack, J L

    1980-07-01

    The case histories of two elderly patients with cutaneous histiocytosis X treated topically with nitrogen mustard are presented. The cutaneous lesions cleared within 2 to 3 weeks, and remission was maintained with daily topical administration of nitrogen mustard. The clinical impression of improvement was substantiated by light and electron microscopic studies prior to and after therapy.

  3. Generating focused topic-specific sentiment lexicons

    NARCIS (Netherlands)

    Jijkoun, V.; de Rijke, M.; Weerkamp, W.

    2010-01-01

    We present a method for automatically generating focused and accurate topic-specific subjectivity lexicons from a general purpose polarity lexicon that allow users to pin-point subjective on-topic information in a set of relevant documents. We motivate the need for such lexicons in the field of medi

  4. Lattice theory special topics and applications

    CERN Document Server

    Wehrung, Friedrich

    2014-01-01

    George Grätzer's Lattice Theory: Foundation is his third book on lattice theory (General Lattice Theory, 1978, second edition, 1998). In 2009, Grätzer considered updating the second edition to reflect some exciting and deep developments. He soon realized that to lay the foundation, to survey the contemporary field, to pose research problems, would require more than one volume and more than one person. So Lattice Theory: Foundation provided the foundation. Now we complete this project with Lattice Theory: Special Topics and Applications, written by a distinguished group of experts, to cover some of the vast areas not in Foundation. This first volume is divided into three parts. Part I. Topology and Lattices includes two chapters by Klaus Keimel, Jimmie Lawson and Ales Pultr, Jiri Sichler. Part II. Special Classes of Finite Lattices comprises four chapters by Gabor Czedli, George Grätzer and Joseph P. S. Kung. Part III. Congruence Lattices of Infinite Lattices and Beyond includes four chapters by Friedrich W...

  5. Correlated Topic Model for Web Services Ranking

    Directory of Open Access Journals (Sweden)

    Mustapha AZNAG

    2013-07-01

    Full Text Available With the increasing number of published Web services providing similar functionalities, it’s very tedious for a service consumer to make decision to select the appropriate one according to her/his needs. In this paper, we explore several probabilistic topic models: Probabilistic Latent Semantic Analysis (PLSA, Latent Dirichlet Allocation (LDA and Correlated Topic Model (CTM to extract latent factors from web service descriptions. In our approach, topic models are used as efficient dimension reduction techniques, which are able to capture semantic relationships between word-topic and topic-service interpreted in terms of probability distributions. To address the limitation of keywords-based queries, we represent web service description as a vector space and we introduce a new approach for discovering and ranking web services using latent factors. In our experiment, we evaluated our Service Discovery and Ranking approach by calculating the precision (P@n and normalized discounted cumulative gain (NDCGn.

  6. Topical antioxidants in radiodermatitis: a clinical review.

    Science.gov (United States)

    Kodiyan, Joyson; Amber, Kyle T

    2015-09-01

    Radiation-induced skin toxicity is the most prevalent side effect of radiation therapy. Not only does it have a significant effect on patients' quality of life, but it also results in poor follow-up and early termination of radiotherapy treatment. Several skin care practices and topical applications have been studied in the field of radiodermatitis, including skin washing, topical steroids, and mechanical skin barriers. Aside from these methods, many patients turn to complementary and alternative medicine for the prevention and treatment of radiodermatitis. Many of these alternative therapies are topically applied antioxidants. While the rationale behind the use of antioxidants in treating radiodermatitis is strong, clinical studies have been far less consistent. Even in large scale randomised controlled trials, findings have been limited by the inconsistent use of topical vehicles and placebos. In this article, the authors review the role of topical antioxidants to better help the practitioner navigate through different available skin directed antioxidants.

  7. Prevention of aspiration pneumonia (AP) with oral care.

    Science.gov (United States)

    Tada, Akio; Miura, Hiroko

    2012-01-01

    AP is a major cause of morbidity and mortality in elderly patients, especially frail elderly patients. The aim of this article is to review effect of oral care, including oral hygiene and improvement of oral function, on the prevention of AP among elderly people in hospitals and nursing homes. There is now a substantial body of work studying the effect of oral care on the prevention of respiratory diseases. Oral hygiene, consisting of oral decontamination and mechanical cleaning by dental professionals, has resulted in significant clinical effects (decreased incidence of pneumonia and decreased mortality from respiratory diseases) in clinical randomized trials. Moreover, studies examining oral colonization by pneumonia pathogens have shown the effect of oral hygiene on eliminating these pathogens. In addition, swallowing training has been shown to improve the movement and function of swallowing-related muscles, also resulting in decreased incidence of pneumonia. These findings support the contention that oral care is effective in the prevention of AP.

  8. Westinghouse plans global new builds for AP1000

    Energy Technology Data Exchange (ETDEWEB)

    Mitev, Lubomir [NucNet, Brussels (Belgium)

    2014-10-15

    Interview with Danny Roderick, Westinghouse Electric Company, President and Chief Executive Officer since September 2012, about perspectives and future plans for AP1000 new build worldwide. Within three to four years there wille be 'shovels in the ground' for three new AP1000 reactors in the UK, as well as new units in China and Bulgaria. Four AP1000 reactors are under construction in the United States at Vogtle and VC Summer, and soon at Turkey Point. Additionally Danny Roderick spoke about the acquisition of NuGen, technology transfer, the influence of the Ukraine crises on the nuclear market in East Europe and the future need for more nuclear worldwide and in the UK and Bulgaria.

  9. Complementary Therapies for Idiopathic Hirsutism: Topical Licorice as Promising Option

    Directory of Open Access Journals (Sweden)

    Gita Faghihi

    2015-01-01

    Full Text Available Hirsutism is one of the most prevalent health problems in women. The aim of the study was to compare the effect of 755 nm alexandrite hair removal laser with that of alexandrite laser plus topical licorice on the improvement of idiopathic hirsutism. A double-blind, randomized placebo-controlled study was performed on 90 female subjects. The patients were divided into two groups: alexandrite laser plus 15% licorice gel (group A and placebo (group B. Each subject received one of both products over one side of the face, twice daily for 24 weeks on the hirsute locations. Each group underwent five sessions of alexandrite laser at 6-week intervals. To minimize the effects of confounding variables, the test was performed on two separate zones of patients’ skin. The mean ± SD numbers of terminal hairs in group A were 7.05 ± 4.55 for zone 1 and 6.06 ± 3.70 for zone 2. In group B, they were 3.18 ± 1.75 for zone 1 and 2.49 ± 1.63 for zone 2. The difference in the mean number of terminal hairs was statistically significant between the two groups (p<0.001, and there were no serious adverse reactions. The treatment of idiopathic hirsutism with 755 nm alexandrite laser plus topical licorice is more effective than alexandrite laser only.

  10. Topics on Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. Chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently coordinate the

  11. Topics in Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. To start with, chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently

  12. Topics in Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. To start with, chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently

  13. Topics on Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. Chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently coordinate the

  14. First Magnetic Doppler Images of a roAp star

    Science.gov (United States)

    Lüftinger, T.; Kochukhov, O.; Ryabchikova, T.; Weiss, W. W.; Ilyin, I.

    2007-06-01

    We present the first analysis of the magnetic field geometry and elemental abundance distributions on the surface of a rapidly oscillating Ap (roAp) star, using an elaborate magnetic Doppler Imaging (MDI) code (Piskunov et al. 2002, Kochukhov et al. 2002), inv, which allows to reconstruct simultaneously and consistently the magnetic field geometry and abundance distributions on a stellar surface without any a priori assumptions. We analysed Stokes I and V time series obtained with the SOFIN polarimeter and recovered the magnetic field and surface abundance structures of Fe and Nd (among others). These two elements are found to be anticorrelated.

  15. THE PARALLEL RECURSIVE AP ADAPTIVE ALGORITHM BASED ON VOLTERRA SERIES

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Aiming at the nonlinear system identification problem, a parallel recursive affine projection (AP) adaptive algorithm for the nonlinear system based on Volterra series is presented in this paper. The algorithm identifies in parallel the Volterra kernel of each order, recursively estimate the inverse of the autocorrelation matrix for the Volterra input of each order, and remarkably improve the convergence speed of the identification process compared with the NLMS and conventional AP adaptive algorithm based on Volterra series. Simulation results indicate that the proposed method in this paper is efficient.

  16. Review of Topical Treatment of Upper Tract Urothelial Carcinoma

    Directory of Open Access Journals (Sweden)

    Kenneth G. Nepple

    2009-01-01

    Full Text Available A select group of patients with upper tract urothelial carcinoma may be appropriate candidates for minimally invasive management. Organ-preserving endoscopic procedures may be appropriate for patients with an inability to tolerate major surgery, solitary kidney, bilateral disease, poor renal function, small tumor burden, low-grade disease, or carcinoma in situ. We review the published literature on the use of topical treatment for upper tract urothelial carcinoma and provide our approach to treatment in the office setting.

  17. Calibration of Strömgren-Crawford photometry for Ap-stars compared to Hipparcos results

    Science.gov (United States)

    Vogt, Nikolaus; Paunzen, Ernst; Maitzen, Hans M.

    25 years ago Bidelman and MacConnell (1973) published a list of nearly 800 Ap-stars which they had identified on objective prism plates collected at the Cerro Tololo Interamerican Observatory as kind of a precursor work for the huge Michigan project of two-dimensional spectral classification. This list has been used as basis for 3 different photometric projects carried out at ESO-La Silla with limiting magnitude V = 8.5: 1. uvby photometry by Vogt and Faúndez (1979); 2. δa photometry by Maitzen and Vogt (1983) in the system of Maitzen (1976) demonstrating the very high agreement of photometric Ap-detections with the spectroscopic results of Bidelman and MacConnell; 3. Hβ photometry of 226 objects which were observed at the Danish 50cm telescope on La Silla in 1982. The latter work was intended not only to formally complete Strögren-Crawford data for a significantly large set of chemically peculiar stars (excluding Am and HgMn objects) but also to yield their galactic locations. Reddening corrections mattered only for the hot peculiars. Absolute magnitudes were derived according to the calibrations worked out by Crawford two decades ago for normal main sequence AB stars. The Hipparcos catalogue which appeared in 1997 offers an independent way to check whether these calibrations derived for normal stars do apply also for chemically peculiar stars. Fortunately, we identified Hipparcos parallaxes for two thirds of our sample. We divided our objects according to 3 calibration groups: early (= B type stars), intermediate (A0-A2 type stars), late (other A type stars). First of all we consider normal stars with published β-values in order to compare their photometric absolute magnitudes to those based on the Hipparcos catalogue. The degree of correlation between both quantities is not excellent for the normal B-type stars, but no systematic trend is visible. For the stars around the Balmer maximum (intermediate group) we also do not recognize a significant systematic

  18. Assessment of topical versus oral ivermectin as a treatment for head lice.

    Science.gov (United States)

    Ahmad, Hesham M; Abdel-Azim, Eman S; Abdel-Aziz, Rasha T

    2014-01-01

    Many medications are available for treatment of pediculosis capitis including ivermectin. Our aim is to compare the efficacy and safety of topical versus oral ivermectin in treatment of pediculosis capitis. Sixty-two patients with proved head lice infestation were included and divided into group I (31 patients; received single topical application of 1% ivermectin) and group II (31 patients; received single dose of oral ivermectin). Treatment was repeated after 1 week for nonresponders. At 1 week after treatment, the eradication rates and improvement of pruritus were significantly higher among patients who received topical than oral ivermectin. When a second treatment, topical or oral, was given to nonresponders, the cure rates of infestation and pruritus was 100% and 97% among patients treated with topical and oral ivermectin, respectively with no significant difference between the two groups. This study suggests that both topical and oral ivermectin demonstrate high efficacy and tolerability in treatment of pediculosis capitis. However, a single treatment with topical ivermectin provides significantly higher cure of infestation and faster relief of pruritus than oral ivermectin. In addition, whether topical or oral ivermectin is used to treat head lice, a second dose is required in some cases to ensure complete eradication.

  19. Control of pain with topical plant medicines

    Institute of Scientific and Technical Information of China (English)

    James; David; Adams; Jr.; Xiaogang; Wang

    2015-01-01

    Pain is normally treated with oral nonsteroidal anti-inflammatory agents and opioids. These drugs are dangerous and are responsible for many hospitalizations and deaths. It is much safer to use topical preparations made from plants to treat pain, even severe pain. Topical preparations must contain compounds that penetrate the skin, inhibit pain receptors such as transient receptor potential cation channels and cyclooxygenase-2, to relieve pain. Inhibition of pain in the skin disrupts the pain cycle and avoids exposure of internal organs to large amounts of toxic compounds. Use of topical pain relievers has the potential to save many lives, decrease medical costs and improve therapy.

  20. Large scale topic modeling made practical

    DEFF Research Database (Denmark)

    Wahlgreen, Bjarne Ørum; Hansen, Lars Kai

    2011-01-01

    Topic models are of broad interest. They can be used for query expansion and result structuring in information retrieval and as an important component in services such as recommender systems and user adaptive advertising. In large scale applications both the size of the database (number of docume......Topic models are of broad interest. They can be used for query expansion and result structuring in information retrieval and as an important component in services such as recommender systems and user adaptive advertising. In large scale applications both the size of the database (number...... topics at par with a much larger case specific vocabulary....

  1. A prospective double-blind placebo controlled trial of topical tranexamic acid in total knee arthroplasty.

    Science.gov (United States)

    Georgiadis, Andrew G; Muh, Stephanie J; Silverton, Craig D; Weir, Robb M; Laker, Michael W

    2013-09-01

    Tranexamic acid (TNA) reduces postoperative blood loss in general and obstetrical surgery but there is limited orthopaedic literature regarding its use in the topical setting. To study the effect of topical TNA after primary total knee arthroplasty (TKA), 101 patients were randomized to topical administration of 2.0g TNA in 75mL of normal saline (50 patients) or placebo (51 patients). Operative technique, drug administration, and venous thromboembolism prophylaxis were standardized. All patients underwent screening ultrasound of the operative extremity. Total blood loss was lower in the TNA group (940.2±327.1mL) than the placebo group (1293.1±532.7mL)(P<0.001), and four patients in the placebo group and none in the TNA group received postoperative transfusion (P=0.118). We recommend administration of topical TNA in primary TKA in healthy patients to decrease perioperative blood loss.

  2. Topics in Double Field Theory

    Science.gov (United States)

    Kwak, Seung Ki

    The existence of momentum and winding modes of closed string on a torus leads to a natural idea that the field theoretical approach of string theory should involve winding type coordinates as well as the usual space-time coordinates. Recently developed double field theory is motivated from this idea and it implements T-duality manifestly by doubling the coordinates. In this thesis we will mainly focus on the double field theory formulation of different string theories in its low energy limit: bosonic, heterotic, type II and its massive extensions, and N = 1 supergravity theory. In chapter 2 of the thesis we study the equivalence of different formulations of double field theory. There are three different formulations of double field theory: background field E formulation, generalized metric H formulation, and frame field EAM formulation. Starting from the frame field formalism and choosing an appropriate gauge, the equivalence of the three formulations of bosonic theory are explicitly verified. In chapter 3 we construct the double field theory formulation of heterotic strings. The global symmetry enlarges to O( D, D + n) for heterotic strings and the enlarged generalized metric features this symmetry. The structural form of bosonic theory can directly be applied to the heterotic theory with the enlarged generalized metric. In chapter 4 we develop a unified framework of double field theory for type II theories. The Ramond-Ramond potentials fit into spinor representations of the duality group O( D, D) and the theory displays Spin+( D, D) symmetry with its self-duality relation. For a specific form of RR 1-form the theory reduces to the massive deformation of type IIA theory due to Romans. In chapter 5 we formulate the N = 1 supersymmetric extension of double field theory including the coupling to n abelian vector multiplets. This theory features a local O(1, 9 + n) x O(1, 9) tangent space symmetry under which the fermions transform. (Copies available exclusively from

  3. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses

    Science.gov (United States)

    Prilliman, Stephen G.

    2014-01-01

    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  4. Penetration dynamics of AP8 in thin ceramic tiles

    NARCIS (Netherlands)

    Abadjieva, E.; Khoe, Y.S.

    2013-01-01

    The interaction of thin ceramic tiles with AP8 (WC core, 7,62 mm) at 1000 m/s velocity has been studied experimentally and numerically. “Thin” ceramic tiles refers here to ratio of the tile thickness (t) to the projectile diameter, (d), t/d@ 1, as they are both in the same order. The method applied

  5. Research on CoAP%CoAP协议研究

    Institute of Scientific and Technical Information of China (English)

    刘紫青; 程燕; 关联; 桑梓勤; 郝俊瑞

    2013-01-01

    For some M2M applications, there exists problems of constrained networks and nodes, and the HTTP isn't applicable. The Constrained Application Protocol (CoAP) is described and analyzed in this paper, and the mapping between CoAP and HTTP is also included. Then, the comparison of the two protocols is researched. Finally, it can be concluded that CoAP is simple and its overhead is very low, which can well meet the application layer' s communications requirements in the constrained environment.%针对某些M2M应用中存在网络和节点资源受限的情况,不适用HTTP,介绍和分析了受限应用协议CoAP(Constrained Application Protocol)的特点及其与HTTP的映射,并将CoAP和HTTP进行对比研究,发现CoAP简单、开销小,能很好地满足资源受限环境的应用层通信需求.

  6. Pulmonary Rehabilitation: MedlinePlus Health Topic

    Science.gov (United States)

    ... Related Issues Breathing and Relaxation (National Jewish Health) DANCE Your Way to Healthier Lungs (American Association for Respiratory Care) Exercises (National Jewish Health) Oxygen Therapy: MedlinePlus Health Topic (National Library of Medicine) Also ...

  7. Corneal Neurotoxicity Due to Topical Benzalkonium Chloride

    OpenAIRE

    Sarkar, Joy; Chaudhary, Shweta; Namavari, Abed; Ozturk, Okan; Chang, Jin-Hong; Yco, Lisette; Sonawane, Snehal; Khanolkar, Vishakha; Hallak, Joelle; Jain, Sandeep

    2012-01-01

    Topical application of benzalkonium chloride (BAK) to the eye causes dose-related corneal neurotoxicity. Corneal inflammation and reduction in aqueous tear production accompany neurotoxicity. Cessation of BAK treatment leads to recovery of corneal nerve density.

  8. Topical cidofovir for refractory verrucae in children.

    Science.gov (United States)

    Gupta, Monique; Bayliss, Susan J; Berk, David R

    2013-01-01

    Warts are common and are a challenge to treat in some children, especially immunocompromised children and those who fail or cannot tolerate salicylic acid preparations and cryotherapy. Cidofovir, a nucleotide analogue with antiviral activity, has demonstrated promising results when compounded into a topical form to treat refractory warts. We present a retrospective institutional review of 12 children with refractory verrucae treated with 1% to 3% topical cidofovir compounded in an unscented moisturizing cream, applied every other day to daily. In our institutional series, only three patients (25%) demonstrated complete clearance of their verrucae. An additional four patients (33%) demonstrated partial clearance. Our experience using topical cidofovir has been less successful than previous institutional reviews, possibly because we used a lower concentration and less-frequent dosing. More studies are needed to better characterize the efficacy, safety, and dosing of topical cidofovir for the treatment of refractory warts.

  9. Diabetes: MedlinePlus Health Topic

    Science.gov (United States)

    ... Foundation for Medical Education and Research) Prevention and Risk Factors Choose More than 50 Ways to Prevent Type ... Resources for Living Well (National Diabetes Education Program) Diabetic Diet: MedlinePlus Health Topic (National Library of Medicine) ...

  10. Teenage Pregnancy: MedlinePlus Health Topic

    Science.gov (United States)

    ... Tips for Parents to Help Their Children Avoid Teen Pregnancy (National Campaign to Prevent Teen and Unplanned Pregnancy) - PDF Living With Pregnancy and Nutrition: MedlinePlus Health Topic (National Library of Medicine) Also ...

  11. Mining Concurrent Topical Activity in Microblog Streams

    CERN Document Server

    Panisson, A; Quaggiotto, M; Cattuto, C

    2014-01-01

    Streams of user-generated content in social media exhibit patterns of collective attention across diverse topics, with temporal structures determined both by exogenous factors and endogenous factors. Teasing apart different topics and resolving their individual, concurrent, activity timelines is a key challenge in extracting knowledge from microblog streams. Facing this challenge requires the use of methods that expose latent signals by using term correlations across posts and over time. Here we focus on content posted to Twitter during the London 2012 Olympics, for which a detailed schedule of events is independently available and can be used for reference. We mine the temporal structure of topical activity by using two methods based on non-negative matrix factorization. We show that for events in the Olympics schedule that can be semantically matched to Twitter topics, the extracted Twitter activity timeline closely matches the known timeline from the schedule. Our results show that, given appropriate techn...

  12. Pain Relievers: MedlinePlus Health Topic

    Science.gov (United States)

    ... Physicians) Also in Spanish Medicines for Pain: From Osteoarthritis to Muscle Pain (National Center for Farmworker Health, ... Institutes of Health Page last updated on 16 March 2017 Topic last reviewed: 29 December 2016

  13. Hip Replacement: MedlinePlus Health Topic

    Science.gov (United States)

    ... damage. The most common cause of damage is osteoarthritis . Osteoarthritis causes pain, swelling, and reduced motion in your ... Institutes of Health Page last updated on 17 March 2017 Topic last reviewed: 31 August 2016

  14. MedlinePlus Health Topic Web Service

    Data.gov (United States)

    U.S. Department of Health & Human Services — A search-based Web service that provides access to disease, condition and wellness information via MedlinePlus health topic data in XML format. The service accepts...

  15. Sports Safety: MedlinePlus Health Topic

    Science.gov (United States)

    ... exercise injuries Returning to sports after a back injury Sports physical Related Health Topics Sports Fitness Sports Injuries Water Safety (Recreational) Languages Hmong (Hmoob) Russian (Русский) ...

  16. Helpful Contacts - Agency List By Topic

    Data.gov (United States)

    U.S. Department of Health & Human Services — A database of agencies listed by state and topic to provide you with contact information for specific organizations or help you get answers to your Medicare related...

  17. Efficacy of Topical Anesthetics in the Treatment of Ingrown Nail

    Directory of Open Access Journals (Sweden)

    Fatma Gülru Erdoğan

    2011-06-01

    Full Text Available Background and Design: One of the reasons for preferring conservative methods for ingrown nails is lack of local anesthesia for the painful step. Moreover, ingrown nail is a painful condition per se. It may be very difficult to intervene patients with high basal pain levels. Here, we aimed to assess the efficacy of topical anesthetics (2.5% lidocaine, 2.5% prilocaine mixture and 20% benzocaine gel by determining basal pain level and pain during and after manipulation in patients with severe pain who applied with ingrown nail complaint.Material and Method: In this study, we included a total of 29 patients (12 male, 17 female who had complaint of ingrown nail and for whom nail brace treatment was planned. The patients were divided randomly into two groups regardless of the stage of ingrown nail: with lidocain-prilocain mixture application and with benzocaine gel application. Benzocaine gel was applied 10 minutes before the procedure and lidocaine-prilocaine mixture was applied under occlusion, 2 hours prior to the procedure. Pain levels were evaluated on a numerical pain rating scale before and after topical anesthesia as well as during and half an hour after the procedure in both groups.Results: Statistical difference was not detected between the pain levels of the two groups before and after topical anesthesia and during and half an hour after the procedure. Regardless of the stage of ingrown nail, the pain levels after topical anesthesia and half an hour after procedure were found to decrease significantly compared to the levels before topical anesthesia in both groups. Pain levels of both groups increased during the procedure and were similar to the basal levels. Considering the stage of ingrown nail, while lidocaine-prilocaine mixture did not decrease pain significantly in the cases with stage 2-3, benzocaine did. Conclusion: Due to ease of application and especially to efficacy in stage 2-3 ingrown nails, 20% benzocaine gel may help in

  18. Pharmacogenetics of ophthalmic topical β-blockers

    OpenAIRE

    Sidjanin, Duska J.; McCarty, Catherine A.; Patchett, Richard; Smith, Edward; Wilke, Russell A.

    2008-01-01

    Glaucoma is the second leading cause of blindness worldwide. The primary glaucoma risk factor is elevated intraocular pressure. Topical β-blockers are affordable and widely used to lower intraocular pressure. Genetic variability has been postulated to contribute to interpersonal differences in efficacy and safety of topical β-blockers. This review summarizes clinically significant polymorphisms that have been identified in the β-adrenergic receptors (ADRB1, ADRB2 and ADRB3). The implications ...

  19. Topical steroid addiction in atopic dermatitis

    Directory of Open Access Journals (Sweden)

    Fukaya M

    2014-10-01

    Full Text Available Mototsugu Fukaya,1 Kenji Sato,2 Mitsuko Sato,3 Hajime Kimata,4 Shigeki Fujisawa,5 Haruhiko Dozono,6 Jun Yoshizawa,7 Satoko Minaguchi8 1Tsurumai Kouen Clinic, Nagoya, 2Department of Dermatology, Hannan Chuo Hospital, Osaka, 3Sato Pediatric Clinic, Osaka, 4Kimata Hajime Clinic, Osaka, 5Fujisawa Dermatology Clinic, Tokyo, 6Dozono Medical House, Kagoshima, 7Yoshizawa Dermatology Clinic, Yokohama, 8Department of Dermatology, Kounosu Kyousei Hospital, Saitama, Japan Abstract: The American Academy of Dermatology published a new guideline regarding topical therapy in atopic dermatitis in May 2014. Although topical steroid addiction or red burning skin syndrome had been mentioned as possible side effects of topical steroids in a 2006 review article in the Journal of the American Academy of Dermatology, no statement was made regarding this illness in the new guidelines. This suggests that there are still controversies regarding this illness. Here, we describe the clinical features of topical steroid addiction or red burning skin syndrome, based on the treatment of many cases of the illness. Because there have been few articles in the medical literature regarding this illness, the description in this article will be of some benefit to better understand the illness and to spur discussion regarding topical steroid addiction or red burning skin syndrome. Keywords: topical steroid addiction, atopic dermatitis, red burning skin syndrome, rebound, corticosteroid, eczema

  20. Group performance and decision making.

    Science.gov (United States)

    Kerr, Norbert L; Tindale, R Scott

    2004-01-01

    Theory and research on small group performance and decision making is reviewed. Recent trends in group performance research have found that process gains as well as losses are possible, and both are frequently explained by situational and procedural contexts that differentially affect motivation and resource coordination. Research has continued on classic topics (e.g., brainstorming, group goal setting, stress, and group performance) and relatively new areas (e.g., collective induction). Group decision making research has focused on preference combination for continuous response distributions and group information processing. New approaches (e.g., group-level signal detection) and traditional topics (e.g., groupthink) are discussed. New directions, such as nonlinear dynamic systems, evolutionary adaptation, and technological advances, should keep small group research vigorous well into the future.

  1. Phase IIB Randomized Study of Topical Difluoromethylornithine and Topical Diclofenac on Sun-Damaged Skin of the Forearm.

    Science.gov (United States)

    Jeter, Joanne M; Curiel-Lewandrowski, Clara; Stratton, Steven P; Myrdal, Paul B; Warneke, James A; Einspahr, Janine G; Bartels, Hubert G; Yozwiak, Michael; Bermudez, Yira; Hu, Chengcheng; Bartels, Peter; Alberts, David S

    2016-02-01

    Prevention of nonmelanoma skin cancers remains a health priority due to high costs associated with this disease. Diclofenac and difluoromethylornithine (DFMO) have demonstrated chemopreventive efficacy for cutaneous squamous cell carcinomas. We designed a randomized study of the combination of DFMO and diclofenac in the treatment of sun-damaged skin. Individuals with visible cutaneous sun damage were eligible. Subjects were randomized to one of the three groups: topical DFMO applied twice daily, topical diclofenac applied daily, or DFMO plus diclofenac. The treatment was limited to an area on the left forearm, and the duration of use was 90 days. We hypothesized that combination therapy would have increased efficacy compared with single-agent therapy. The primary outcome was change in karyometric average nuclear abnormality (ANA) in the treated skin. Individuals assessing the biomarkers were blinded regarding the treatment for each subject. A total of 156 subjects were randomized; 144 had baseline and end-of-study biopsies, and 136 subjects completed the study. The ANA unexpectedly increased for all groups, with higher values correlating with clinical cutaneous inflammation. Nearly all of the adverse events were local cutaneous effects. One subject had cutaneous toxicity that required treatment discontinuation. Significantly more adverse events were seen in the groups taking diclofenac. Overall, the study indicated that the addition of topical DFMO to topical diclofenac did not enhance its activity. Both agents caused inflammation on a cellular and clinical level, which may have confounded the measurement of chemopreventive effects. More significant effects may be observed in subjects with greater baseline cutaneous damage.

  2. The first clinical experience on efficacy of topical flutamide on melasma compared with topical hydroquinone: a randomized clinical trial

    Directory of Open Access Journals (Sweden)

    Adalatkhah H

    2015-08-01

    Full Text Available Hassan Adalatkhah,1 Homayoun Sadeghi-Bazargani2,3 1Department of Dermatology, Ardabil University of Medical Sciences, Ardabil, Iran; 2Road Traffic Injury Research Center, Department of Statistics and Epidemiology, Tabriz University of Medical Sciences, Tabriz, Iran; 3Department of Public Health Sciences, Karolinska Institute, Stockholm, Sweden Background: Treatment of melasma is unsatisfactory most of the times. Hormonal role is shown to exist in pathogenesis of the melasma, and sex-hormone related drugs may have an effect on melasma.Aim: To investigate efficacy of 1% flutamide cream versus 4% hydroquinone cream on melasma.Methods: In a parallel randomized clinical trial, 74 women with melasma were allocated to receive a sunscreen along with 4% hydroquinone cream or 1% flutamide cream. Melasma Area and Severity Index (MASI, mexameter melanin assay, and patient satisfaction were investigated.Results: Mean age of the participants was 33.8 years. Mean length of time suffering from Melasma was 96.3 months. The subjects reported in average 1.1 hours per day of exposure to sunlight. Mean standardized total patient satisfaction score was 28.8 (standard deviation [SD] 17.2 in flutamide group patients versus 18 (SD 15.5 in control group (P<0.01. Regardless of treatment group, the skin darkness assessed upon MASI scales was reduced over the treatment course (P<0.001. Using mixed effects, longitudinal modeling showed better treatment efficacy based on MASI scale for flutamide group compared to the hydroquinone group (P<0.05. However, longitudinal analysis of mexameter scores did not reveal any significant difference in melanin measurements between flutamide and hydroquinone.Conclusion: Topical flutamide appeared as effective as topical hydroquinone in treating melasma using mexameter assessment but with a better MASI improvement trend and higher patient satisfaction in flutamide treatment versus topical hydroquinone. As the present study is possibly the

  3. Brian Barry: innovative contributions to transdermal and topical drug delivery.

    Science.gov (United States)

    Williams, A C

    2013-01-01

    Brian Barry published over 300 research articles across topics ranging from colloid science, vasoconstriction and the importance of thermodynamics in dermal drug delivery to exploring the structure and organisation of the stratum corneum barrier lipids and numerous strategies for improving topical and transdermal drug delivery, including penetration enhancers, supersaturation, coacervation, eutectic formation and the use of varied liposomes. As research in the area blossomed in the early 1980s, Brian wrote the book that became essential reading for both new and established dermal delivery scientists, explaining the background mathematics and principles through to formulation design. Brian also worked with numerous scientists, as collaborators and students, who have themselves taken his rigorous approach to scientific investigation into their own research groups. This paper can only describe a small fraction of the many significant contributions that Brian made to the field during his 40-year academic career.

  4. Influence of metabolism in skin on dosimetry after topical exposure

    Energy Technology Data Exchange (ETDEWEB)

    Bronaugh, R.L.; Collier, S.W.; Macpherson, S.E.; Kraeling, M.E.K. [Food and Drug Administration, Washington, DC (United States)

    1994-12-01

    Metabolism of chemicals occurs in skin and therefore should be taken into account when one determines topical exposure dose. Skin metabolism is difficult to measure in vivo because biological specimens may also contain metabolites from other tissues. Metabolism in skin during percutaneous absorption can be studied with viable skin in flow-through diffusion cells. Several compounds metabolized by microsomal enzymes in skin (benzo[a]pyrene and 7-ethoxycoumarin) penetrated human and hairless guinea pig skin predominantly unmetabolized. However, compounds containing a primary amino group (p-aminobenzoic acid, benzocaine, and azo color reduction products) were substrates for acetyltransferase activity in skin and were substantially metabolized during absorption. A physiologically based pharmacokinetic model has been developed with an input equation, allowing modeling after topical exposure. 14 refs., 3 figs., 4 tabs.

  5. Influence of metabolism in skin on dosimetry after topical exposure.

    Science.gov (United States)

    Bronaugh, R L; Collier, S W; Macpherson, S E; Kraeling, M E

    1994-12-01

    Metabolism of chemicals occurs in skin and therefore should be taken into account when one determines topical exposure dose. Skin metabolism is difficult to measure in vivo because biological specimens may also contain metabolites from other tissues. Metabolism in skin during percutaneous absorption can be studied with viable skin in flow-through diffusion cells. Several compounds metabolized by microsomal enzymes in skin (benzo[a]pyrene and 7-ethoxycoumarin) penetrated human and hairless guinea pig skin predominantly unmetabolized. However, compounds containing a primary amino group (p-aminobenzoic acid, benzocaine, and azo color reduction products) were substrates for acetyltransferase activity in skin and were substantially metabolized during absorption. A physiologically based pharmacokinetic model has been developed with an input equation, allowing modeling after topical exposure. Plasma concentrations in the hairless guinea pig were accurately predicted for the model compound, benzoic acid, from in vitro absorption, metabolism, and other pharmacokinetic parameters.

  6. A Topic Model Approach to Representing and Classifying Football Plays

    KAUST Repository

    Varadarajan, Jagannadan

    2013-09-09

    We address the problem of modeling and classifying American Football offense teams’ plays in video, a challenging example of group activity analysis. Automatic play classification will allow coaches to infer patterns and tendencies of opponents more ef- ficiently, resulting in better strategy planning in a game. We define a football play as a unique combination of player trajectories. To this end, we develop a framework that uses player trajectories as inputs to MedLDA, a supervised topic model. The joint maximiza- tion of both likelihood and inter-class margins of MedLDA in learning the topics allows us to learn semantically meaningful play type templates, as well as, classify different play types with 70% average accuracy. Furthermore, this method is extended to analyze individual player roles in classifying each play type. We validate our method on a large dataset comprising 271 play clips from real-world football games, which will be made publicly available for future comparisons.

  7. A Survey of Topic Modeling in Text Mining

    Directory of Open Access Journals (Sweden)

    Rubayyi Alghamdi

    2015-01-01

    Full Text Available Topic models provide a convenient way to analyze large of unclassified text. A topic contains a cluster of words that frequently occur together. A topic modeling can connect words with similar meanings and distinguish between uses of words with multiple meanings. This paper provides two categories that can be under the field of topic modeling. First one discusses the area of methods of topic modeling, which has four methods that can be considerable under this category. These methods are Latent semantic analysis (LSA, Probabilistic latent semantic analysis (PLSA, Latent Dirichlet allocation (LDA, and Correlated topic model (CTM. The second category is called topic evolution models, which model topics by considering an important factor time. In the second category, different models are discussed, such as topic over time (TOT, dynamic topic models (DTM, multiscale topic tomography, dynamic topic correlation detection, detecting topic evolution in scientific literature, etc.

  8. Topical tranexamic acid as a promising treatment for melasma

    Directory of Open Access Journals (Sweden)

    Bahareh Ebrahimi

    2014-01-01

    Full Text Available Background: In recent times, tranexamic acid (TA is claimed to have whitening effects especially for ultraviolet-induced hyperpigmentation including melasma. The aim of our study was to evaluate the efficacy and safety of topical solution of TA and compare it with combined solution of hydroquinone and dexamethasone as the gold standard treatment of melasma in Iranian women. Materials and Methods: This was a double-blind split-face trial of 12 weeks which was conducted in Isfahan, Iran. Fifty Iranian melasma patients applied topical solution of 3% TA on one side of the face, and topical solution of 3% hydroquinone + 0.01% dexamethasone on the other side two times a day. The Melasma Area and Severity Index (MASI and the side effects were evaluated at baseline and every 4 weeks before and after photographs to be compared by a dermatologist were taken. The patient satisfaction was documented at week 12. Results: A repeated measurement analysis was used to evaluate the changes in the MASI score before and after treatments. A significant decreasing trend was observed in the MASI score of both groups with no significant difference between them during the study (P < 0.05. No differences were seen in patients′ and investigator′s satisfaction of melasma improvement between two groups (P < 0.05. However, the side effects of hydroquinone + dexamethasone were significantly prominent compared with TA (P = 0.01. Conclusion: This study′s results introduce the topical TA as an effective and safe medication for the treatment of melasma.

  9. TOPIC SENTENCE”: GETTING THE IDEA ACROSS ABOUT GETTING IDEAS ACROSS

    Institute of Scientific and Technical Information of China (English)

    NiuRuiying

    2004-01-01

    This paper reports on an experimental study of the acquisition of topic sentence by Chinese learners of English. In the preliminary experiment, on the basis of formal instruction theory and noticing theory, we isolated two types of teaching practice: formal instruction and pushed output. Then we carried out different teaching practices on two groups of subjects respectively, taking the third group of subjects as the control group. However, contrary to our expectation, the results indicated that the acquisition of topic sentence does not have much to do with different teaching practices, but depends on learners'cof using topic sentence, as was corroborated in the following further experiment. In the further experiment, the subjects were required to write two compositions. For composition 1, the use of topic sentence was not required ; for composition 2, the use of topic sentence was clearly demanded. The results showed a considerable increase in topic sentences in composition 2, implying that the acquisition of topic sentence is closely related with learners' consciousness of use, and teachers' clear instruction can raise learners'consciousness.

  10. PREFACE: Asia-Pacific Interdisciplinary Research Conference 2011 (AP-IRC 2011)

    Science.gov (United States)

    Sandhu, Adarsh; Okada, Hiroshi; Maekawa, Toru; Okano, Ken

    2012-03-01

    ; a novel method for the synthesis of graphene using bacteria extracted from a riverside in Toyohashi by Toyohashi Tech scientists; and ambitious plans to harvest energy by laying massive numbers of solar cells in North Africa as part of the 'Sahara Solar Breeder (SSB) Plan' for a global clean-energy superhighway, described by Hideomi Koinuma. In addition to the technical sessions, the conference banquet included a short session during which the invited speakers described notable trends in research and policy in their part of the world. The short speeches led to animated discussions between the delegates, particularly the young scientists and graduate students, who were able to talk directly with veteran researchers for a first-hand view of the issues raised during the day's presentations. In closing the conference, Professor Makoto Ishida, co-chair of the conference and vice-president of Toyohashi Tech announced that this conference will be held annually at the same time each year, with AP-IRC 2012 scheduled for 15-16 November 2012 at the Irago Sea-Park & Spa Hotel in Aichi Prefecture, Japan. AP-IRC group The PDF also contains lists of the Committees involved.

  11. Genome-Wide Analysis of the AP2/ERF Gene Family in Physic Nut and Overexpression of the JcERF011 Gene in Rice Increased Its Sensitivity to Salinity Stress.

    Science.gov (United States)

    Tang, Yuehui; Qin, Shanshan; Guo, Yali; Chen, Yanbo; Wu, Pingzhi; Chen, Yaping; Li, Meiru; Jiang, Huawu; Wu, Guojiang

    2016-01-01

    The AP2/ERF transcription factors play crucial roles in plant growth, development and responses to biotic and abiotic stresses. A total of 119 AP2/ERF genes (JcAP2/ERFs) have been identified in the physic nut genome; they include 16 AP2, 4 RAV, 1 Soloist, and 98 ERF genes. Phylogenetic analysis indicated that physic nut AP2 genes could be divided into 3 subgroups, while ERF genes could be classed into 11 groups or 43 subgroups. The AP2/ERF genes are non-randomly distributed across the 11 linkage groups of the physic nut genome and retain many duplicates which arose from ancient duplication events. The expression patterns of several JcAP2/ERF duplicates in the physic nut showed differences among four tissues (root, stem, leaf, and seed), and 38 JcAP2/ERF genes responded to at least one abiotic stressor (drought, salinity, phosphate starvation, and nitrogen starvation) in leaves and/or roots according to analysis of digital gene expression tag data. The expression of JcERF011 was downregulated by salinity stress in physic nut roots. Overexpression of the JcERF011 gene in rice plants increased its sensitivity to salinity stress. The increased expression levels of several salt tolerance-related genes were impaired in the JcERF011-overexpressing plants under salinity stress.

  12. TopicLens: Efficient Multi-Level Visual Topic Exploration of Large-Scale Document Collections.

    Science.gov (United States)

    Kim, Minjeong; Kang, Kyeongpil; Park, Deokgun; Choo, Jaegul; Elmqvist, Niklas

    2017-01-01

    Topic modeling, which reveals underlying topics of a document corpus, has been actively adopted in visual analytics for large-scale document collections. However, due to its significant processing time and non-interactive nature, topic modeling has so far not been tightly integrated into a visual analytics workflow. Instead, most such systems are limited to utilizing a fixed, initial set of topics. Motivated by this gap in the literature, we propose a novel interaction technique called TopicLens that allows a user to dynamically explore data through a lens interface where topic modeling and the corresponding 2D embedding are efficiently computed on the fly. To support this interaction in real time while maintaining view consistency, we propose a novel efficient topic modeling method and a semi-supervised 2D embedding algorithm. Our work is based on improving state-of-the-art methods such as nonnegative matrix factorization and t-distributed stochastic neighbor embedding. Furthermore, we have built a web-based visual analytics system integrated with TopicLens. We use this system to measure the performance and the visualization quality of our proposed methods. We provide several scenarios showcasing the capability of TopicLens using real-world datasets.

  13. Analyses of Research Topics in the Field of Informetrics Based on the Method of Topic Modeling

    Directory of Open Access Journals (Sweden)

    Sung-Chien Lin

    2014-07-01

    Full Text Available In this study, we used the approach of topic modeling to uncover the possible structure of research topics in the field of Informetrics, to explore the distribution of the topics over years, and to compare the core journals. In order to infer the structure of the topics in the field, the data of the papers published in the Journal of Informetricsand Scientometrics during 2007 to 2013 are retrieved from the database of the Web of Science as input of the approach of topic modeling. The results of this study show that when the number of topics was set to 10, the topic model has the smallest perplexity. Although data scopes and analysis methodsare different to previous studies, the generating topics of this study are consistent with those results produced by analyses of experts. Empirical case studies and measurements of bibliometric indicators were concerned important in every year during the whole analytic period, and the field was increasing stability. Both the two core journals broadly paid more attention to all of the topics in the field of Informetrics. The Journal of Informetricsput particular emphasis on construction and applications ofbibliometric indicators and Scientometrics focused on the evaluation and the factors of productivity of countries, institutions, domains, and journals.

  14. Topical treatment options for conjunctival neoplasms

    Directory of Open Access Journals (Sweden)

    Jonathan W Kim

    2008-10-01

    Full Text Available Jonathan W Kim, David H AbramsonOphthalmic Oncology Service, Memorial Sloan-Kettering Cancer Center, New York, NY, USAAbstract: Topical therapies offer a nonsurgical method for treating conjunctival tumors by delivering high drug concentrations to the ocular surface. Over the past ten years, topical agents have been used by investigators to treat various premalignant and malignant lesions of the conjunctiva, such as primary acquired melanosis with atypia, conjunctival melanoma, squamous intraepithelial neoplasia and squamous cell carcinoma of the conjunctiva, and pagetoid spread of the conjunctiva arising from sebaceous cell carcinoma. Despite the enthusiasm generated by the success of these agents, there are unanswered questions regarding the clinical efficacy of this new nonsurgical approach, and whether a single topical agent can achieve cure rates comparable with traditional therapies. Furthermore, the long-term consequences of prolonged courses of topical chemotherapeutic drugs on the ocular surface are unknown, and the ideal regimen for each of these agents is still being refined. In this review, we present specific guidelines for treating both melanocytic and squamous neoplasms of the conjunctiva, utilizing the available data in the literature as well as our own clinical experience at the Memorial Sloan-Kettering Cancer Center.Keywords: topical therapies, conjunctival neoplasms melanosis, Mitomycin-C, 5-Fluorouracil

  15. Strategies of persuasion in offers to participate in cancer clinical trials I: Topic placement and topic framing.

    Science.gov (United States)

    Barton, Ellen; Eggly, Susan; Winckles, Andrew; Albrecht, Terrance L

    2014-01-01

    Clinical trials are the gold standard in medical research evaluating new treatments in cancer care; however, in the United States, too few patients enroll in trials, especially patients from minority groups. Offering patients the option of a clinical trial is an ethically-charged communicative event for oncologists. One particularly vexed ethical issue is the use of persuasion in trial offers. Based on a corpus of 22 oncology encounters with Caucasian-American (n = 11) and African-American (n = 11) patients, this discourse analysis describes oncologists' use of two persuasive strategies related to the linguistic structure of trial offers: topic placement and topic framing. Findings are presented in total and by patient race, and discussed in terms of whether these strategies may constitute ethical or unethical persuasion, particularly with respect to the ethical issue of undue influence and the social issue of underrepresentation of minorities in cancer clinical trials.

  16. Involvement of AP-1 in p38MAPK signaling pathway in osteoblast apoptosis induced by high glucose.

    Science.gov (United States)

    Feng, Z P; Deng, H C; Jiang, R; Du, J; Cheng, D Y

    2015-04-10

    We investigated the effect of p38MAPK/AP-1 (activator protein-1) signaling on the apoptosis of osteoblasts induced by high glucose. A lentivirus vector of small hairpin RNA (shRNA) targeting p38MAPK was constructed in vitro. Osteoblasts MC3T3-E1 cultured in vitro were treated with vehicle, high glucose, p38MAPK-shRNA transfection, p38MAPK inhibitor, and unrelated shRNA transfection. Apoptosis, protein levels of p38MAPK, and activities of AP-1 in MC3T3-E1 osteoblasts were measured using TUNEL and flow cytometry, Western blot analysis, and an electrophoretic mobility shift assay. Compared with the vehicle group, high glucose induced apoptosis of MC3T3-E1 osteoblasts and activated p38MAPK and AP-1. p38MAPK-shRNA transfection blocked the effect of high glucose stimulation, and the p38MAPK inhibitor showed similar effects as those observed in p38MAPK transfection. Unrelated shRNA had no effect on these changes in MC3T3-E1 osteoblasts induced by high glucose. Therefore, our results suggest that p38MAPK-shRNA reduce apoptosis of MC3T3-E1 osteoblasts induced by high glucose by inhibiting the p38MAPK-AP-1 signaling pathway.

  17. Mammalian Base Excision Repair: Functional Partnership between PARP-1 and APE1 in AP-Site Repair.

    Directory of Open Access Journals (Sweden)

    Rajendra Prasad

    Full Text Available The apurinic/apyrimidinic- (AP- site in genomic DNA arises through spontaneous base loss and base removal by DNA glycosylases and is considered an abundant DNA lesion in mammalian cells. The base excision repair (BER pathway repairs the AP-site lesion by excising and replacing the site with a normal nucleotide via template directed gap-filling DNA synthesis. The BER pathway is mediated by a specialized group of proteins, some of which can be found in multiprotein complexes in cultured mouse fibroblasts. Using a DNA polymerase (pol β immunoaffinity-capture technique to isolate such a complex, we identified five tightly associated and abundant BER factors in the complex: PARP-1, XRCC1, DNA ligase III, PNKP, and Tdp1. AP endonuclease 1 (APE1, however, was not present. Nevertheless, the complex was capable of BER activity, since repair was initiated by PARP-1's AP lyase strand incision activity. Addition of purified APE1 increased the BER activity of the pol β complex. Surprisingly, the pol β complex stimulated the strand incision activity of APE1. Our results suggested that PARP-1 was responsible for this effect, whereas other proteins in the complex had no effect on APE1 strand incision activity. Studies of purified PARP-1 and APE1 revealed that PARP-1 was able to stimulate APE1 strand incision activity. These results illustrate roles of PARP-1 in BER including a functional partnership with APE1.

  18. Diffusion and Settling in Ap/Bp Stars

    Energy Technology Data Exchange (ETDEWEB)

    Turcotte, S

    2003-04-09

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  19. On the progenitor of the Type Ic supernova 2002ap

    NARCIS (Netherlands)

    Smartt, SJ; Ramirez-Ruiz, E; Gilmore, GF; Meikle, WPS; Ferguson, AMN; Knapen, JH

    2002-01-01

    This Letter presents wide-field optical and near-IR (UBVRIHalphaK') images of the galaxy M74 that were taken between 0.6 and 8.3 yr before the discovery of the Type Ic supernova 2002ap. We have located the position of the supernova on these images with an accuracy of 0."3. We find no sign of a proge

  20. A Low-Power CoAP for Contiki

    OpenAIRE

    Kovatsch M.; Duquennoy S.; Dunkels A.

    2011-01-01

    Internet of Things devices will by and large be battery-operated, but existing application protocols have typically not been designed with power-efficiency in mind. In low-power wireless systems, power-efficiency is determined by the ability to maintain a low radio duty cycle: keeping the radio off as much as possible. We present an implementation of the IETF Constrained Application Protocol (CoAP) for the Contiki operating system that leverages the ContikiMAC low-powe...

  1. Characteristics of shigellosis outbreaks in the AP of Vojvodina

    OpenAIRE

    2009-01-01

    Introduction. Shigellosis causes around 165 million infections and around 1 million deaths in the world every year. Two thirds of both infections and deaths are among children younger than 10. Shigellosis mainly spreads by direct or indirect contact, but water- and food-borne outbreaks are not rare. Material and methods. A descriptive epidemiological method was used to analyse characteristics of shigellosis outbreaks in the AP of Vojvodina in the period 1979-2005. Results. During this period ...

  2. Diffusion and Settling in Ap/Bp Stars

    CERN Document Server

    Turcotte, S

    2003-01-01

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  3. Essay: Computers in the APS Editorial Office: The Early Years

    Science.gov (United States)

    Adams, Peter

    2009-03-01

    APS journals in the late 1960s began to move from hot-metal print shops to tailor-made typewriters, next to special keyboards and a small computer, then to completely photocomposed journal pages. At the same time, internal editorial operations were being converted from paper handling and data records to completely electronic procedures. By 1990, it became feasible for authors to submit manuscripts to the journal electronically.

  4. Heterologous expression of ApGSMT2 and ApDMT2 genes from Aphanothece halophytica enhanced drought tolerance in transgenic tobacco.

    Science.gov (United States)

    He, Ying; He, Chunmei; Li, Lihua; Liu, Zhili; Yang, Aifang; Zhang, Juren

    2011-01-01

    The glycine-methylation biosynthetic pathway of glycinebetaine (GB) has been investigated, but only a few studies on GB accumulation in transgenic higher plants have utilized this pathway. In this study, two methyltransferase genes named ApGSMT2 and ApDMT2, encoding proteins catalyzing GB biosynthesis from glycine, were cloned from a relative strain of Aphanothece halophytica. The potential roles of ApGSMT2 and ApDMT2 in GB synthesis were first examined in transgenic Escherichia coli, which had increased levels of GB and improved salt tolerance. Then ApGSMT2 and ApDMT2 were transferred into tobacco. Compared with transgenic tobacco expressing betA, transgenic tobacco co-expressing ApGSMT2 and ApDMT2 accumulated more GB and exhibited enhanced drought resistance with better germination performance, higher relative water content, less cell membrane damage and better photosynthetic capacity under drought stress. We concluded that the ApGSMT2 and ApDMT2 genes cloned in this study will be very useful for engineering GB-accumulating transgenic plants with enhanced drought resistance.

  5. Risk assessment of topically applied products

    DEFF Research Database (Denmark)

    Søborg, Tue; Basse, Line Hollesen; Halling-Sørensen, Bent

    2007-01-01

    The human risk of harmful substances in semisolid topical dosage forms applied topically to normal skin and broken skin, respectively, was assessed. Bisphenol A diglycidyl ether (BADGE) and three derivatives of BADGE previously quantified in aqueous cream and the UV filters 3-BC and 4-MBC were used...... as model compounds. Tolerable daily intake (TDI) values have been established for BADGE and derivatives. Endocrine disruption was chosen as endpoint for 3-BC and 4-MBC. Skin permeation of the model compounds was investigated in vitro using pig skin membranes. Tape stripping was applied to simulate broken...... parameters for estimating the risk. The immediate human risk of BADGE and derivatives in topical dosage forms was found to be low. However, local treatment of broken skin may lead to higher exposure of BADGE and derivatives compared to application to normal skin. 3-BC permeated skin at higher flux than 4-MBC...

  6. Getting Started with Topic Modeling and MALLET

    Directory of Open Access Journals (Sweden)

    Shawn Graham

    2012-09-01

    Full Text Available In this lesson you will first learn what topic modeling is and why you might want to employ it in your research. You will then learn how to install and work with the MALLET natural language processing toolkit to do so. MALLET involves modifying an environment variable (essentially, setting up a short-cut so that your computer always knows where to find the MALLET program and working with the command line (ie, by typing in commands manually, rather than clicking on icons or menus. We will run the topic modeller on some example files, and look at the kinds of outputs that MALLET installed. This will give us a good idea of how it can be used on a corpus of texts to identify topics found in the documents without reading them individually.

  7. Lecture Notes on Topics in Accelerator Physics

    CERN Document Server

    Chao, A W

    2002-01-01

    These are lecture notes that cover a selection of topics, some of them under current research, in accelerator physics. I try to derive the results from first principles, although the students are assumed to have an introductory knowledge of the basics. The topics covered are: (1) Panofsky-Wenzel and Planar Wake Theorems; (2) Echo Effect; (3) Crystalline Beam; (4) Fast Ion Instability; (5) Lawson-Woodward Theorem and Laser Acceleration in Free Space; (6) Spin Dynamics and Siberian Snakes; (7) Symplectic Approximation of Maps; (8) Truncated Power Series Algebra; and (9) Lie Algebra Technique for nonlinear Dynamics. The purpose of these lectures is not to elaborate, but to prepare the students so that they can do their own research. Each topic can be read independently of the others.

  8. Loss-of-Function Mutations in YY1AP1 Lead to Grange Syndrome and a Fibromuscular Dysplasia-Like Vascular Disease.

    Science.gov (United States)

    Guo, Dong-Chuan; Duan, Xue-Yan; Regalado, Ellen S; Mellor-Crummey, Lauren; Kwartler, Callie S; Kim, Dong; Lieberman, Kenneth; de Vries, Bert B A; Pfundt, Rolph; Schinzel, Albert; Kotzot, Dieter; Shen, Xuetong; Yang, Min-Lee; Bamshad, Michael J; Nickerson, Deborah A; Gornik, Heather L; Ganesh, Santhi K; Braverman, Alan C; Grange, Dorothy K; Milewicz, Dianna M

    2017-01-05

    Fibromuscular dysplasia (FMD) is a heterogeneous group of non-atherosclerotic and non-inflammatory arterial diseases that primarily involves the renal and cerebrovascular arteries. Grange syndrome is an autosomal-recessive condition characterized by severe and early-onset vascular disease similar to FMD and variable penetrance of brachydactyly, syndactyly, bone fragility, and learning disabilities. Exome-sequencing analysis of DNA from three affected siblings with Grange syndrome identified compound heterozygous nonsense variants in YY1AP1, and homozygous nonsense or frameshift YY1AP1 variants were subsequently identified in additional unrelated probands with Grange syndrome. YY1AP1 encodes yin yang 1 (YY1)-associated protein 1 and is an activator of the YY1 transcription factor. We determined that YY1AP1 localizes to the nucleus and is a component of the INO80 chromatin remodeling complex, which is responsible for transcriptional regulation, DNA repair, and replication. Molecular studies revealed that loss of YY1AP1 in vascular smooth muscle cells leads to cell cycle arrest with decreased proliferation and increased levels of the cell cycle regulator p21/WAF/CDKN1A and disrupts TGF-β-driven differentiation of smooth muscle cells. Identification of YY1AP1 mutations as a cause of FMD indicates that this condition can result from underlying genetic variants that significantly alter the phenotype of vascular smooth muscle cells.

  9. Long-term stability of the APS storage ring

    Energy Technology Data Exchange (ETDEWEB)

    Friedsam, H.; Penicka, M.; Error, J.

    1999-10-26

    The Advanced Photon Source (APS), a third-generation synchrotrons light source, was commissioned in 1995 at Argonne ''National Laboratory and has been fully-operational for beamline users since 1997. The APS storage ring can accommodate up to 68 user beamlines; about 70% of the available beamlines are currently in use by various collaborative access teams (CATS). The 7-GeV synchrotrons light source produces light in the soft to hard x-ray range that is used for research in such areas as x-ray instrumentation; material, chemical and atomic sciences; biology; and geo/soil/ environmental sciences. For the successful operation of an x-ray light source such as the Advanced Photon Source, the long-term stability of the concrete floor supporting the beam components and user beamlines is crucial. Settlements impact the orbit and location of the x-ray source points as well as the position of the x-ray beamlines. This paper compares the results of two successive resurveys of the APS accelerator components performed in 1995 and 1998.

  10. Topical and peripheral ketamine as an analgesic.

    Science.gov (United States)

    Sawynok, Jana

    2014-07-01

    Ketamine, in subanesthetic doses, produces systemic analgesia in chronic pain settings, an action largely attributed to block of N-methyl-D-aspartate receptors in the spinal cord and inhibition of central sensitization processes. N-methyl-D-aspartate receptors also are located peripherally on sensory afferent nerve endings, and this provided the initial impetus for exploring peripheral applications of ketamine. Ketamine also produces several other pharmacological actions (block of ion channels and receptors, modulation of transporters, anti-inflammatory effects), and while these may require higher concentrations, after topical (e.g., as gels, creams) and peripheral application (e.g., localized injections), local tissue concentrations are higher than those after systemic administration and can engage lower affinity mechanisms. Peripheral administration of ketamine by localized injection produced some alterations in sensory thresholds in experimental trials in volunteers and in complex regional pain syndrome subjects in experimental settings, but many variables were unaltered. There are several case reports of analgesia after topical application of ketamine given alone in neuropathic pain, but controlled trials have not confirmed such effects. A combination of topical ketamine with several other agents produced pain relief in case, and case series, reports with response rates of 40% to 75% in retrospective analyses. In controlled trials of neuropathic pain with topical ketamine combinations, there were improvements in some outcomes, but optimal dosing and drug combinations were not clear. Given orally (as a gargle, throat swab, localized peritonsillar injections), ketamine produced significant oral/throat analgesia in controlled trials in postoperative settings. Topical analgesics are likely more effective in particular conditions (patient factors, disease factors), and future trials of topical ketamine should include a consideration of factors that could predispose

  11. Is there a therapeutic window for pentoxifylline after the onset of acute pancreatitis? Existe uma janela terapêutica para a pentoxifilina após o início da pancreatite aguda?

    Directory of Open Access Journals (Sweden)

    Ana Maria Mendonça Coelho

    2012-07-01

    Full Text Available PURPOSE: To investigate the effects of pentoxifylline (PTX in experimental acute pancreatitis (AP starting drug administration after the induction of the disease. METHODS: One hundred male Wistar rats were submitted to taurocholate-induced AP and divided into three groups: Group Sham: sham-operated rats, Group Saline: AP plus saline solution, and Group PTX: AP plus PTX. Saline solution and PTX were administered 1 hour after induction of AP. At 3 hours after AP induction, peritoneal levels of tumor necrosis factor (TNF-α, and serum levels of interleukin (IL-6 and IL-10 levels were assayed by Enzyme-Linked Immunosorbent Assay (ELISA. Determinations of lung myeloperoxidase activity (MPO, histological analysis of lung and pancreas, and mortality study were performed. RESULTS: PTX administration 1 hour after induction of AP caused a significant decrease in peritoneal levels of TNF-α and in serum levels of IL-6 and IL-10 when compared to the saline group. There were no differences in lung MPO activity between the two groups with AP. A decrease in mortality was observed in the PTX treatment compared to the saline group. CONCLUSIONS: Administration of PTX after the onset of AP decreased the systemic levels of proinflammatory cytokines, raising the possibility that there is an early therapeutic window for PTX after the initiation of AP.OBJETIVO: Investigar os efeitos da pentoxifilina (PTX na pancreatite aguda (PA experimental administrando a droga após a indução da doença. MÉTODOS: Cem ratos machos Wistar foram submetidos à indução da PA através da infusão de taurocolato de sódio e divididos em três grupos: Grupo Sham: sham-operated ratos, Grupo Salina: AP e solução salina, e Grupo PTX: AP e PTX. Solução salina e PTX foram administradas 1 hora após a indução da PA. Três horas após indução da PA os níveis de fator de necrose tumoral (TNF-α no líquido peritoneal e os níveis séricos de interleucina (IL-6 e IL-10 foram

  12. Genome-Wide Analysis of the AP2/ERF Transcription Factors Family and the Expression Patterns of DREB Genes in Moso Bamboo (Phyllostachys edulis).

    Science.gov (United States)

    Wu, Huili; Lv, Hao; Li, Long; Liu, Jun; Mu, Shaohua; Li, Xueping; Gao, Jian

    2015-01-01

    The AP2/ERF transcription factor family, one of the largest families unique to plants, performs a significant role in terms of regulation of growth and development, and responses to biotic and abiotic stresses. Moso bamboo (Phyllostachys edulis) is a fast-growing non-timber forest species with the highest ecological, economic and social values of all bamboos in Asia. The draft genome of moso bamboo and the available genomes of other plants provide great opportunities to research global information on the AP2/ERF family in moso bamboo. In total, 116 AP2/ERF transcription factors were identified in moso bamboo. The phylogeny analyses indicated that the 116 AP2/ERF genes could be divided into three subfamilies: AP2, RAV and ERF; and the ERF subfamily genes were divided into 11 groups. The gene structures, exons/introns and conserved motifs of the PeAP2/ERF genes were analyzed. Analysis of the evolutionary patterns and divergence showed the PeAP2/ERF genes underwent a large-scale event around 15 million years ago (MYA) and the division time of AP2/ERF family genes between rice and moso bamboo was 15-23 MYA. We surveyed the putative promoter regions of the PeDREBs and showed that largely stress-related cis-elements existed in these genes. Further analysis of expression patterns of PeDREBs revealed that the most were strongly induced by drought, low-temperature and/or high salinity stresses in roots and, in contrast, most PeDREB genes had negative functions in leaves under the same respective stresses. In this study there were two main interesting points: there were fewer members of the PeDREB subfamily in moso bamboo than in other plants and there were differences in DREB gene expression profiles between leaves and roots triggered in response to abiotic stress. The information produced from this study may be valuable in overcoming challenges in cultivating moso bamboo.

  13. Topics in current aerosol research (part2)

    CERN Document Server

    Hidy, G M

    1972-01-01

    Topics in Current Aerosol Research, Part 2 contains some selected articles in the field of aerosol study. The chosen topics deal extensively with the theory of diffusiophoresis and thermophoresis. Also covered in the book is the mathematical treatment of integrodifferential equations originating from the theory of aerosol coagulation. The book is the third volume of the series entitled International Reviews in Aerosol Physics and Chemistry. The text offers significant understanding of the methods employed to develop a theory for thermophoretic and diffusiophoretic forces acting on spheres in t

  14. Illustrative EDOF topics in Fourier optics

    Science.gov (United States)

    George, Nicholas; Chen, Xi; Chi, Wanli

    2011-10-01

    In this talk we present a series of illustrative topics in Fourier Optics that are proving valuable in the design of EDOF camera systems. They are at the level of final examination problems that have been made solvable by a student or professoi having studied from one of Joseph W. Goodman's books---our tribute for his 75fr year. As time permits, four illustrative topics are l) Electromagnetic waves and Fourier optics;2) The perfect lens; 3) Connection between phase delay and radially varying focal length in an asphere and 4) tailored EDOF designs.

  15. Topical therapy in atopic dermatitis in children

    Directory of Open Access Journals (Sweden)

    Dharshini Sathishkumar

    2016-01-01

    Full Text Available Atopic dermatitis (AD is a common, chronic childhood skin disorder caused by complex genetic, immunological, and environmental interactions. It significantly impairs quality of life for both child and family. Treatment is complex and must be tailored to the individual taking into account personal, social, and emotional factors, as well as disease severity. This review covers the management of AD in children with topical treatments, focusing on: education and empowerment of patients and caregivers, avoidance of trigger factors, repair and maintenance of the skin barrier by correct use of emollients, control of inflammation with topical corticosteroids and calcineurin inhibitors, minimizing infection, and the use of bandages and body suits.

  16. Topic Time Series Analysis of Microblogs

    Science.gov (United States)

    2014-10-01

    does not display a currently valid OMB control number. 1. REPORT DATE OCT 2014 2. REPORT TYPE 3. DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE...Tweets in topic k triggered by a Tweet in topic k, also known as the branching factor. ωk is a parameter controlling the rate of decay, i.e. how...2011. [20] Yosihiko Ogata . Statistical models for earthquake occurrences and residual analysis for point pro- cesses. Journal of the American

  17. Safety of topical vancomycin powder in neurosurgery

    Directory of Open Access Journals (Sweden)

    Kalil G Abdullah

    2016-01-01

    Full Text Available Surgical site infections (SSIs remain an important cause of morbidity following neurosurgical procedures despite the best medical practices. In addition, hospital infection rates are proposed as a metric for ranking hospitals safety profiles to guide medical consumerism. Recently, the use of topical vancomycin, defined as the application of vancomycin powder directly into the surgical wound, has been described in both cranial and spinal surgeries as a method to reduce SSIs. Early results are promising. Here, we provide a concise primer on the pharmacology, bacterial spectrum, history, and clinical indications of topical vancomycin for the practicing surgeon.

  18. Applied atomic and collision physics special topics

    CERN Document Server

    Massey, H S W; Bederson, Benjamin

    1982-01-01

    Applied Atomic Collision Physics, Volume 5: Special Topics deals with topics on applications of atomic collisions that were not covered in the first four volumes of the treatise. The book opens with a chapter on ultrasensitive chemical detectors. This is followed by separate chapters on lighting, magnetohydrodynamic electrical power generation, gas breakdown and high voltage insulating gases, thermionic energy converters, and charged particle detectors. Subsequent chapters deal with the operation of multiwire drift and proportional chambers and streamer chambers and their use in high energy p

  19. Heart block following topical latanoprost treatment

    Science.gov (United States)

    De Smit, Elisabeth; Theodorou, Maria; Hildebrand, Göran Darius; Bloom, Philip

    2011-01-01

    The authors report a case of second degree heart block associated with topical latanoprost treatment. The authors discuss the possibility of a causative effect as the cessation of this treatment resulted in improvement of the arrhythmia. The authors highlight previous reports and research in humans and animals which demonstrate an association of arrhythmias with prostaglandin analogues. This report draws attention to the possibility that an extremely commonly prescribed topical drug may trigger arrhythmias in susceptible individuals. It is important that prescribers are aware of this possible side-effect. PMID:22679164

  20. Treatment of phimosis with topical steroids and foreskin anatomy

    Directory of Open Access Journals (Sweden)

    Tatiana C. Marques

    2005-08-01

    Full Text Available OBJECTIVES: To correlate topical steroidal treatment of stenosed foreskin with the different degrees of glans exposure and the length of time the ointment is applied. MATERIALS AND METHODS: We studied 95 patients with phimosis, divided according to the degree of foreskin retraction. Group A presented no foreskin retraction, group B presented exposure of only the urethral meatus, group C presented exposure of half of the glans, and group D presented exposure of the glans, which was incomplete because of preputial adherences to the coronal sulcus. Patients were submitted to application of 0.05% betamethasone ointment on the distal aspect of the prepuce twice daily for a minimum of 30 days and a maximum of 4 months. RESULTS: Of 95 patients, 10 (10.52% abandoned the treatment and 15 patients in groups C and D were excluded from the study. Among the remaining 70 patients, only 4 patients (5.7% in group A did not obtain adequate glans exposure after treatment. In group A (38 patients, fully retractable foreskins were obtained in 19 patients (50% after 1 month of treatment. In group B (28 patients, fully retractable foreskins were obtained in 18 patients (64.2% after 1 month. CONCLUSIONS: Treatment was successful in 94.2% of patients, irrespective of the type of foreskin anatomy. The improvement may require several months of treatment. Patients with impossibility of urethral meatus exposure present around 10% treatment failure.

  1. Upgraded Coal Interest Group

    Energy Technology Data Exchange (ETDEWEB)

    Evan Hughes

    2009-01-08

    The Upgraded Coal Interest Group (UCIG) is an EPRI 'users group' that focuses on clean, low-cost options for coal-based power generation. The UCIG covers topics that involve (1) pre-combustion processes, (2) co-firing systems and fuels, and (3) reburn using coal-derived or biomass-derived fuels. The UCIG mission is to preserve and expand the economic use of coal for energy. By reducing the fuel costs and environmental impacts of coal-fired power generation, existing units become more cost effective and thus new units utilizing advanced combustion technologies are more likely to be coal-fired.

  2. 75 FR 26647 - Ophthalmic and Topical Dosage Form New Animal Drugs; Ivermectin Topical Solution

    Science.gov (United States)

    2010-05-12

    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 524 Ophthalmic and Topical Dosage Form New Animal Drugs; Ivermectin Topical Solution AGENCY: Food and Drug Administration, HHS. ACTION: Final rule, technical amendment. SUMMARY: The Food and Drug Administration (FDA) is amending the animal drug...

  3. 76 FR 81806 - Ophthalmic and Topical Dosage Form New Animal Drugs; Ivermectin Topical Solution

    Science.gov (United States)

    2011-12-29

    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 524 Ophthalmic and Topical Dosage Form New Animal Drugs; Ivermectin Topical Solution AGENCY: Food and Drug Administration, HHS. ACTION: Final rule. SUMMARY: The Food and Drug Administration (FDA) is amending the animal drug regulations to...

  4. The Adolescent Novel in AP English: A Response to Patricia Spencer.

    Science.gov (United States)

    McGee, Tim

    1992-01-01

    Discusses the absence of adolescent literature in Advanced Placement (AP) English classes. Describes how a class of AP students and their teacher benefited from reading Robert Cormier's "The Chocolate War." (PRA)

  5. Recombinant thermostable AP exonuclease from Thermoanaerobacter tengcongensis: cloning, expression, purification, properties and PCR application

    DEFF Research Database (Denmark)

    Dabrowski, Slawomir; Brillowska-Dabrowska, Anna; Ahring, Birgitte Kiær

    2013-01-01

    Apurinic/apyrimidinic (AP) sites in DNA are considered to be highly mutagenic and must be corrected to preserve genetic integrity, especially at high temperatures. The gene encoding a homologue of AP exonuclease was cloned from the thermophilic anaerobic bacterium Thermoanaerobacter tengcongensis...... (14000 kU) of pure His6-tagged Tte AP (153 kU/mg) from 1 liter of culture. The optimal conditions of Tte AP endo-, exonuclease and 3'-nuclease activity were investigated using fluorescein labeled dsDNA with inserted AP sites and ssDNA. Optimal Tte AP endonuclease activity was observed at 70-75 degrees C...... DNA templates. Tte AP exonuclease eliminated AP-sites in DNA template and improved the efficiency of DNA amplification....

  6. Advanced topics in the arithmetic of elliptic curves

    CERN Document Server

    Silverman, Joseph H

    1994-01-01

    In the introduction to the first volume of The Arithmetic of Elliptic Curves (Springer-Verlag, 1986), I observed that "the theory of elliptic curves is rich, varied, and amazingly vast," and as a consequence, "many important topics had to be omitted." I included a brief introduction to ten additional topics as an appendix to the first volume, with the tacit understanding that eventually there might be a second volume containing the details. You are now holding that second volume. it turned out that even those ten topics would not fit Unfortunately, into a single book, so I was forced to make some choices. The following material is covered in this book: I. Elliptic and modular functions for the full modular group. II. Elliptic curves with complex multiplication. III. Elliptic surfaces and specialization theorems. IV. Neron models, Kodaira-Neron classification of special fibers, Tate's algorithm, and Ogg's conductor-discriminant formula. V. Tate's theory of q-curves over p-adic fields. VI. Neron's theory of can...

  7. Topical Treatment of Dermatophytic Lesion on Mice (Mus musculus) Model.

    Science.gov (United States)

    Sharma, Bindu; Kumar, Padma; Joshi, Suresh Chandra

    2011-06-01

    Antidermatophytic potential of three weed plants viz. Tridax procumbens L., Capparis decidua (forsk) Edgew and Lantana camara L. were explored and experimentally induced dermatophytic lesion was topically treated in mice. Microbroth dilution method was carried out for determination of MIC and MFC of different extracts of selected plants. In animal studies, mice were experimentally inoculated with Trichophyton mentagrophytes and infected animals were topically treated with 5 mg/g terbinafine and two concentrations, i.e., 5 and 10 mg/g of test extract ointment. Complete recovery from the infection was observed on 12th day of treatment for reference drug terbinafine (5 mg/g) and 10 mg/g concentration of test extract ointment whereas 5 mg/g concentration of test extract ointment showed complete cure on 16th day of treatment. Fungal burden was also calculated by culturing skin scrapings from infected animals of different groups. Test extract ointment successfully treated induced dermatophytosis in mice without any disease recurrence incidences, thereby indicating efficacy of test extract as an excellent topical antifungal agent for the cure of dermatophytosis.

  8. Interrelationships between ALOX5AP polymorphisms, serum leukotriene B4 level and risk of acute coronary syndrome.

    Directory of Open Access Journals (Sweden)

    Guoping He

    Full Text Available BACKGROUND: We investigated the relationships between the ALOX5AP gene rs10507391 and rs4769874 polymorphisms, serum levels of leukotriene (LT B4, and risk of acute coronary syndrome (ACS. METHODS: A total of 709 participants, comprising 508 ACS patients (ACS group and 201 noncoronary artery disease patients with chest pain (control group were recruited from the Han population of the Changwu region in China. Two polymorphic loci were genotyped using polymerase chain reaction and restriction fragment length polymorphism analysis. Serum LTB4 level was determined by enzyme-linked immunosorbent assay. RESULTS: Serum LTB4 levels were significantly higher (P<0.001 in the ACS group (median/interquartile range, 470.27/316.32 pg/ml than in the control group (233.05/226.82 pg/ml. No statistical differences were observed between genotype, allele and haplotype frequencies for the tested loci in either the ACS group or the control group, even after adjustments were made for conventional risk factors by multivariate logistic regression. This suggests there is no association between the ALOX5AP rs10507391 and rs4769874 polymorphisms and ACS risk. Elevated serum LTB4 level was closely linked to ACS risk, and may be independent of traditional risk factors as a risk factor for ACS (P<0.001. There was no significant association between serum LTB4 levels and the two variants in either the ACS group or the control group. CONCLUSIONS: Rs10507391, rs4769874 and its haplotypes in ALOX5AP are unrelated to ACS risk in the Chinese Han population of Changwu, but elevated serum LTB4 level is strongly associated with ACS risk. Serum LTB4 level is not subject to the influence of either the rs10507391, rs4769874 or the haplotype.

  9. Effect of topical application of terbinafine on fungal keratitis

    Institute of Scientific and Technical Information of China (English)

    LIANG Qing-feng; JIN Xiu-ying; WANG Xiang-lan; SUN Xu-guang

    2009-01-01

    Background Fungal keratitis is a rare but serious corneal disease that may result in loss of vision.The poor prognosis might be due to limited treatment option.This study aimed to evaluate the clinical efficacy of 0.25% terbinafine eye drops comparing with 5% natamycin suspension on fungal keratitis.Methods A retrospective clinical trial was performed on 90 patients presenting with direct smear and/or culture positive fungal keratitis at Beijing Tongren Hospital,Beijing,China from January 2006 to May 2008.Corneal ulcers were categorized as mild or severe.Forty-five patients were treated with topical terbinafine and the next 45 cases received topical natamycin hourly.Results Filamentous fungi were found in corneal scrapings among all 90 cases.Fungal cultures were positive in 64 patients (71%).Species of Fusarium and Aspergillus were the principal isolates.Forty (89%) patients showed favorable response to terbinafine,while forty-two (93%) patients exhibited favorable response to natamycin (P >0.05).The mean course of treatment was significantly showed in the terbinafine treatment group than natamycin group ((26.5±11.2) days versus (19.3±6.4) days;P <0.05).In terbinafine group,twenty patients with ulcers smaller than 4 mm had favorable outcome,while 20 of 25 patients with ulcers more than 4 mm in diameter had favorable response (P <0.05).Twenty-seven patients with depth of infiltration less than half of stroma thickness had favorable response to terbinafine,while 13 of 18 patients with depth of infiltration more than half of stroma responded to terbinafine.This difference was statistically significant (P<0.05).Conclusions Our findings suggest that topical terbinafine is an effective antifungal drug for the management of filamentous mycotic keratitis,particularly in cases with smaller and shallower ulcers.Its mean duration of treatment was longer than natamycin.

  10. Paquimetria esperada X obtida após LASIK para miopia Achieved X expected pachymetry after LASIK for myopia

    Directory of Open Access Journals (Sweden)

    Juliane de Freitas Santos Paranhos

    2001-06-01

    Full Text Available Objetivo: Comparar a paquimetria corneana encontrada (PEn com a esperada (PEs 3 meses após a cirurgia de LASIK para correção de miopia. Métodos: 77 olhos de 39 pacientes míopes foram incluídos neste estudo. A cirurgia foi realizada utilizando-se o excimer laser Technolas 217 e o microcerátomo automático da Chiron. Paquimetria foi realizada em todos os olhos antes e 3 meses após o LASIK. PEs foi obtida subtraindo-se a profundidade de ablação realizada pelo laser, da paquimetria pré-operatória. Os pacientes foram divididos em 3 grupos: grupo A (55 olhos com miopia variando de -1,00D a -5,75D; grupo B (14 olhos, de -6,00D a -10,00D e grupo C (8 olhos acima de -10,00D. Resultados: Houve uma diminuição da média do equivalente esférico de -2,71D para 0,00 no grupo A, -8,18D para 0,00 no grupo B e de -11,4D para -1,06D no grupo C. As médias das PEs foram 468 mim, 370 mim e 382 mim para os grupos A,B e C, respectivamente. As médias das PEn foram de 491 mim, 431 mim e 427 mim nos grupos A, B e C, respectivamente. Em 70 olhos (90,9 % a PEn foi superior a PEs, sendo esta diferença estatisticamente significativa (p=0,001. Conclusão: Apesar dos resultados mostrarem que a córnea encontrava-se mais espessa do que o esperado após a cirurgia de LASIK, não foi observada hipocorreção significativa. Após 3 meses a refração da maioria dos pacientes estava próxima da emetropia.Purpose: To compare the achieved corneal pachymetry (AP with the expected one (EP after 3 months of LASIK for myopia. Methods: 77 myopic eyes of 39 patients were included in this study. Surgery was performed with the Technolas 217 excimer laser and the Chiron automated corneal shaper microkeratome. Screening pachymetry was performed in all corneas before and 3 months after LASIK. EP was obtained by subtracting the ablation depth from the preoperative pachymetry. Patients were divided into 3 groups as follows: Group A (55 eyes, from -1.00 diopter (D to -5.75D; group

  11. NRC confirmatory AP600 safety system phase I testing in the ROSA/AP600 test facility

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, G.S.; Kukita, Yutaka; Schultz, R.R.

    1996-03-01

    The NRC confirmatory phase I testing for the AP600 safety systems has been completed in the modified ROSA (Rig of Safety Assessment) test facility located at the Japan Atomic Energy Research Institute (JAERI) campus in Tokai, Japan. The test matrix included a variety of accident scenarios covering both design and beyond-design basis accidents. The test results indicate the AP600 safety systems as reflected in ROSA appear to perform as designed and there is no danger of core heatup for the accident scenarios investigated. In addition, no detrimental system interactions nor adverse effects of non-safety systems on the safety system functions were identified. However, three phenomena of interest have been identified for further examination to determine whether they are relevant to the AP600 plant. Those three phenomena are: (1) a potential for water hammer caused by rapid condensation which may occur following the actuation of the automatic depressurization system (ADS), (2) a large thermal gradient in the cold leg pipe where cooled water returns from the passive residual heat removal system and forms a thermally stratified layer, and (3) system-wide oscillations initiating following the ADS stage 4 actuation and persisting until the liquid in the pressurizer drains and steam generation in the core becomes insignificant.

  12. Clinical efficacy and safety of topical versus oral ivermectin in treatment of uncomplicated scabies.

    Science.gov (United States)

    Ahmad, Hesham M; Abdel-Azim, Eman S; Abdel-Aziz, Rasha T

    2016-01-01

    Many medications are available for scabies treatment including oral and topical ivermectin. However, studies comparing these two forms as a scabies treatment are few. This study compares efficacy and safety of topical versus oral ivermectin as scabies treatment. The study included 62 confirmed uncomplicated scabies patients, divided into: Group I (32 patients, received topical ivermectin) and Group II (30 patients, received oral ivermectin). Patients were assessed, clinically and by KOH smear at 1, 2 and 4 weeks. Treatment was repeated after one week in patients with persistent infection. Adverse events were recorded. Most patients (87.5% and 73.5% in group I and group II respectively) were symptom free after a single treatment. A second treatment was required in 4 patients of group I and 8 patients of group II. However, 2 weeks after treatment symptoms and signs completely resolved in all cases with no recurrence at 4 weeks. This study suggests that both topical and oral ivermectin are safe and equally effective in treatment of uncomplicated scabies. Single treatment, whether topical or oral, is associated with high cure rate in a week post treatment. However, repeating treatment after one week may be required to achieve 100% cure.

  13. A clinical comparative study of oral and topical ginger on severity and duration of primary dysmenorrhea

    Directory of Open Access Journals (Sweden)

    P. Shirooye

    2017-01-01

    Full Text Available Background and objectives: Primary dysmenorrhea has remained a health problem. This study has compared the effect of oral and topical ginger on severity and duration of primary dysmenorrhea.  Methods: A single-blind randomized trial was conducted on 70 female students with moderate and severe primary dysmenorrhea. The participants were stratified randomized between two groups of oral and topical ginger. The oral group received 250 mg capsules of ginger powder and the topical group applied five drops of ginger oil topically every 6 hours from two days before through the first three days of menstruation for three cycles. The severity and duration of pain, and the number of mefenamic acid consumption were assessed in each cycle. Before-after changes were evaluated in each group and were compared between two groups. Results: The reduction of pain severity was 3(±3.2 in the topical compared to 2.6(±3.4 in the oral group (p

  14. Topical anaesthesia in children: reducing the need for specialty referral.

    LENUS (Irish Health Repository)

    O'Connor, Gabrielle

    2012-01-31

    OBJECTIVE: The management of wounds in children is stressful, not only for the child, but also for parents and staff. In our Emergency Department (ED), we currently do not have a paediatric sedation policy, and thus children requiring suturing, not amenable to distraction and infiltrative anaesthesia, are referred to specialty teams for general anaesthesia. We proposed that the introduction of a topical anaesthetic gel (lidocaine, adrenaline, tetracaine - LAT) might help to reduce the number of referrals, by allowing the ED staff to perform the procedures, in combination with nonpharmacological approaches. METHODS: We carried out a retrospective review of ED records of all children aged 14 years or less attending with wounds, over an 8-month period, from 01 May 2007 to 31 January 2008. RESULTS: Two hundred and one (50.6%) patients presented before the introduction of LAT gel, whereas 196 (49.3%) patients presented afterwards. A total of 39 (19.4%) patients were referred for specialty review pre-LAT, whereas only 19 (9.7%) patients were referred in the LAT group. Of these, 31 (15.4%) pre-LAT and 15 (7.7%) LAT group required general anaesthesia. There is a significant difference between these two groups, using Fischer\\'s exact test, P=0.018. CONCLUSION: We have found that the introduction of topical anaesthetic gel in ED has significantly reduced the number of children with wounds referred to specialty teams for general anaesthesia. This has important implications for patient safety and hospital resources.

  15. Novel Topic Impact on Authorship Attribution

    Science.gov (United States)

    2009-12-01

    consisted of 72 documents written by eight students . Each student wrote a total of 24 documents in three different genres about three different topics [14...attribution," in Proceedings of the SIGIR 󈧋 Workshop on Plagiarism Analysis, Authorship Identification, and Near-Duplicate Detection, PAN 2007

  16. Special topics in the theory of piezoelectricity

    CERN Document Server

    Yang, Jiashi

    2009-01-01

    Piezoelectricity has been a steadily growing field, with recent advances made by researchers from applied physics, acoustics, materials science, and engineering. This collective work presents a comprehensive treatment of selected advanced topics in the subject. The book is written for an intermediate graduate level and is intended for researchers, mechanical engineers, and applied mathematicians interested in the advances and new applications in piezoelectricity.

  17. An Emerging Era in Topical Delivery: Organogels

    Directory of Open Access Journals (Sweden)

    Sreedevi.T

    2012-06-01

    Full Text Available Semisolid preparations for external application to skin have gained much demand, since it is easily absorbed through the skin layers. Many novel topical dosage forms have been discovered, among which organogels appears to play an important role. Organogels are thermodynamically stable, biocompatible, isotropic gel, which not only give localised effect, but also systemic effect through percutaneous absorption. Although different types of gelator molecules are being used for the development of organogels, both egg and soya lecithin are mainly focused. The purity of lecithin is also considered to be an important factor in gelation. Apart from lecithin, non-ionic surfactant based microemulsion gels and pluronic organogels are also being developed. Compared to conventional topical dosage forms, these novel formulations are found to be more advantageous and efficient. In future, organogels can give way to many promising discoveries in the field of topical dosage forms. The current review aims at giving an idea about organogels, its applications and importance in topical delivery.

  18. Six Hot Topics in Planetary Astronomy

    OpenAIRE

    Jewitt, David

    2008-01-01

    Six hot topics in modern planetary astronomy are described: 1) lightcurves and densities of small bodies 2) colors of Kuiper belt objects and the distribution of the ultrared matter 3) spectroscopy and the crystallinity of ice in the outer Solar system 4) irregular satellites of the giant planets 5) the Main Belt Comets and 6) comets and meteor stream parents.

  19. Expose Mechanical Engineering Students to Biomechanics Topics

    Science.gov (United States)

    Shen, Hui

    2011-01-01

    To adapt the focus of engineering education to emerging new industries and technologies nationwide and in the local area, a biomechanics module has been developed and incorporated into a mechanical engineering technical elective course to expose mechanical engineering students at ONU (Ohio Northern University) to the biomedical engineering topics.…

  20. Contact Dermatitis From Topical Application Of Mercurochrome

    Directory of Open Access Journals (Sweden)

    Saha Sib Shankar

    1995-01-01

    Full Text Available Mercury in its metallic from and its other salts may cause contact dermatitis and eczema; but contact allergy due to them is rather uncommon. A case of eczematous reaction due to topical application of mercurochrome developing within one day is being reported.

  1. Contact Dermatitis From Topical Application Of Mercurochrome

    OpenAIRE

    Saha Sib Shankar; Manjumdar Sabyasachi

    1995-01-01

    Mercury in its metallic from and its other salts may cause contact dermatitis and eczema; but contact allergy due to them is rather uncommon. A case of eczematous reaction due to topical application of mercurochrome developing within one day is being reported.

  2. Topical morphine for oral mucositis in children

    DEFF Research Database (Denmark)

    Nielsen, Bettina Nygaard; Aagaard, Gitte; Henneberg, Steen W;

    2012-01-01

    Systemic opioids for painful chemotherapy-induced oral mucositis in children often result in unsatisfactory pain relief and a high frequency of side effects. Opioids applied topically can produce analgesia by binding to opioid receptors on peripheral terminals of sensory neurons. These receptors...

  3. Topical beta-Blockers and Mortality

    NARCIS (Netherlands)

    Muskens, Rogier P. H. M.; Wolfs, Roger C. W.; Wittenian, Jacqueline C. M.; Hofman, Albert; de Jong, Paulus T. V. M.; Stricker, Bruno H. C.; Jansonius, Nomdo M.

    2008-01-01

    Purpose: To study the associations between long-term and short-term use of topical beta-blockers and mortality. Design: Prospective population-based cohort study. Participants: To examine long-term effects, 3842 participants aged 55 years and older were recruited. To examine short-term effects, 484

  4. Teaching Difficult Topics with Primary Sources

    Science.gov (United States)

    Potter, Lee Ann

    2011-01-01

    "Difficult" or "challenging" topics to teach include racism, violence, genocide, bullying, gangs, abuse (physical, emotional, and substance), slavery, suffering, hatred, terrorism, war, disease, loss, addiction, and more. But by confronting them with students, in the safety of a classroom through thoughtfully constructed lessons (ones that take…

  5. Mobility Aids: MedlinePlus Health Topic

    Science.gov (United States)

    ... ClinicalTrials.gov: Self-Help Devices (National Institutes of Health) Journal Articles References and abstracts from MEDLINE/PubMed (National ... Eldercare at Home: Mobility Problems (AGS Foundation for Health in Aging) Topic Image MedlinePlus Email Updates Get Mobility Aids ...

  6. Deep Belief Nets for Topic Modeling

    DEFF Research Database (Denmark)

    Maaløe, Lars; Arngren, Morten; Winther, Ole

    2015-01-01

    . Efficient retrieval can be carried out in the latent representation. We work both on public benchmarks and digital media content provided by Issuu, an on-line publishing platform. This article also comes with a newly developed deep belief nets toolbox for topic modeling tailored towards performance...

  7. Common Core: Teaching Optimum Topic Exploration (TOTE)

    Science.gov (United States)

    Karge, Belinda Dunnick; Moore, Roxane Kushner

    2015-01-01

    The Common Core has become a household term and yet many educators do not understand what it means. This article explains the historical perspectives of the Common Core and gives guidance to teachers in application of Teaching Optimum Topic Exploration (TOTE) necessary for full implementation of the Common Core State Standards. An effective…

  8. Tracking Multiple Topics for Finding Interesting Articles

    Energy Technology Data Exchange (ETDEWEB)

    Pon, R K; Cardenas, A F; Buttler, D J; Critchlow, T J

    2007-02-15

    We introduce multiple topic tracking (MTT) for iScore to better recommend news articles for users with multiple interests and to address changes in user interests over time. As an extension of the basic Rocchio algorithm, traditional topic detection and tracking, and single-pass clustering, MTT maintains multiple interest profiles to identify interesting articles for a specific user given user-feedback. Focusing on only interesting topics enables iScore to discard useless profiles to address changes in user interests and to achieve a balance between resource consumption and classification accuracy. Also by relating a topic's interestingness to an article's interestingness, iScore is able to achieve higher quality results than traditional methods such as the Rocchio algorithm. We identify several operating parameters that work well for MTT. Using the same parameters, we show that MTT alone yields high quality results for recommending interesting articles from several corpora. The inclusion of MTT improves iScore's performance by 9% to 14% in recommending news articles from the Yahoo! News RSS feeds and the TREC11 adaptive filter article collection. And through a small user study, we show that iScore can still perform well when only provided with little user feedback.

  9. Water: A Topic for All Sciences

    Science.gov (United States)

    Davies, Malonne I.; Seimears, C. Matt

    2008-01-01

    The authors illustrate an effective lesson-planning technique known as unpacking for the broad topic of water. Interconnections among science disciplines are shown for numerous possible subtopics. Two lesson sets are included, the first dealing with properties of water and the second dealing with water as a resource. (Contains 1 table and 4…

  10. Recent Progress in Some Active Topics on Complex Networks

    Science.gov (United States)

    Gu, J.; Zhu, Y.; Guo, L.; Jiang, J.; Chi, L.; Li, W.; Wang, Q. A.; Cai, X.

    2015-04-01

    Complex networks have been extensively studied across many fields, especially in interdisciplinary areas. It has since long been recognized that topological structures and dynamics are important aspects for capturing the essence of complex networks. The recent years have also witnessed the emergence of several new elements which play important roles in network study. By combining the results of different research orientations in our group, we provide here a review of the recent advances in regards to spectral graph theory, opinion dynamics, interdependent networks, graph energy theory and temporal networks. We hope this will be helpful for the newcomers of those fields to discover new intriguing topics.

  11. Quantization on nilpotent Lie groups

    CERN Document Server

    Fischer, Veronique

    2016-01-01

    This book presents a consistent development of the Kohn-Nirenberg type global quantization theory in the setting of graded nilpotent Lie groups in terms of their representations. It contains a detailed exposition of related background topics on homogeneous Lie groups, nilpotent Lie groups, and the analysis of Rockland operators on graded Lie groups together with their associated Sobolev spaces. For the specific example of the Heisenberg group the theory is illustrated in detail. In addition, the book features a brief account of the corresponding quantization theory in the setting of compact Lie groups. The monograph is the winner of the 2014 Ferran Sunyer i Balaguer Prize.

  12. In touch with psoriasis: topical treatments and current guidelines.

    LENUS (Irish Health Repository)

    Murphy, G

    2011-06-01

    This article describes topical therapies and treatment guidelines for psoriasis and is based on a presentation given by the authors at a satellite symposium held during the 19th Congress of the European Academy of Dermatology and Venereology, 6-10 October, 2010, in Gothenburg, Sweden. The highly variable nature of psoriasis and its individual presentation in patients can make it difficult to choose the most appropriate treatment. There are many treatment options, from topical treatment with emollients for very mild psoriasis, to systemic therapy with fumaric acid esters, methotrexate or biologics for severe disease. For the treatment of mild-to-moderate psoriasis, topical therapy is generally the most appropriate and a variety of options, both historical and recent, are available. Newer therapies offer greater convenience and fewer side-effects. Of the more recently available therapies, vitamin D analogues and topical corticosteroids are the two with the greatest proven efficacy in randomized clinical trials. A recent Cochrane review showed the highest efficacy overall with the fixed combination vitamin D analogue (calcipotriol) and corticosteroid (betamethasone dipropionate). Indeed, clinical trials have shown that two-compound calcipotriol\\/betamethasone dipropionate ointment has higher efficacy than calcipotriol or betamethasone dipropionate alone. With regard to safety, two-compound calcipotriol\\/betamethasone dipropionate was shown to be suitable for intermittent long-term treatment of mild-to-moderate psoriasis. The findings of the Cochrane review are reflected in the current treatment guidelines from the USA and Germany regarding the treatment of mild-to-moderate psoriasis. In both these guidelines, which will be discussed in this article, the recommended treatments for this patient group are vitamin D analogues and corticosteroids, particularly when used in combination.

  13. In touch with psoriasis: topical treatments and current guidelines.

    LENUS (Irish Health Repository)

    Murphy, G

    2012-02-01

    This article describes topical therapies and treatment guidelines for psoriasis and is based on a presentation given by the authors at a satellite symposium held during the 19th Congress of the European Academy of Dermatology and Venereology, 6-10 October, 2010, in Gothenburg, Sweden. The highly variable nature of psoriasis and its individual presentation in patients can make it difficult to choose the most appropriate treatment. There are many treatment options, from topical treatment with emollients for very mild psoriasis, to systemic therapy with fumaric acid esters, methotrexate or biologics for severe disease. For the treatment of mild-to-moderate psoriasis, topical therapy is generally the most appropriate and a variety of options, both historical and recent, are available. Newer therapies offer greater convenience and fewer side-effects. Of the more recently available therapies, vitamin D analogues and topical corticosteroids are the two with the greatest proven efficacy in randomized clinical trials. A recent Cochrane review showed the highest efficacy overall with the fixed combination vitamin D analogue (calcipotriol) and corticosteroid (betamethasone dipropionate). Indeed, clinical trials have shown that two-compound calcipotriol\\/betamethasone dipropionate ointment has higher efficacy than calcipotriol or betamethasone dipropionate alone. With regard to safety, two-compound calcipotriol\\/betamethasone dipropionate was shown to be suitable for intermittent long-term treatment of mild-to-moderate psoriasis. The findings of the Cochrane review are reflected in the current treatment guidelines from the USA and Germany regarding the treatment of mild-to-moderate psoriasis. In both these guidelines, which will be discussed in this article, the recommended treatments for this patient group are vitamin D analogues and corticosteroids, particularly when used in combination.

  14. AP Studio Art as an Enabling Constraint for Secondary Art Education

    Science.gov (United States)

    Graham, Mark A.

    2009-01-01

    Advanced Placement (AP) Studio Art is an influential force in secondary art education as is evident in the 31,800 portfolios submitted for review in 2008. From the perspectives of a high school educator and AP Reader, this author has observed how the constraints of the AP program can be used to generate support for high school art programs and…

  15. Using a Classroom Response System to Improve Multiple-Choice Performance in AP[R] Physics

    Science.gov (United States)

    Bertrand, Peggy

    2009-01-01

    Participation in rigorous high school courses such as Advanced Placement (AP[R]) Physics increases the likelihood of college success, especially for students who are traditionally underserved. Tackling difficult multiple-choice exams should be part of any AP program because well-constructed multiple-choice questions, such as those on AP exams and…

  16. Working group report: Astroparticle and neutrino physics

    Indian Academy of Sciences (India)

    Raj Gandhi; Subhendra Mohanty; Tarun Souradeep; S Agarwalla; K Bhattacharya; B Brahmachari; R Crittenden; S Goswami; P Ghoshal; M Lindner; H S Mani; S Mitra; S Pascoli; S Panda; R Rangarajan; S Ray; T Roy Choudhury; R Saha; S Sarkar; A Srivastava; R Sheth; S Uma Sankar; U Yajnik

    2006-10-01

    The working group on astroparticle and neutrino physics at WHEPP-9 covered a wide range of topics. The main topics were neutrino physics at INO, neutrino astronomy and recent constraints on dark energy coming from cosmological observations of large scale structure and CMB anisotropy.

  17. Plant-specific insertions in the soybean aspartic proteinases, soyAP1 and soyAP2, perform different functions of vacuolar targeting.

    Science.gov (United States)

    Terauchi, Kaede; Asakura, Tomiko; Ueda, Haruko; Tamura, Tomoko; Tamura, Kentaro; Matsumoto, Ichiro; Misaka, Takumi; Hara-Nishimura, Ikuko; Abe, Keiko

    2006-07-01

    Most aspartic proteinases (APs) of plant origin are characterized by the presence of plant-specific insertion (PSI) in their primary structure. PSI has been reported to function as signals for both transport of AP molecules from the endoplasmic reticulum (ER) and for their targeting to the vacuole. To determine the functions of the PSIs in soyAP1 and soyAP2 identified in our previous study, we examined their subcellular localization by transient expression of a green fluorescent protein (GFP) fusion protein in the protoplasts of Arabidopsis suspension-cultured cells. Both soyAP1-GFP and soyAP2-GFP were targeted to the vacuole. To confirm the role of the PSI, we prepared PSI-deleted soyAP1 and soyAP2, and investigated their vacuolar targeting by the same method. While the former deletion mutant was always transported to the vacuole, the latter sometimes remained in the ER and was only sometimes transported to the vacuole. These observations indicated that, in the case of soyAP1, the PSI is not involved in vacuolar targeting, also suggesting that the function of the PSI differs depending on its origin.

  18. Structural characterization of the N-terminal mineral modification domains from the molluscan crystal-modulating biomineralization proteins, AP7 and AP24.

    Science.gov (United States)

    Wustman, Brandon A; Morse, Daniel E; Evans, John Spencer

    2004-08-05

    The AP7 and AP24 proteins represent a class of mineral-interaction polypeptides that are found in the aragonite-containing nacre layer of mollusk shell (H. rufescens). These proteins have been shown to preferentially interfere with calcium carbonate mineral growth in vitro. It is believed that both proteins play an important role in aragonite polymorph selection in the mollusk shell. Previously, we demonstrated the 1-30 amino acid (AA) N-terminal sequences of AP7 and AP24 represent mineral interaction/modification domains in both proteins, as evidenced by their ability to frustrate calcium carbonate crystal growth at step edge regions. In this present report, using free N-terminal, C(alpha)-amide "capped" synthetic polypeptides representing the 1-30 AA regions of AP7 (AP7-1 polypeptide) and AP24 (AP24-1 polypeptide) and NMR spectroscopy, we confirm that both N-terminal sequences possess putative Ca (II) interaction polyanionic sequence regions (2 x -DD- in AP7-1, -DDDED- in AP24-1) that are random coil-like in structure. However, with regard to the remaining sequences regions, each polypeptide features unique structural differences. AP7-1 possesses an extended beta-strand or polyproline type II-like structure within the A11-M10, S12-V13, and S28-I27 sequence regions, with the remaining sequence regions adopting a random-coil-like structure, a trait common to other polyelectrolyte mineral-associated polypeptide sequences. Conversely, AP24-1 possesses random coil-like structure within A1-S9 and Q14-N16 sequence regions, and evidence for turn-like, bend, or loop conformation within the G10-N13, Q17-N24, and M29-F30 sequence regions, similar to the structures identified within the putative elastomeric proteins Lustrin A and sea urchin spicule matrix proteins. The similarities and differences in AP7 and AP24 N-terminal domain structure are discussed with regard to joint AP7-AP24 protein modification of calcium carbonate growth.

  19. Small Group Communication in the 1980's.

    Science.gov (United States)

    Neer, Michael R., Ed.

    1981-01-01

    This special edition of "Communication" brings together the work of nine leading scholars of small group communication. The following topics are discussed: (1) small group communication research in the 1980s; (2) unanswered questions in research on communication in the small group; (3) emerging trends in small group research; (4) structure in…

  20. Comparative study of oral and topical ketoconazole therapy in pityriasis versicolor

    Directory of Open Access Journals (Sweden)

    Nagpal V

    2003-07-01

    Full Text Available Introduction: Both topical and systemic ketoconazole are reported to be effective against pityriasis versicolor. Material and Methods: Forty patients suffering from pityriasis versicolor were treated either with oral ketoconazole 200 mg per day or 2% ketoconazole cream topically once daily for 2 weeks. Results: On global assessment, after 2 weeks of start of therapy, 18 (90% out of 20 patients treated with oral ketoconazole were cured while 2 patients had considerable residual disease. In the ketoconazole cream group, 16 (80% out of 20 patients were cured and 4 patients had considerable residual disease. Conclusion: No significant difference was observed in the response rates in the two groups. Relapse occurred in two patients of the systemic ketoconazole group and six patients of the topical ketoconazole group during the follow-up period of three months.

  1. AP Theory III: Cone-like Graded SUSY, Dynamic Dark Energy and the YM Millenium Problem

    CERN Document Server

    Winkelnkemper, H E

    2010-01-01

    Artin Presentation Theory, (AP Theory), is a new, direct infusion, via pure braid theory, of discrete group theory, (i.e., symmetry in its purest form), into the theory of {\\it smooth} 4-manifolds, (i.e.,$(3+1)$-Quantum Gravity in its purest topological form), thus exhibiting the most basic, rigorous, universal, model-free intrinsic {\\it gauge-gravity} duality in a non-infinitesimal, cone-like graded, as holographic as possible, model-independent, non-perturbative, background-independent, parameter-free manner. {\\it In AP Theory even smooth topology change becomes gauge-theoretic, setting the stage for a rigorous smooth topological $(3+1)$-QFT of Dynamic Dark Energy.} In this theory, the rigid $\\infty$ of the dimension of classical Hilbert space is substituted by the dynamic $\\infty$ of the $\\infty$ generation at each stage of a cone-like graded subgroup of topology-changing transitions/interactions. As a corollary, the Cosmological Constant problem and the YM Millenium Mass Gap problem, two of the most perpl...

  2. Generic effluent monitoring system certification for AP-40 exhauster stack

    Energy Technology Data Exchange (ETDEWEB)

    Glissmeyer, J.A.; Davis, W.E.; Bussell, J.H.; Maughan, A.D.

    1997-09-01

    Tests were conducted to verify that the Generic Effluent Monitoring System (GEMS), as applied to the AP-40 exhauster stack, meets all applicable regulatory performance criteria for air sampling systems at nuclear facilities. These performance criteria address both the suitability of the air sampling probe location and the transport of the sample to the collection devices. The criteria covering air sampling probe location ensure that the contaminants in the stack are well mixed with the airflow at the probe location such that the extracted sample represents the whole. The sample transport criteria ensure that the sampled contaminants are quantitatively delivered to the collection device. The specific performance criteria are described in detail in the report. The tests demonstrated that the GEMS/AP-40 system meets all applicable performance criteria. The contaminant mixing tests were conducted by Pacific Northwest National Laboratory (PNNL) at the wind tunnel facility, 331-H Building, using a mockup of the actual stack. The particle sample transport tests were conducted by PNNL at the Numatec Hanford Company`s 305 Building. The AP-40 stack is typical of several 10-in. diameter stacks that discharge the filtered ventilation air from tank farms at the U.S. Department of Energy`s Hanford Site in Richland, Washington. The GEMS design features a probe with a single shrouded sampling nozzle, a sample delivery line, and sample collection system. The collection system includes a filter holder to collect the sample of record and an in-line detector head and filter for monitoring beta radiation-emitting particles. Unrelated to the performance criteria, it was found that the record sample filter holder exhibited symptoms of sample bypass around the particle collection filter. This filter holder should either be modified or replaced with a different type. 10 refs., 8 figs., 6 tabs.

  3. Initial diagnostics commissioning results for the APS injector subsystems

    Science.gov (United States)

    Lumpkin, A.; Chung, Y.; Kahana, E.; Patterson, D.; Sellyey, W.; Smith, T.; Wang, X.

    1995-05-01

    In recent months the first beams have been introduced into the various injector subsystems of the Advanced Photon Source (APS). An overview will be given of the diagnostics results on beam profiling, beam position monitors (BPMs), loss rate monitors (LRMs), current monitors (CMs), and photon monitors on the low energy transport lines, positron accumulator ring (PAR), and injector synchrotron (IS). Initial measurements have been done with electron beams at energies from 250 to 450 MeV and 50 to 400 pC per macrobunch. Operations in single turn and stored beam conditions were diagnosed in the PAR and IS.

  4. Operation of the APS photoinjector drive laser system.

    Energy Technology Data Exchange (ETDEWEB)

    Li, Y.; Accelerator Systems Division (APS)

    2008-08-04

    The APS photoinjector drive laser system has been in operation since 1999 and is achieving a performance level exceeding the requirement of stable operation of the LEUTL FEL system. One remarkable number is the UV energy stability of better than 2% rms, sometimes less than 1% rms. This report summarizes the operation experience of the laser system and the improvements made along the way. We also outline the route of upgrade of the system and some frontier laser research and development opportunities in ultrabright electron beam generation.

  5. Desarrollo y Estudio del protocolo Observe para CoAP

    OpenAIRE

    Gimeno Gimenez, Javier

    2013-01-01

    Premi Accenture al millor Projecte Final de Carrera, Treball Fi de Grau, Master Thesis, en l'Àrea de Serveis Telemàtics (curs 2012-2013) [ANGLÈS] In the context of the wireless sensor networks, an implementation of the observer pattern for CoAP is done. The implementation is done both for the nodes of the network and for a proxy that will allow to establish object-observer relationships between sensors inside the WSN and elements outside the network. [CASTELLÀ] En el contexto de las red...

  6. A Comparison of Topical or Retrobulbar Anesthesia for 23-Gauge Posterior Vitrectomy

    Directory of Open Access Journals (Sweden)

    Hande Celiker

    2014-01-01

    Full Text Available Background. To compare the efficacy and safety of topical anesthesia versus retrobulbar anesthesia in 23-gauge vitreoretinal surgery. Materials and Methods. A total of 63 patients scheduled for 23 G posterior vitrectomy without scleral buckling procedures were included in the study. The patients were randomly assigned to receive either topical (Group 1, n=31 or retrobulbar anesthesia (Group 2, n=32. Postoperatively, patients were shown a visual analogue pain scale (VAPS from 1 (no pain or discomfort to 4 (severe pain or discomfort to rate the levels of pain. Results. There was more discomfort in patients in Group 2 while anesthetic was administered (Group 1:  1.0±0, Group 2: 2.3±0.7, P=0.0001. Between the two groups the level of pain during surgery (Group 1: 1.4±0.5, Group 2: 1.5±0.5; P=0.85 was noted. There was also no significant difference between two groups postoperatively (Group 1: 1.2±0.4, Group 2: 1.3±0.4; P=0.28. There were no complications in either group related to the anesthetic technique. No patient needed sedation or anesthesia supplement during the surgery or postoperative period. Conclusion. Topical anesthesia in posterior vitrectomy procedures is an effective and safe method that is alternative to retrobulbar anesthesia.

  7. AP/二茂铁衍生物混合体系的热感度研究%Study on thermal sensitivity of AP and ferrocene derivative mixtures

    Institute of Scientific and Technical Information of China (English)

    王宁; 赵孝彬; 罗岚; 李彦荣; 段卫毅

    2011-01-01

    通过局部热感度试验和DSC-TG联用仪,研究了高氯酸铵(AP)和一种二茂铁衍生物(EMT)混合体系的热感度.结果表明,减小AP粒度或增加EMT含量,能缩小AP高低温分解峰之间的差距,提高AP低温分解量,混合物的局部热感度增加.AP存在下,EMT的侧链容易发生断裂,断裂后的二茂铁或二茂铁离子活性体对AP分解起催化作用.此外,EMT 不利于AP的质子转移过程,但对HClO4的分解有较强催化作用.%Thermal sensitivity of AP and ferrocene derivative (EMT) mixtures was studied by partial thermal sensitivity and DSC-TG coupling. The results indicate that reducing AP particle size or increasing the content of EMT can shorten the gap between high-temperature thermal decomposition peak of AP and low-temperature thermal decomposition peak of AP, enhance the low-temperature thermad decomposition amount of AP,and increase partial thermal sensitivity about mixtures of AP and EMT. In the presence of AP, side-chain of EMT is easily ruptured. Residual main skeleton, ferrocene or ferrocene ion, is the real catalyst to thermal decomposition of AP. Furthermore, EMT inhabits proton transfer process of AP, but it is a strong catalysis of EMT to decomposition of HCIO4, one of initial decomposition product of AP.

  8. NF-κB/AP-1-Targeted Inhibition of Macrophage-Mediated Inflammatory Responses by Depigmenting Compound AP736 Derived from Natural 1,3-Diphenylpropane Skeleton

    Directory of Open Access Journals (Sweden)

    Van Thai Ha

    2014-01-01

    Full Text Available AP736 was identified as an antimelanogenic drug that can be used for the prevention of melasma, freckles, and dark spots in skin by acting as a suppressor of melanin synthesis and tyrosinase expression. Since macrophage-mediated inflammatory responses are critical for skin health, here we investigated the potential anti-inflammatory activity of AP736. The effects of AP736 on various inflammatory events such as nitric oxide (NO/prostaglandin (PG E2 production, inflammatory gene expression, phagocytic uptake, and morphological changes were examined in RAW264.7 cells. AP736 was found to strongly inhibit the production of both NO and PGE2 in lipopolysaccharide- (LPS- treated RAW264.7 cells. In addition, AP736 strongly inhibited both LPS-induced morphological changes and FITC-dextran-induced phagocytic uptake. Furthermore, AP736 also downregulated the expression of multiple inflammatory genes, such as inducible NO synthase (iNOS, cyclooxygenase- (COX- 2, and interleukin- (IL- 1β in LPS-treated RAW264.7 cells. Transcription factor analysis, including upstream signalling events, revealed that both NF-κB and AP-1 were targeted by AP736 via inhibition of the IKK/IκBα and IRAK1/TAK1 pathways. Therefore, our results strongly suggest that AP736 is a potential anti-inflammatory drug due to its suppression of NF-κB-IKK/IκBα and AP-1-IRAK1/TAK1 signalling, which may make AP736 useful for the treatment of macrophage-mediated skin inflammation.

  9. Overexpression of ligase defective E6-associated protein, E6-AP, results in mammary tumorigenesis.

    Science.gov (United States)

    Ramamoorthy, Sivapriya; Tufail, Rozina; Hokayem, Jimmy El; Jorda, Mercy; Zhao, Wei; Reis, Zizi; Nawaz, Zafar

    2012-02-01

    E6-associated protein (E6-AP) is a dual function protein. It acts as an E3 ubiquitin-protein ligase enzyme and coactivator of steroid hormone receptors such as estrogen (ERα) and progesterone (PR) receptors. It promotes the degradation of ERα and PR through the ubiquitin-proteasome pathway. Furthermore, it has been shown that the levels of E6-AP are inversely associated with that of ERα in human breast tumors. But the role of wild-type human E6-AP and its ubiquitin-protein ligase activity in mammary tumorigenesis is still unknown. To investigate this role, the authors utilized transgenic mice lines that specifically overexpress either the wild-type human E6-AP (E6-AP(WT)) or the ubiquitin-protein ligase defective E6-AP that contains C833S mutation (E6-AP(C833S)) in the mammary gland. To further substantiate the role of E6-AP in the development of breast tumorigenesis, it was also examined the expression of E6-AP in a large cohort of human breast cancer samples. The transgenic mice that overexpress wild-type E6-AP (E6-AP(WT)) fail to develop mammary tumors. Unlike the E6-AP(WT) mice, the E6-AP(C833S) mice that overexpress ubiquitin-protein ligase defective E6-AP protein develop mammary hyperplasia with a median latency of 18 months. These observations suggest that the inactivation of the ubiquitin-protein ligase function of E6-AP is sufficient to initiate the process of mammary tumor development. Furthermore, the data also suggests that E6-AP exerts its effects on target cells by modulating the protein levels and functions of ERα and PR. In addition, it was found in human breast cancer patients that the level of E6-AP is decreased in invasive breast tumors compared to normal breast tissue. Moreover, the authors also show that the survival patterns for E6-AP negative patients were worse compared to E6-AP positive patients. Taken together, these data suggests that E6-AP may act as a tumor suppressor in breast.

  10. Topics in modern physics theoretical foundations

    CERN Document Server

    Walecka, John Dirk

    2013-01-01

    While the two previous books entitled Introduction to Modern Physics: Theoretical Foundations and Advanced Modern Physics: Theoretical Foundations exposed the reader to the foundations and frontiers of today's physics, the goal of this third volume is to cover in some detail several topics omitted in the essentially linear progression of the first two. This book is divided into three parts. Part 1 is on quantum mechanics. Analytic solutions to the Schrödinger equation are developed for some basic systems. The analysis is then formalized, concluding with a set of postulates for the theory. Part 2 is on applications of quantum mechanics: approximation methods for bound states, scattering theory, time-dependent perturbation theory, and electromagnetic radiation and quantum electrodynamics. Part 3 covers some selected topics in relativistic quantum field theory: discrete symmetries, the Heisenberg picture, and the Feynman rules for quantum chromodynamics. The three volumes in this series taken together provide ...

  11. [Update of the topical treatment of psoriasis].

    Science.gov (United States)

    Carrascosa, J M; Vanaclocha, F; Borrego, L; Fernández-López, E; Fuertes, A; Rodríguez-Fernández-Freire, L; Zulaica, A; Tuneu, A; Caballé, G; Colomé, E; Bordas, X; Hernanz, J M; Brufau, C; Herrera, E

    2009-04-01

    Topical therapy continues to be one of the pillars of psoriasis management. Topical corticosteroids and vitamin D analogs are the drugs of choice during the induction phase, and vitamin D analogs continue to be drugs of choice for maintenance therapy. Tazarotene and dithranol are suitable options in patients with certain, specific characteristics. The calcineurin inhibitors can be considered to be second-line treatment for psoriasis of the face and flexures. The efficacy and safety of the fixed-dose combination of betamethasone and calcipotriol in the induction phase is greater than that of either drug alone. The combination of corticosteroids with salicylic acid achieves better results than corticosteroids in monotherapy. None of the drugs evaluated stands out over the others in all clinical situations, and their use must therefore be individualized in each patient and adjusted according to the course of the disease.

  12. Topics from the theory of numbers

    CERN Document Server

    Grosswald, Emil

    1984-01-01

    Many of the important and creative developments in modern mathematics resulted from attempts to solve questions that originate in number theory. The publication of Emil Grosswald’s classic text presents an illuminating introduction to number theory. Combining the historical developments with the analytical approach, Topics from the Theory of Numbers offers the reader a diverse range of subjects to investigate, including: * divisibility * congruences * the Riemann zeta function * Diophantine equations and Fermat’s conjecture * the theory of partitions Comprehensive in nature, Topics from the Theory of Numbers is an ideal text for advanced undergraduates and graduate students alike. "In my opinion it is excellent. It is carefully written and represents clearly a work of a scholar who loves and understands his subject. One can only wish more authors would take such pains and would be as good and honest expositors as Grosswald." — Marc Kac "This book is designed for use in a first course in number theory at...

  13. SnAP reagents for the one-step synthesis of medium-ring saturated N-heterocycles from aldehydes.

    Science.gov (United States)

    Vo, Cam-Van T; Luescher, Michael U; Bode, Jeffrey W

    2014-04-01

    Interest in saturated N-heterocycles as scaffolds for the synthesis of bioactive molecules is increasing. Reliable and predictable synthetic methods for the preparation of these compounds, especially medium-sized rings, are limited. We describe the development of SnAP (Sn amino protocol) reagents for the transformation of aldehydes into seven-, eight- and nine-membered saturated N-heterocycles. This process occurs under mild, room-temperature conditions and offers exceptional substrate scope and functional-group tolerance. Air- and moisture-stable SnAP reagents are prepared on a multigram scale from inexpensive starting materials by simple reaction sequences. These new reagents and processes allow widely available aryl, heteroaryl and aliphatic aldehydes to be converted into diverse N-heterocycles, including diazepanes, oxazepanes, diazocanes, oxazocanes and hexahydrobenzoxazonines, by a single synthetic operation.

  14. Topical Day on Biological Effects of Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Baatout, S.; Jacquet, P.

    1997-05-15

    The topical day has been focussed on the potential effects of ionizing radiation on human health. A general overview on molecular and biophysical aspects of radiation, its effects on cells and organisms, and the contribution of radiobiology to radiation protection and risk assessment is given. The genetic effects of radiation and its effects on the developing organism, the effects of radiation on the cell cycle and the mechanisms of radiation induced apoptosis were also discussed.

  15. Topics on tournaments in graph theory

    CERN Document Server

    Moon, John W

    2015-01-01

    Tournaments, in this context, are directed graphs ― an important and interesting topic in graph theory. This concise volume collects a substantial amount of information on tournaments from throughout the mathematical literature. Suitable for advanced undergraduate students of mathematics, the straightforward treatment requires a basic familiarity with finite mathematics. The fundamental definitions and results appear in the earlier sections, and most of the later sections can be read independently of each other. Subjects include irreducible and strong tournaments, cycles and strong subtourname

  16. Contraception via topical application? - A review.

    Science.gov (United States)

    Schaefer, H; Stüttgen, G; Schalla, W

    1979-09-01

    The skin, generally speaking, is not an absorption organ but one of its major functions is the protection of the body against the entrance of foreign material. Under certain circumstances, however, drugs can be introduced into the skin and thereby into the body as can be seen in the topical treatment of skin diseases. Though percutaneous pharmacokinetics of steroids seem appropriate for contraception, the variability of the absorption process appears to be too high for this purpose.

  17. Psoriasis and psoriatic arthritis: Topical issues

    Directory of Open Access Journals (Sweden)

    Yulia Leonidovna Korsakova

    2012-09-01

    Full Text Available The topical issues of the diagnosis and treatment of psoriasis (Ps and psoriatic arthritis (PsA are discussed. The characteristics and treatments of Ps and the methods for the diagnosis of PsA in Ps are presented; the extraarticular manifestations of PsA, its radiological signs, criteria for a treatment response, the current principles of therapy, and prognosis in these patients are described.

  18. Topics in theoretical and applied statistics

    CERN Document Server

    Giommi, Andrea

    2016-01-01

    This book highlights the latest research findings from the 46th International Meeting of the Italian Statistical Society (SIS) in Rome, during which both methodological and applied statistical research was discussed. This selection of fully peer-reviewed papers, originally presented at the meeting, addresses a broad range of topics, including the theory of statistical inference; data mining and multivariate statistical analysis; survey methodologies; analysis of social, demographic and health data; and economic statistics and econometrics.

  19. Forewords Special Topic Issue on Nanophotonics

    Institute of Scientific and Technical Information of China (English)

    Yiping Cui; Joseph W.Haus

    2009-01-01

    @@ This Special Topic Issue has grown out of research that has been highlighted at the Nanophotonics Conference series held in China for the past three years.The fourteen papers appearing in this issue are a small sampling of the total scope of the conference.Broadly speaking,the subjects covered by the contributing authors include quantum properties using semiconductor materials,nanocharacterization especially with applications to medical fields,photonic crystals and fibers,and plasmonics.

  20. Molecular Basis for Enhancement of the Meiotic DMCI Recombinase by RAD51AP1

    Energy Technology Data Exchange (ETDEWEB)

    Dray, Eloise; Dunlop, Myun Hwa; Kauppi, Liisa; San Filippo, Joseph San; Wiese, Claudia; Tsai, Miaw-Sheue; Begovic, Sead; Schild, David; Jasin, Maria; Keeney, Scott; Sung, Patrick

    2010-11-05

    Homologous recombination is needed for meiotic chromosome segregation, genome maintenance, and tumor suppression. RAD51AP1 (RAD51 Associated Protein 1) has been shown to interact with and enhance the recombinase activity of RAD51. Accordingly, genetic ablation of RAD51AP1 leads to enhanced sensitivity to and also chromosome aberrations upon DNA damage, demonstrating a role for RAD51AP1 in mitotic homologous recombination. Here we show physical association of RAD51AP1 with the meiosis-specific recombinase DMC1 and a stimulatory effect of RAD51AP1 on the DMC1-mediated D-loop reaction. Mechanistic studies have revealed that RAD51AP1 enhances the ability of the DMC1 presynaptic filament to capture the duplex DNA partner and to assemble the synaptic complex, in which the recombining DNA strands are homologously aligned. We also provide evidence that functional co-operation is dependent on complex formation between DMC1 and RAD51AP1, and that distinct epitopes in RAD51AP1 mediate interactions with RAD51 and DMC1. Finally, we show that RAD51AP1 is expressed in mouse testes, and that RAD51AP1 foci co-localize with a subset of DMC1 foci in spermatocytes. These results suggest that RAD51AP1 also serves an important role in meiotic homologous recombination.

  1. Lack of CD2AP disrupts Glut4 trafficking and attenuates glucose uptake in podocytes.

    Science.gov (United States)

    Tolvanen, Tuomas A; Dash, Surjya Narayan; Polianskyte-Prause, Zydrune; Dumont, Vincent; Lehtonen, Sanna

    2015-12-15

    The adapter protein CD2-associated protein (CD2AP) functions in various signaling and vesicle trafficking pathways, including endosomal sorting and/or trafficking and degradation pathways. Here, we investigated the role of CD2AP in insulin-dependent glucose transporter 4 (Glut4, also known as SLC2A4) trafficking and glucose uptake. Glucose uptake was attenuated in CD2AP(-/-) podocytes compared with wild-type podocytes in the basal state, and CD2AP(-/-) podocytes failed to increase glucose uptake in response to insulin. Live-cell imaging revealed dynamic trafficking of HA-Glut4-GFP in wild-type podocytes, whereas in CD2AP(-/-) podocytes, HA-Glut4-GFP clustered perinuclearly. In subcellular membrane fractionations, CD2AP co-fractionated with Glut4, IRAP (also known as LNPEP) and sortilin, constituents of Glut4 storage vesicles (GSVs). We further found that CD2AP forms a complex with GGA2, a clathrin adaptor, which sorts Glut4 to GSVs, suggesting a role for CD2AP in this process. We also found that CD2AP forms a complex with clathrin and connects clathrin to actin in the perinuclear region. Furthermore, clathrin recycling back to trans-Golgi membranes from the vesicular fraction containing GSVs was defective in the absence of CD2AP. This leads to reduced insulin-stimulated trafficking of GSVs and attenuated glucose uptake into CD2AP(-/-) podocytes.

  2. Sodium ascorbyl phosphate in topical microemulsions.

    Science.gov (United States)

    Spiclin, Polona; Homar, Miha; Zupancic-Valant, Andreja; Gasperlin, Mirjana

    2003-04-30

    Sodium ascorbyl phosphate is a hydrophilic derivative of ascorbic acid, which has improved stability arising from its chemical structure. It is used in cosmetic and pharmaceutical preparations since it has many favorable effects in the skin, the most important being antioxidant action. In order to achieve this, it has to be converted into free ascorbic acid by enzymatic degradation in the skin. In the present work, o/w and w/o microemulsions composed of the same ingredients, were selected as carrier systems for topical delivery of sodium ascorbyl phosphate. We showed that sodium ascorbyl phosphate was stable in both types of microemulsion with no significant influence of its location in the carrier system. To obtain liquid microemulsions appropriate for topical application, their viscosity was increased by adding thickening agents. On the basis of rheological characterization, 4.00% (m/m) colloidal silica was chosen as a suitable thickening agent for w/o microemulsions and 0.50% (m/m) xanthan gum for the o/w type. The presence of thickening agent and the location of sodium ascorbyl phosphate in the microemulsion influenced the in vitro drug release profiles. When incorporated in the internal aqueous phase, sustained release profiles were observed. This study confirmed microemulsions as suitable carrier systems for topical application of sodium ascorbyl phosphate.

  3. Tracking Multiple Topics for Finding Interesting Articles

    Energy Technology Data Exchange (ETDEWEB)

    Pon, R K; Cardenas, A F; Buttler, D J; Critchlow, T J

    2008-01-03

    We introduce multiple topic tracking (MTT) for iScore to better recommend news articles for users with multiple interests and to address changes in user interests over time. As an extension of the basic Rocchio algorithm, traditional topic detection and tracking, and single-pass clustering, MTT maintains multiple interest profiles to identify interesting articles for a specific user given user-feedback. Focusing on only interesting topics enables iScore to discard useless profiles to address changes in user interests and to achieve a balance between resource consumption and classification accuracy. iScore is able to achieve higher quality results than traditional methods such as the Rocchio algorithm. We identify several operating parameters that work well for MTT. Using the same parameters, we show that MTT alone yields high quality results for recommending interesting articles from several corpora. The inclusion of MTT improves iScore's performance by 25% in recommending news articles from the Yahoo! News RSS feeds and the TREC11 adaptive filter article collection. And through a small user study, we show that iScore can still perform well when only provided with little user feedback.

  4. Armenian media coverage of science topics

    Science.gov (United States)

    Mkhitaryan, Marie

    2016-12-01

    The article discusses features and issues of Armenian media coverage on scientific topics and provides recommendations on how to promote scientific topics in media. The media is more interested in social or public reaction rather than in scientific information itself. Medical science has a large share of the global media coverage. It is followed by articles about environment, space, technology, physics and other areas. Armenian media mainly tends to focus on a scientific topic if at first sight it contains something revolutionary. Media primarily reviews whether that scientific study can affect the Armenian economy and only then decides to refer to it. Unfortunately, nowadays the perception of science is a little distorted in media. We can often see headlines of news where is mentioned that the scientist has made "an invention". Nowadays it is hard to see the border between a scientist and an inventor. In fact, the technological term "invention" attracts the media by making illusionary sensation and ensuring large audience. The report also addresses the "Gitamard" ("A science-man") special project started in 2016 in Mediamax that tells about scientists and their motivations.

  5. Semantic Segmentation with Same Topic Constraints

    Directory of Open Access Journals (Sweden)

    Ling Mao

    2013-02-01

    Full Text Available A popular approach to semantic segmentation problems is to construct a pair wise Conditional Markov Random Field (CRF over image pixels where the pair wise term encodes a preference for smoothness within pixel neighborhoods. Recently, researchers have considered higher-order models that encode local region or soft non-local constraints (e.g., label consistency or co-occurrence statistics. These new models with higher-order terms have significantly pushed the state-of-the-art for semantic segmentation problems. In this study, we consider a novel non-local constraint that enforces consistent pixel labels among those image regions having the same topic. These topics are discovered by Probabilistic Latent Semantic Analysis model (PLSA. We encode this constraint as a robust Pn higher-order potential among all the image regions of the same topic in a unified CRF model. We experimentally demonstrate quantitative and qualitative improvements over a refined baseline unary and pair wise CRF models.

  6. A New Generalized Similarity-Based Topic Distillation Algorithm

    Institute of Scientific and Technical Information of China (English)

    ZHOU Hongfang; DANG Xiaohui

    2007-01-01

    The procedure of hypertext induced topic search based on a semantic relation model is analyzed, and the reason for the topic drift of HITS algorithm was found to prove that Web pages are projected to a wrong latent semantic basis. A new concept-generalized similarity is introduced and, based on this, a new topic distillation algorithm GSTDA(generalized similarity based topic distillation algorithm) was presented to improve the quality of topic distillation. GSTDA was applied not only to avoid the topic drift, but also to explore relative topics to user query. The experimental results on 10 queries show that GSTDA reduces topic drift rate by 10% to 58% compared to that of HITS(hypertext induced topic search) algorithm, and discovers several relative topics to queries that have multiple meanings.

  7. Topical treatment (part two: Vehicles, nature and functions

    Directory of Open Access Journals (Sweden)

    Ertuğrul H. Aydemir

    2012-12-01

    Full Text Available Vehicles of topical medicines support the treatment with their physical effects, in addition to their carrying function. Different types of vehicles are composed of various mixtures of three main elements: water (hydrophilic bases, oil and powder. If a vehicle includes only one element, it is called monophasic, if two, biphasic, and if more than two, then it is termed polyphasic. According to the type of utilization, they may be classified as “liquids, semisolids and solids”. Liquids are solutions (monophasic-hydrophilic, colloids (in classic type monophasic, suspensions (biphasic, liquid oils (monophasic, liniments (biphasic and liquid emulsions (W/O-O/W. Semisolids including creams, ointments (pomades, pastes, foams and seras is the most commonly used group. All semisolids are biphasic or polyphasic except for some ointments which are pure semisolid oil (such as petrolatum. The group of solids includes only powders which are very bad vehicle and used only for prophylaxis.

  8. Luteolin, a flavonoid, inhibits AP-1 activation by basophils.

    Science.gov (United States)

    Hirano, Toru; Higa, Shinji; Arimitsu, Junsuke; Naka, Tetsuji; Ogata, Atsushi; Shima, Yoshihito; Fujimoto, Minoru; Yamadori, Tomoki; Ohkawara, Tomoharu; Kuwabara, Yusuke; Kawai, Mari; Matsuda, Hisashi; Yoshikawa, Masayuki; Maezaki, Naoyoshi; Tanaka, Tetsuaki; Kawase, Ichiro; Tanaka, Toshio

    2006-02-03

    Flavonoids including luteolin, apigenin, and fisetin are inhibitors of IL-4 synthesis and CD40 ligand expression by basophils. This study was done to search for compounds with greater inhibitory activity of IL-4 expression and to clarify the molecular mechanisms through which flavonoids inhibit their expression. Of the 37 flavonoids and related compounds examined, ayanin, luteolin, and apigenin were the strongest inhibitors of IL-4 production by purified basophils in response to anti-IgE antibody plus IL-3. Luteolin did not suppress Syk or Lyn phosphorylation in basophils, nor did suppress p54/46 SAPK/JNK, p38 MAPK, and p44/42 MAPK activation by a basophilic cell line, KU812 cells, stimulated with A23187 and PMA. However, luteolin did inhibit phosphorylation of c-Jun and DNA binding activity of AP-1 in nuclear lysates from stimulated KU812 cells. These results provide a fundamental structure of flavonoids for IL-4 inhibition and demonstrate a novel action of flavonoids that suppresses the activation of AP-1.

  9. Abnormal lithium abundance in several Ap-Bp stars

    CERN Document Server

    Shavrina, A; Drake, N A; Kudryavtsev, D O; Gopka, V F; Yushchenko, V A; Yushchenko, A V

    2013-01-01

    Using observations of rapidly rotating roAp star HD 12098, obtained with 6m telescope of SAO RAS in 2005-2008 in nine rotational phases (0.001-0.817), and code V. Tsymbal ROTATE we identified 3 lithium spots on the surface of star, one of them coincided with the position of one magnetic pole and two others are located near the other pole, symmetrically with respect to it. Perhaps magnetic field of the star has a more complex structure than the dipole (Shavrina 2008). Lithium abundance in the spots is greater than cosmic one. It can be explained by diffusion of lithium in the presence of a magnetic field or by production of lithium in the reactions of "spallation" on the surface of star near the magnetic poles (see, for example, Goriely 2007). Enhanced lithium abundances was also determined for other two slowly rotating Ap stars HR 465 and HD 965. The analysis is performed using a synthetic spectrum method taking into account magnetic splitting of lines by the SYNTHM code of Khan (2004).

  10. Pulsation models for the roAp star HD 134214

    CERN Document Server

    Saio, H; Weiss, W W; Matthews, J M; Ryabchikova, T

    2011-01-01

    Precise time-series photometry with the MOST satellite has led to identification of 10 pulsation frequencies in the rapidly oscillating Ap (roAp) star HD 134214. We have fitted the observed frequencies with theoretical frequencies of axisymmetric modes in a grid of stellar models with dipole magnetic fields. We find that, among models with a standard composition of $(X,Z) = (0.70,0.02)$ and with suppressed convection, eigenfrequencies of a $1.65\\,{\\rm M}_\\odot$ model with $\\log T_{\\rm eff} = 3.858$ and a polar magnetic field strength of 4.1kG agree best with the observed frequencies. We identify the observed pulsation frequency with the largest amplitude as a deformed dipole ($\\ell = 1$) mode, and the four next-largest-amplitude frequencies as deformed $\\ell = 2$ modes. These modes have a radial quasi-node in the outermost atmospheric layers ($\\tau \\sim 10^{-3}$). Although the model frequencies agree roughly with observed ones, they are all above the acoustic cut-off frequency for the model atmosphere and hen...

  11. The new AP Physics exams: Integrating qualitative and quantitative reasoning

    Science.gov (United States)

    Elby, Andrew

    2015-04-01

    When physics instructors and education researchers emphasize the importance of integrating qualitative and quantitative reasoning in problem solving, they usually mean using those types of reasoning serially and separately: first students should analyze the physical situation qualitatively/conceptually to figure out the relevant equations, then they should process those equations quantitatively to generate a solution, and finally they should use qualitative reasoning to check that answer for plausibility (Heller, Keith, & Anderson, 1992). The new AP Physics 1 and 2 exams will, of course, reward this approach to problem solving. But one kind of free response question will demand and reward a further integration of qualitative and quantitative reasoning, namely mathematical modeling and sense-making--inventing new equations to capture a physical situation and focusing on proportionalities, inverse proportionalities, and other functional relations to infer what the equation ``says'' about the physical world. In this talk, I discuss examples of these qualitative-quantitative translation questions, highlighting how they differ from both standard quantitative and standard qualitative questions. I then discuss the kinds of modeling activities that can help AP and college students develop these skills and habits of mind.

  12. Improved Monte Carlo Renormalization Group Method

    Science.gov (United States)

    Gupta, R.; Wilson, K. G.; Umrigar, C.

    1985-01-01

    An extensive program to analyze critical systems using an Improved Monte Carlo Renormalization Group Method (IMCRG) being undertaken at LANL and Cornell is described. Here we first briefly review the method and then list some of the topics being investigated.

  13. RAD51AP1-deficiency in vertebrate cells impairs DNA replication.

    Science.gov (United States)

    Parplys, Ann C; Kratz, Katja; Speed, Michael C; Leung, Stanley G; Schild, David; Wiese, Claudia

    2014-12-01

    RAD51-associated protein 1 (RAD51AP1) is critical for homologous recombination (HR) by interacting with and stimulating the activities of the RAD51 and DMC1 recombinases. In human somatic cells, knockdown of RAD51AP1 results in increased sensitivity to DNA damaging agents and to impaired HR, but the formation of DNA damage-induced RAD51 foci is unaffected. Here, we generated a genetic model system, based on chicken DT40 cells, to assess the phenotype of fully inactivated RAD51AP1 in vertebrate cells. Targeted inactivation of both RAD51AP1 alleles has no effect on either viability or doubling-time in undamaged cells, but leads to increased levels of cytotoxicity after exposure to cisplatin or to ionizing radiation. Interestingly, ectopic expression of GgRAD51AP1, but not of HsRAD51AP1 is able to fully complement in cell survival assays. Notably, in RAD51AP1-deficient DT40 cells the resolution of DNA damage-induced RAD51 foci is greatly slowed down, while their formation is not impaired. We also identify, for the first time, an important role for RAD51AP1 in counteracting both spontaneous and DNA damage-induced replication stress. In human and in chicken cells, RAD51AP1 is required to maintain wild type speed of replication fork progression, and both RAD51AP1-depleted human cells and RAD51AP1-deficient DT40 cells respond to replication stress by a slow-down of replication fork elongation rates. However, increased firing of replication origins occurs in RAD51AP1-/- DT40 cells, likely to ensure the timely duplication of the entire genome. Taken together, our results may explain why RAD51AP1 commonly is overexpressed in tumor cells and tissues, and we speculate that the disruption of RAD51AP1 function could be a promising approach in targeted tumor therapy.

  14. Identification of Cargo for Adaptor Protein (AP) Complexes 3 and 4 by Sucrose Gradient Profiling.

    Science.gov (United States)

    Pertl-Obermeyer, Heidi; Wu, Xu Na; Schrodt, Jens; Müdsam, Christina; Obermeyer, Gerhard; Schulze, Waltraud X

    2016-09-01

    Intracellular vesicle trafficking is a fundamental process in eukaryotic cells. It enables cellular polarity and exchange of proteins between subcellular compartments such as the plasma membrane or the vacuole. Adaptor protein complexes participate in the vesicle formation by specific selection of the transported cargo. We investigated the role of the adaptor protein complex 3 (AP-3) and adaptor protein complex 4 (AP-4) in this selection process by screening for AP-3 and AP-4 dependent cargo proteins. Specific cargo proteins are expected to be mis-targeted in knock-out mutants of adaptor protein complex components. Thus, we screened for altered distribution profiles across a density gradient of membrane proteins in wild type versus ap-3β and ap-4β knock-out mutants. In ap-3β mutants, especially proteins with transport functions, such as aquaporins and plasma membrane ATPase, as well as vesicle trafficking proteins showed differential protein distribution profiles across the density gradient. In the ap-4β mutant aquaporins but also proteins from lipid metabolism were differentially distributed. These proteins also showed differential phosphorylation patterns in ap-3β and ap-4β compared with wild type. Other proteins, such as receptor kinases were depleted from the AP-3 mutant membrane system, possibly because of degradation after mis-targeting. In AP-4 mutants, membrane fractions were depleted for cytochrome P450 proteins, cell wall proteins and receptor kinases. Analysis of water transport capacity in wild type and mutant mesophyll cells confirmed aquaporins as cargo proteins of AP-3 and AP-4. The combination of organelle density gradients with proteome analysis turned out as a suitable experimental strategy for large-scale analyses of protein trafficking.

  15. Intelligent topical sentiment analysis for the classification of e-learners and their topics of interest.

    Science.gov (United States)

    Ravichandran, M; Kulanthaivel, G; Chellatamilan, T

    2015-01-01

    Every day, huge numbers of instant tweets (messages) are published on Twitter as it is one of the massive social media for e-learners interactions. The options regarding various interesting topics to be studied are discussed among the learners and teachers through the capture of ideal sources in Twitter. The common sentiment behavior towards these topics is received through the massive number of instant messages about them. In this paper, rather than using the opinion polarity of each message relevant to the topic, authors focus on sentence level opinion classification upon using the unsupervised algorithm named bigram item response theory (BIRT). It differs from the traditional classification and document level classification algorithm. The investigation illustrated in this paper is of threefold which are listed as follows: (1) lexicon based sentiment polarity of tweet messages; (2) the bigram cooccurrence relationship using naïve Bayesian; (3) the bigram item response theory (BIRT) on various topics. It has been proposed that a model using item response theory is constructed for topical classification inference. The performance has been improved remarkably using this bigram item response theory when compared with other supervised algorithms. The experiment has been conducted on a real life dataset containing different set of tweets and topics.

  16. Intelligent Topical Sentiment Analysis for the Classification of E-Learners and Their Topics of Interest

    Directory of Open Access Journals (Sweden)

    M. Ravichandran

    2015-01-01

    Full Text Available Every day, huge numbers of instant tweets (messages are published on Twitter as it is one of the massive social media for e-learners interactions. The options regarding various interesting topics to be studied are discussed among the learners and teachers through the capture of ideal sources in Twitter. The common sentiment behavior towards these topics is received through the massive number of instant messages about them. In this paper, rather than using the opinion polarity of each message relevant to the topic, authors focus on sentence level opinion classification upon using the unsupervised algorithm named bigram item response theory (BIRT. It differs from the traditional classification and document level classification algorithm. The investigation illustrated in this paper is of threefold which are listed as follows: (1 lexicon based sentiment polarity of tweet messages; (2 the bigram cooccurrence relationship using naïve Bayesian; (3 the bigram item response theory (BIRT on various topics. It has been proposed that a model using item response theory is constructed for topical classification inference. The performance has been improved remarkably using this bigram item response theory when compared with other supervised algorithms. The experiment has been conducted on a real life dataset containing different set of tweets and topics.

  17. Topic-Focus Articulation of Isotopy

    Directory of Open Access Journals (Sweden)

    Radim Sova

    2012-09-01

    Full Text Available The paper deals with linguistic phenomena at suprasentential level. In particular, it looks into how textual analysis can be enhanced by supplementing the Parisian programme of interpretive semantics, as devised by François Rastier, namely his theory of isotopies, with elementary aspects of topic-focus articulation (TFA, as well as contextual boundness (CB and contextual non-boundness (CN, as elaborated within the Praguian linguistic tradition (V. Mathesius, P. Sgall, E. Hajičová, F. Daneš, J. Firbas, and how the descriptive power of the former can be increased by the latter. In this respect, it is argued that two types of TFA phenomena interact during any process of textual interpretation: those of topic-focus articulation at the level of sentence, conceiving lexical morphs as thematic (T and/or rhematic (R, as well as contextually bound (CB and/or contextually non-bound (CN, and those of topic-focus articulation at the level of isotopy, with each isotopy being conceived as structured around a center (an abstract semantic unit and periphery (a span of concrete utterances. Two types of such interaction are described, each defined by either correlation, or non-correlation of the CB and CN semes at the levels of isotopy and sentence, respectively: thematic-rhematic isotopy, induced by co-occurrence of the CB seme of the center and the CB seme of the periphery; and thematic-rhematic allotopy (i.e. non-isotopy, induced by co-occurrence of the CB seme of the center and the CN seme of the periphery. Since topic-focus isotopies and allotopies can be perceived as members of privative oppositions, a tentative system of such oppositions is presented, based on linguistic analyses of selected European Commission texts drafted in English and their Czech translations. The author’s ultimate intention is to show that the semantic features of topic-focus articulation at the sentential and suprasentential levels are both structurally parallel and

  18. Origin and nature of the aluminium phosphate-sulfate minerals (APS) associated with uranium mineralization in triassic red-beds (Iberian Range, Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Marfil, R.; Iglesia, A. la; Estupinan, J.

    2013-10-01

    This study focuses on the mineralogical and chemical study of an Aluminium-phosphate-sulphate (APS) mineralization that occurs in a classic sequence from the Triassic (Buntsandstein) of the Iberian Range. The deposit is constituted by sandstones, mud stones, and conglomerates with arenaceous matrix, which were deposited in fluvial to shallow-marine environments. In addition to APS minerals, the following diagenetic minerals are present in the classic sequence: quartz, K-feldspar, kaolinite group minerals, illite, Fe-oxides-hydroxides, carbonate-sulphate cement-replacements and secondary uraniferous minerals. APS minerals were identified and characterized by optical microscopy, X-ray diffraction, scanning electron microscopy, and electron microprobe. Microcrystalline APS crystals occur replacing uraniferous minerals, associated with kaolinite, mica and filling pores, in distal fluvial-to-tidal arkoses-subarkoses. Given their Ca, Sr, and Ba contents, the APS minerals can be defined as a solid solution of crandallite- goyacite-gorceixite (0.53 Ca, 0.46 Sr and 0.01 Ba). The chemical composition, low LREE concentration and Sr > S suggest that the APS mineral were originated during the supergene alteration of the Buntsandstein sandstones due to the presence of the mineralizing fluids which causes the development of Ubearing sandstones in a distal alteration area precipitating from partially dissolved and altered detrital minerals. Besides, the occurrence of dickite associated with APS minerals indicates they were precipitated at diagenetic temperatures (higher than 80 degree centigrade), related to the uplifting occurred during the late Cretaceous post-rift thermal stage.(Author)

  19. NVC-422 topical gel for the treatment of impetigo.

    Science.gov (United States)

    Iovino, Susan M; Krantz, Kenneth D; Blanco, Daisy M; Fernández, Josefina A; Ocampo, Naomi; Najafi, Azar; Memarzadeh, Bahram; Celeri, Chris; Debabov, Dmitri; Khosrovi, Behzad; Anderson, Mark

    2011-08-15

    Impetigo is a highly contagious bacterial skin infection affecting children worldwide that is caused by the Gram-positive bacteria Staphylococcus aureus, Streptococcus pyogenes, or both. Staphylococcus species can quickly develop drug resistance rendering mupirocin, fusidic acid, and erythromycin ineffective. Preclinical and clinical studies demonstrated that NVC-422 (N, N-dichloro-2, 2-dimethyltaurine) rapidly kills pathogens without the development of drug resistance. 129 patients with clinically diagnosed impetigo were randomized to three dose groups (0.1, 0.5, or 1.5% NVC-422 topical gel) in a study conducted at 2 centers; 125 patients (97%) had microbiologically confirmed infection. Treatment was administered three times a day (TID) for 7 days to all randomized subjects. Response was measured at the completion of treatment (Day 8) and 1 week post treatment (Day 15) by the Skin Infection Rating Scale (SIRS) and by microbiological response. A total of 120 subjects (96%) completed all 7 days of treatment and were assessed at end of treatment (EOT). Clinical response rate at EOT in the PPC population was excellent in each of the dose groups (84.6%, 87.2%, and 92.3% in the 0.1%, 0.5% and 1.5% dose groups respectively). The majority of the infections were caused by S. aureus, alone (106/125, 85%) of which approximately 10% were MRSA. There were no clinical recurrences in any treatment groups. Treatment-emergent adverse events were seen in 5.4% of the subjects (7/129) and were mild to moderate and resolved. NVC-422 topical gel administered TID was well tolerated, with high rates of clinical and microbiological responses for treating impetigo.

  20. 储氢合金/AP/HTPB推进剂燃烧性能研究%Investigation on Combustion Properties of Hydrogen Storage Alloy/AP/HTPB Propellant

    Institute of Scientific and Technical Information of China (English)

    窦燕蒙; 罗运军; 李国平; 葛震

    2013-01-01

    AI/AP/HTPB propellant and hydrogen storage alloy/AP/HTPB propellant were prepared and their properties were characterized by DSC,PDSC,explosion heat and burning rate test. DSC and PDSC test results show that hydrogen storage alloy has catalysis on condensed phase reactions of AP/HTPB propellant in which main decomposition temperature is decreased by 21.67℃,and 15. 67 ℃ at 0. 1MPa and 5MPa,respectively while condensed phase reaction heat is increased by 105. 97% and 21. 87% separately. Explosion heat test results show that hydrogen storage alloy has catalysis on gas phase reactions of AP/HTPB propellant in which gas phase reaction heat is increased by 4. 74% . Burning rate test results show that hydrogen storage alloy can increase burning rate of AP/HTPB propellant. Further studies indicate that possible correlation exist between burning rate and explosion heat of Al/AP/HTPB propellant and hydrogen storage alloy/AP/HTPB propellant. The burning rate-explosion heat formula is summed up.%制备了Al/AP/HTPB推进剂和储氢合金/AP/HTPB推进剂,并对它们进行了DSC,PDSC,爆热和燃速测试.DSC和PDSC测试结果表明,储氢合金对AP/HTPB推进剂的凝聚相反应有催化作用,在0.1MPa和5MPa下,使其凝聚相主分解温度分别降低21.67℃和15.67℃,凝聚相反应热分别提高105.97%和21.87%;爆热测试结果表明,储氢合金对AP/HTPB推进剂的气相反应有催化作用,使气相反应热提高4.74%;燃速结果表明,储氢合金可以提高AP/HTPB推进剂的燃速.进一步研究表明,A1/AP/HTPB推进剂和储氢合金/AP/HTPB推进剂的燃速与爆热存在一定的相关性.总结出了燃速-爆热关系式.

  1. Constitutive Expression of Sense & Antisense PtAP3, an AP3 Homologue Gene of Populus tomentosa, Affects Growth and Flowering Time in Transgenic Tobacco

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    To analyze the function of PtAP3, an APETALA3 (AP3) homologue gene isolated from Populus tomentosa Carr., the full length sequence (1 797 bp) and a fragment (870 bp) of PtAP3 were fused to a CaMV 35S promoter of pBI121 to generate the sense and antisense constructs of PtAP3. These constructs were transformed into tobacco by Agrobacterium infection of leaf disks and selection on kanamycin medium. Some sense and antisense transgenic tobacco plants were obtained by PCR and Southern blot analysis. Great phenotypic differences in transgenic tobacco plants were observed. Almost all of sense PtAP3 to transgenic tobaccos showed a higher growth rate than those of antisense transformants and a few developed pregnancy earlier than wild type seedlings and antisense transformants under the same conditions.

  2. Overexpression of the soybean GmERF3 gene, an AP2/ERF type transcription factor for increased tolerances to salt, drought, and diseases in transgenic tobacco

    OpenAIRE

    Zhang, Gaiyun; Chen, Ming; Li, Liancheng; Xu, Zhaoshi; Chen, Xueping; Guo, Jiaming; Ma, Youzhi

    2009-01-01

    A new member of the AP2/ERF transcription factor family, GmERF3, was isolated from soybean. Sequence analysis showed that GmERF3 contained an AP2/ERF domain of 58 amino acids and two putative nuclear localization signal (NLS) domains. It belonged to a group IV protein in the ERF (ethylene response factor) subfamily as typified by a conserved N-terminal motif [MCGGAI(I/L)]. Expression of GmERF3 was induced by treatments with high salinity, drought, abscisic acid (ABA), salicylic acid (SA), jas...

  3. SPLIT SKIN GRAFT HARVESTING UNDER LOCAL ANESTHESIA INFILTRATION VERSUS TOPICAL LOCAL ANESTHESIA

    Directory of Open Access Journals (Sweden)

    Shahi

    2014-04-01

    Full Text Available OBJECTIVE: To compare the effectiveness of topical local anesthesia using PRILOX cream versus local anesthesia infiltration using lignocaine and adrenaline in harvesting split skin graft. METHODS: A prospective study of 58 patients requiring split skin graft was carried. One group comprising 29 patients underwent harvesting of split skin graft under topical local anesthesia using PRILOX cream while the other group had local anesthesia infiltration using lignocaine and adrenaline. RESULTS: There were no significant differences between the 2 groups in terms of operating time, per operative pain, post-operative pain and post-operative requirement of analgesia. There was significant difference in time and pain during administration of local anesthesia and patient’s acceptability/ satisfaction with method of anesthesia. CONCLUSION: Topical local anesthesia using PRILOX cream can be used effectively for harvesting of split skin graft and is good alternative to local anesthesia infiltration.

  4. Combination treatment of oral terbinafine with topical terbinafine and 10% urea ointment in hyperkeratotic type tinea pedis.

    Science.gov (United States)

    Shi, Tian-Wei; Zhang, Jiang-An; Zhang, Xian-Wei; Yu, Hong-Xing; Tang, Yong-Bo; Yu, Jian-Bin

    2014-09-01

    Hyperkeratotic-type tinea pedis is chronic and recalcitrant to topical antifungal agents. Some topical antifungal agents are effective; however, long duration of therapy is required, which often reduce the treatment compliance of patients. To seek for short period therapy of hyperkeratotic type tinea pedis, in this study, we observed the efficacy and safety of treatment of topical terbinafine and 10% urea ointment combined oral terbinafine. Participants with hyperkeratotic type tinea pedis were randomly assigned to two groups. Patients in group I were treated with oral terbinafine for 2 weeks and topical terbinafine and 10% urea ointment for 4 weeks, whereas in group II, only the above topical agents were applied for 12 weeks. Clinical improvement rates and fungal eradication rates were compared between the two groups at 24 weeks after the initiation of treatment. The group I had stopped the topical therapy 8 weeks earlier than group II. There were no significant differences in mycological eradication rates and clinical improvement rates between the two groups, besides, no major side effects were noted in both groups. The short combination therapy with oral terbinafine was effective and safe; it should be a valuable option for patients with hyperkeratotic type tinea pedis.

  5. Osmium (VI) complexes of the 3', 5'-dinucleoside monophosphates, ApU and UpA.

    Science.gov (United States)

    Daniel, F B; Behrman, E J

    1976-02-10

    The dinucleoside monophosphates, ApU and UpA, react with potassium osmate (VI) and 2,2'-bipyridyl to form the corresponding oxo-osmium (VI) bipyridyl sugar ester in which the osmate group is bonded to the terminal 2',3'-glycol. Osmium (VIII) tetroxide and 2,2'-bipyridyl react with the dinucleosides to form the corresponding oxo-osmium (VI) bipyridyl heterocyclic esters which result from addition of the tetroxide to the 5,6-double bond of the uracil residue. Although capable of transesterification reactions, these heterocyclic esters are exceptionally stable toward exchange reactions in solution. No apparent exchange was observed after 1 month. This reaction thus seems promising for single-site osmium labeling in polynucleotides.

  6. RAD51AP2, a novel vertebrate- and meiotic-specific protein, sharesa conserved RAD51-interacting C-terminal domain with RAD51AP1/PIR51

    Energy Technology Data Exchange (ETDEWEB)

    Kovalenko, Oleg V.; Wiese, Claudia; Schild, David

    2006-07-25

    Many interacting proteins regulate and/or assist the activities of RAD51, a recombinase which plays a critical role in both DNA repair and meiotic recombination. Yeast two-hybrid screening of a human testis cDNA library revealed a new protein, RAD51AP2 (RAD51 Associated Protein 2), that interacts strongly with RAD51. A full-length cDNA clone predicts a novel vertebrate specific protein of 1159 residues, and the RAD51AP2 transcript was observed only in meiotic tissue (i.e. adult testis and fetal ovary), suggesting a meiotic-specific function for RAD51AP2. In HEK293 cells the interaction of RAD51 with an ectopically-expressed recombinant large fragment of RAD51AP2 requires the C-terminal 57 residues of RAD51AP2. This RAD51-binding region shows 81% homology to the C-terminus of RAD51AP1/PIR51, an otherwise totally unrelated RAD51-binding partner that is ubiquitously expressed. Analyses using truncations and point mutations in both RAD51AP1 and RAD51AP2 demonstrate that these proteins use the same structural motif for RAD51 binding. RAD54 shares some homology with this RAD51-binding motif, but this homologous region plays only an accessory role to the adjacent main RAD51-interacting region, which has been narrowed here to 40 amino acids. A novel protein, RAD51AP2, has been discovered that interacts with RAD51 through a C-terminal motif also present in RAD51AP1.

  7. UVB exposure enhanced benzanthrone-induced inflammatory responses in SKH-1 mouse skin by activating the expression of COX-2 and iNOS through MAP kinases/NF-κB/AP-1 signalling pathways.

    Science.gov (United States)

    Abbas, Sabiya; Alam, Shamshad; Pal, Anu; Kumar, Mahadeo; Singh, Dhirendra; Ansari, Kausar Mahmood

    2016-10-01

    This study was conducted to explore the role of UVB on benzanthrone (BA)-induced skin inflammation and its mechanism/s. SKH-1 hairless mice were topically exposed with BA (25 and 50 mg/kg b.wt) either alone or along with UVB (50 mJ/cm(2)) for 24 h and estimation of ROS, histopathological analysis, myeloperoxidase (MPO) activity, mast cell staining, immunohistochemistry for COX-2 and iNOS as well as western blotting for MAPKs, p-NF-κB, c-jun, c-fos COX-2 and iNOS were carried out. Enhanced ROS generation, increased epidermal thickness, mast cell number, MPO activity, enhanced expression of COX-2 and iNOS, MAPKs, c-jun, c-fos, NF-κB were found in BA either alone or when followed by UVB treatment, compared to the control groups. Expression of COX-2, iNOS and phosphorylation of ERK1/2 were found to be more enhanced in BA and UVB- exposed group compared to BA and UVB only group, while phosphorylation of JNK1/2, p38, NF-κB and expression of c-jun and c-fos were comparable with BA and UVB only groups. In summary, we suggest that UVB exposure enhanced BA-induced SKH-1 skin inflammation possibly via oxidative stress-mediated activation of MAPKs-NF-κB/AP-1 signalling, which subsequently increased the expression of COX-2 and iNOS and led to inflammation in SKH-1 mouse skin.

  8. Comparison Efficacy of Topical Piroxicam Gel and Lidocaine with Intravenous Pethidine in Reducing Pain during ESWL

    Directory of Open Access Journals (Sweden)

    F Mohammad Alibeigi

    2011-06-01

    Full Text Available Introduction & Objective: ESWL is a non-invasive method of breaking stones, using acoustic shock waves. Shock waves cause temporary deep visceral pain and discomfort in entry therefore, administration of sedatives is necessary. The purpose of this study was to compare the effect of topical lidocaine and piroxicam gel with intravenous pethidine in reducing pain during ESWL. Materials & Methods: This clinical trial study was performed on 159 patients who referred to Ayatollah Kashani Hospital in Shahrkord for ESWL in 2009. Patients were randomly divided into three-groups. For the first group, intravenous pethidine (0.5 mg/kg alone was administered. The second group received topical piroxicam, and the third group received topical lidocaine in the area of flank for half an hour before ESWL. During the operation, those patients who had unbearable pain, received another 0.5 mg/kg of pethidine. Data was collected using MC Gill questionnaires and analyzed using the SPSS software, using parametric, nonparametric methods and Dunn's Multiple Comparisons tests. Results: The mean of pain scores in the first group (pethidine was 6.2 ± 6.9 while these scores were 3.2 ± 2 .7 and 3.9 ± 3.1 for the second (piroxicam gel and third group (lidocaine gel respectively. The differences in the mean score of pain was significant in the pethidine group compared to the other groups (P <0.05. The average pethidin consumption were 24 ± 16 mg for the first group (pethidine, 10 ± 13 mg for the second group (piroxicam gel, and 5 ± 9 mg for the third group (lidocaine gel. The mean difference was significant in pethidine treated group in comparison with other two groups (P < 0.05. Conclusion: The use of topical piroxicam or lidocaine reduces pain in patients after ESWL It also reduces the need for sedative drugs.

  9. Refractive changes after scleral buckling surgery Alterações refracionais após retinopexia com explante escleral

    Directory of Open Access Journals (Sweden)

    João Jorge Nassaralla Junior

    2003-10-01

    Full Text Available PURPOSE: A prospective study was conducted to compare the refractive changes after three different types of scleral buckling surgery. METHODS: A total of 100 eyes of 100 patients were divided into three groups according to the type of performed buckling procedure: Group 1, encircling scleral buckling (42 patients; Group 2, encircling with vitrectomy (30 patients; Group 3, encircling with additional segmental buckling (28 patients. Refractive examinations were performed before and at 1, 3 and 6 months after surgery. RESULTS: Changes in spherical equivalent and axial length were significant in all 3 groups. The amount of induced astigmatism was more significant in Group 3. No statistically significant difference was found in the amount of surgically induced changes between Groups 1 and 2, at any postoperative period. CONCLUSIONS: All three types of scleral buckling surgery were found to produce refractive changes. A correlation exists between additional segments and extent of refractive changes.OBJETIVO: Estudo prospectivo foi realizado para comparar as alterações refracionais encontradas após três diferentes tipos de cirurgia com explante escleral. MÉTODOS: Cem olhos de 100 pacientes foram divididos em 3 grupos de acordo com o tipo de cerclagem retiniana realizada: Grupo 1, cerclagem simples (42 pacientes; Grupo 2, cerclagem associada a vitrectomia (30 pacientes; Grupo 3, cerclagem associado a implante escleral segmentar (28 pacientes. Exames refracionais foram realizados antes e após 1, 3 e 6 meses da cirurgia. RESULTADOS: A indução de astigmatismo foi maior no Grupo 3. Alterações no equivalente esférico e no diâmetro ântero-posterior foram significantes nos 3 grupos após a cirurgia. Nenhuma diferença estaticamente significativa foi encontrada nas alterações induzidas pela cirurgia entre os grupos 1 e 2, em nenhum momento após a cirurgia. CONCLUSÃO: Os três tipos de retinopexia causam alteração refracional. Existe correla

  10. Opposite effects of the same drug: reversal of topical analgesia by nocebo information.

    Science.gov (United States)

    Aslaksen, Per Matti; Zwarg, Maria Lorentze; Eilertsen, Hans-Ingvald Hage; Gorecka, Marta Maria; Bjørkedal, Espen

    2015-01-01

    Several studies have shown that psychological factors such as learning, expectation, and emotions can affect pharmacological treatment and shape both favorable and adverse effects of drugs. This study investigated whether nocebo information provided during administration of an analgesic cream could reverse topical analgesia to hyperalgesia. Furthermore, we tested whether nocebo effects were mediated by negative emotional activation. A total of 142 healthy volunteers (73 women) were randomized into 6 groups. A topical analgesic cream (Emla) was administered together with suggestions of analgesia in 1 group, whereas another group received Emla with suggestions of hyperalgesia. Two other groups received a placebo cream together with the same information as the groups receiving Emla. A fifth group received Emla with no specific information about the effect, and the sixth group received no treatment but the same pain induction as the other groups. Heat pain stimulation (48°C) was administered during a pretest and 2 posttests. Pain was continuously recorded during stimulation, and measures of subjective stress and blood pressure were obtained before the pretest, after the application of cream, and after the posttests. The results revealed that pain was significantly lower in the group receiving Emla with positive information and highest in the groups receiving suggestions of hyperalgesia, regardless of whether Emla or the placebo was administered. Mediation analyses showed that stress and blood pressure mediated hyperalgesia after nocebo suggestions. These results suggest that nocebo information can reverse topical analgesia and that emotional factors can explain a significant proportion of variance in nocebo hyperalgesia.

  11. A Prospective, Open-label Study to Compare the Efficacy and the Safety of Topical Loteprednol Etabonate and Topical Flurbiprofen Sodium in Patients with Post-Operative Inflammation after Cataract Extraction

    Science.gov (United States)

    Bannale, Sheshidhar G.; Pundarikaksha, H.P.; Sowbhagya, H.N.

    2012-01-01

    Purpose To study the effect of the topical Non-Steroidal Anti Inflammatory Drug (NSAID), Flurbiprofen 0.03%, as an alternative to the topical steroids for the postoperative control of inflammation in cataract surgeries. Methods The effect of the topical NSAID, flurbiprofen sodium 0.03%, was studied and compared with that of the topical steroid – Loteprednol etabonate 0.5% suspension (as eye drops) in a prospective, open labelled study. Both the groups (20 patients each) were similar in the baseline parameters. The postoperative inflammatory response following the standard, small incision, extra capsular cataract extraction was assessed in both the groups for 28 post-operative days. The parameters which were considered for the study were conjunctival hyperaemia, ciliary congestion, corneal oedema, cells in the anterior chamber, aqueous flare and ocular pain. The severity of the postoperative inflammatory responses for both the drugs was graded on the post-operative days 1, 7, 14, 21 and 28 and it was statistically analyzed. Results The 2 groups did not differ statistically in the effect of the treatment for any of the variables, which included aqueous cells, flare, ciliary congestion and conjunctival congestion (p< 0.001). Both the drugs were well tolerated and no severe adverse Drug Reactions (ADRs) were caused by the topical NSAID and the topical steroid. Conclusion The topical NSAID, Flurbiprofen, is as effective as the topical corticosteroid, Loteprednol and it can be used as an alternative in the routine postoperative treatment following uncomplicated cataract surgeries. PMID:23285440

  12. Social group utility maximization

    CERN Document Server

    Gong, Xiaowen; Yang, Lei; Zhang, Junshan

    2014-01-01

    This SpringerBrief explains how to leverage mobile users' social relationships to improve the interactions of mobile devices in mobile networks. It develops a social group utility maximization (SGUM) framework that captures diverse social ties of mobile users and diverse physical coupling of mobile devices. Key topics include random access control, power control, spectrum access, and location privacy.This brief also investigates SGUM-based power control game and random access control game, for which it establishes the socially-aware Nash equilibrium (SNE). It then examines the critical SGUM-b

  13. Origin and nature of the aluminium phosphate-sulfate minerals (APS associated with uranium mineralization in triassic red-beds (Iberian Range, Spain

    Directory of Open Access Journals (Sweden)

    Marfil, R.

    2013-06-01

    Full Text Available This study focuses on the mineralogical and chemical study of an Aluminium–phosphate–sulphate (APS mineralization that occurs in a clastic sequence from the Triassic (Buntsandstein of the Iberian Range. The deposit is constituted by sandstones, mudstones, and conglomerates with arenaceous matrix, which were deposited in fluvial to shallow-marine environments. In addition to APS minerals, the following diagenetic minerals are present in the clastic sequence: quartz, K-feldspar, kaolinite group minerals, illite, Fe-oxides-hidroxides, carbonate-sulphate cement-replacements and secondary uraniferous minerals. APS minerals were identified and characterized by optical microscopy, X-ray diffraction, scanning electron microscopy, and electron microprobe. Microcrystalline APS crystals occur replacing uraniferous minerals, associated with kaolinite, mica and filling pores, in distal fluvial-to-tidal arkoses-subarkoses. Given their Ca, Sr, and Ba contents, the APS minerals can be defined as a solid solution of crandallite-goyacite-gorceixite (0.53 Ca, 0.46 Sr and 0.01 Ba. The chemical composition, low LREE concentration and Sr > S suggest that the APS mineral were originated during the supergene alteration of the Buntsandstein sandstones due to the presence of the mineralizing fluids which causes the development of U-bearing sandstones in a distal alteration area precipitating from partially dissolved and altered detrital minerals. Besides, the occurrence of dickite associated with APS minerals indicates they were precipitated at diagenetic temperatures (higher than 80ºC, related to the uplifting occurred during the late Cretaceous post-rift thermal stage.Este trabajo se centra en el estudio de los minerales fosfato-sulfato alumínicos (APS que se producenen una secuencia clástica del Triásico (Buntsandstein de la Cordillera Ibérica. El depósito está constituido por areniscas, lutitas y conglomerados con matriz arenosa, que fueron depositados en

  14. Group X

    Energy Technology Data Exchange (ETDEWEB)

    Fields, Susannah

    2007-08-16

    This project is currently under contract for research through the Department of Homeland Security until 2011. The group I was responsible for studying has to remain confidential so as not to affect the current project. All dates, reference links and authors, and other distinguishing characteristics of the original group have been removed from this report. All references to the name of this group or the individual splinter groups has been changed to 'Group X'. I have been collecting texts from a variety of sources intended for the use of recruiting and radicalizing members for Group X splinter groups for the purpose of researching the motivation and intent of leaders of those groups and their influence over the likelihood of group radicalization. This work included visiting many Group X websites to find information on splinter group leaders and finding their statements to new and old members. This proved difficult because the splinter groups of Group X are united in beliefs, but differ in public opinion. They are eager to tear each other down, prove their superiority, and yet remain anonymous. After a few weeks of intense searching, a list of eight recruiting texts and eight radicalizing texts from a variety of Group X leaders were compiled.

  15. Diclofenac epolamine topical patch relieves pain associated with ankle sprain

    Directory of Open Access Journals (Sweden)

    David R Lionberger

    2011-03-01

    Full Text Available David R Lionberger1, Eric Joussellin2, Arturo Lanzarotti3, Jillmarie Yanchick4, Merrell Magelli5 1Southwest Orthopedic Group, LLP, Houston, Texas, USA; 2Institut National du Sport, Paris, France; 3Institut Biochimique SA, Pambionoranco, Switzerland; 4Alpharma Pharmaceuticals LLC, a wholly owned subsidiary of King Pharmaceuticals®, Inc, Piscataway, New Jersey, USA; 5GTx, Inc, Memphis, Tennessee, USABackground: Sports-related injuries, such as sprains and strains, commonly occur during exercise and athletic events. Current therapy includes nonsteroidal anti-inflammatory drugs (NSAIDs, which have a high incidence of upper gastrointestinal side effects. The present study assessed the efficacy and safety of the diclofenac epolamine topical patch (DETP, 1.3%, a topical NSAID for the treatment of acute minor sprains and strains.Methods: This multicenter, randomized, placebo-controlled clinical study enrolled adult patients (n = 134 with acute ankle pain (due to a minor sprain occurring less than 48 hours prior to entering the study. Patients were treated with either the DETP or a placebo topical patch daily for seven days. Pain intensity was evaluated during the first six hours after application of the patch, and on treatment days 1, 2, 3, and 7.Results: Patients treated with the DETP experienced a significantly greater reduction in pain associated with their ankle injury compared with placebo, beginning four hours after the first patch application (P = 0.02. The DETP was well tolerated and was comparable with placebo in terms of safety.Conclusion: Overall, the results of this study demonstrate that the DETP is an effective analgesic for local treatment of pain in mild acute ankle sprain.Keywords: soft tissue injury, acute pain, visual analog scale, efficacy, tolerability 

  16. Topical Application of Fingolimod Perturbs Cutaneous Inflammation.

    Science.gov (United States)

    Sun, Wai Y; Dimasi, David P; Pitman, Melissa R; Zhuang, YiZhong; Heddle, Robert; Pitson, Stuart M; Grimbaldeston, Michele A; Bonder, Claudine S

    2016-05-01

    The prevalence of allergies, including rhinitis, eczema, and anaphylaxis, is rising dramatically worldwide. This increase is especially problematic in children who bear the greatest burden of this rising trend. Increasing evidence identifies neutrophils as primary perpetrators of the more severe and difficult to manage forms of inflammation. A newly recognized mechanism by which neutrophils are recruited during the early phase of histamine-induced inflammation involves the sphingosine kinase (SK)/sphingosine-1-phosphate axis. This study examines whether topical application of fingolimod, an established SK/sphingosine-1-phosphate antagonist already in clinical use to treat multiple sclerosis, may be repurposed to treat cutaneous inflammation. Using two mouse models of ear skin inflammation (histamine- and IgE-mediated passive cutaneous anaphylaxis) we topically applied fingolimod prophylactically, as well as after establishment of the inflammatory response, and examined ear swelling, SK activity, vascular permeability, leukocyte recruitment, and production of proinflammatory mediators. The present study reveals that when applied topically, fingolimod attenuates both immediate and late-phase responses to histamine with reduced extravasation of fluid, SK-1 activity, proinflammatory cytokine and chemokine production, and neutrophil influx and prevents ear swelling. Intravital microscopy demonstrates that histamine-induced neutrophil rolling and adhesion to the postcapillary venules in the mouse ears is significantly attenuated even after 24 h. More importantly, these effects are achievable even once inflammation is established. Translation into humans was also accomplished with epicutaneous application of fingolimod resolving histamine-induced and allergen-induced inflammatory reactions in forearm skin. Overall, this study demonstrates, to our knowledge for the first time, that fingolimod may be repurposed to treat cutaneous inflammation.

  17. Corneal Neurotoxicity Due to Topical Benzalkonium Chloride

    Science.gov (United States)

    Sarkar, Joy; Chaudhary, Shweta; Namavari, Abed; Ozturk, Okan; Chang, Jin-Hong; Yco, Lisette; Sonawane, Snehal; Khanolkar, Vishakha; Hallak, Joelle; Jain, Sandeep

    2012-01-01

    Purpose. The aim of this study was to determine and characterize the effect of topical application of benzalkonium chloride (BAK) on corneal nerves in vivo and in vitro. Methods. Thy1-YFP+ neurofluorescent mouse eyes were treated topically with vehicle or BAK (0.01% or 0.1%). Wide-field stereofluorescence microscopy was performed to sequentially image the treated corneas in vivo every week for 4 weeks, and changes in stromal nerve fiber density (NFD) and aqueous tear production were determined. Whole-mount immunofluorescence staining of corneas was performed with antibodies to axonopathy marker SMI-32. Western immunoblot analyses were performed on trigeminal ganglion and corneal lysates to determine abundance of proteins associated with neurotoxicity and regeneration. Compartmental culture of trigeminal ganglion neurons was performed in Campenot devices to determine whether BAK affects neurite outgrowth. Results. BAK-treated corneas exhibited significantly reduced NFD and aqueous tear production, and increased inflammatory cell infiltration and fluorescein staining at 1 week (P < 0.05). These changes were most significant after 0.1% BAK treatment. The extent of inflammatory cell infiltration in the cornea showed a significant negative correlation with NFD. Sequential in vivo imaging of corneas showed two forms of BAK-induced neurotoxicity: reversible neurotoxicity characterized by axonopathy and recovery, and irreversible neurotoxicity characterized by nerve degeneration and regeneration. Increased abundance of beta III tubulin in corneal lysates confirmed regeneration. A dose-related significant reduction in neurites occurred after BAK addition to compartmental cultures of dissociated trigeminal ganglion cells. Although both BAK doses (0.0001% and 0.001%) reduced nerve fiber length, the reduction was significantly more with the higher dose (P < 0.001). Conclusion. Topical application of BAK to the eye causes corneal neurotoxicity, inflammation, and reduced aqueous

  18. Topically applied ceramide accumulates in skin glyphs

    Directory of Open Access Journals (Sweden)

    Zhang Q

    2015-07-01

    Full Text Available Qihong Zhang,1 Carol R Flach,1 Richard Mendelsohn,1 Guangru Mao,2 Apostolos Pappas,2 M Catherine Mack,2 Russel M Walters,2 Michael D Southall2 1Department of Chemistry, Rutgers University, Newark, 2Johnson & Johnson Consumer Companies, Inc., Skillman, NJ, USAAbstract: Ceramides (CERs, structural components of the stratum corneum (SC, impart essential barrier properties to this thin outer layer of the epidermis. Variations in CER species within this layer have been linked to several skin diseases. A recent proliferation of CER-containing topical skin-care products warrants the elucidation of CER penetration profiles in both healthy and diseased skin. In the current study, the spatial distributions of CER concentration profiles, following topical application of two species of CER, were tracked using infrared imaging. Suspensions of single-chain perdeuterated sphingosine and phytosphingosine CER in oleic acid were applied, in separate experiments, to the surface of healthy intact ex vivo human skin using Franz diffusion cells. Following either a 24- or 48-hour incubation period at 34°C, infrared images were acquired from microtomed skin sections. Both CER species accumulated in glyph regions of the skin and penetrated into the SC, to a limited extent, only in these regions. The concentration profiles observed herein were independent of the CER species and incubation time utilized in the study. As a result, a very heterogeneous, sparse, spatial distribution of CERs in the SC was revealed. In contrast, oleic acid was found to be fairly homogeneously distributed throughout the SC and viable epidermis, albeit at lower concentrations in the latter. A more uniform, lateral distribution of CERs in the SC would likely be important for barrier efficacy or enhancement.Keywords: stratum corneum, infrared imaging, topical delivery, oleic acid

  19. Traditional Persian topical medications for gastrointestinal diseases

    Directory of Open Access Journals (Sweden)

    Laleh Dehghani Tafti

    2017-03-01

    Full Text Available Drug delivery across the skin is used for several millennia to ease gastrointestinal (GI ailments in Traditional Persian Medicine (TPM. TPM topical remedies are generally being applied on the stomach, lower abdomen, lower back and liver to alleviate GI illnesses such as dyspepsia, gastritis, GI ulcers, inflammatory bowel disease, intestinal worms and infections. The aim of the present study is to survey the topical GI remedies and plant species used as ingredients for these remedies in TPM. In addition, pharmacological activities of the mentioned plants have been discussed. For this, we searched major TPM textbooks to find plants used to cure GI problems in topical use. Additionally, scientific databases were searched to obtain pharmacological data supporting the use of TPM plants in GI diseases. Rosa × damascena, Pistacia lentiscus, Malus domestica, Olea europaea and Artemisia absinthium are among the most frequently mentioned ingredients of TPM remedies. β-asarone, amygdalin, boswellic acids, guggulsterone, crocin, crocetin, isomasticadienolic acid, and cyclotides are the most important phytochemicals present in TPM plants with GI-protective activities. Pharmacological studies demonstrated GI activities for TPM plants supporting their extensive traditional use. These plants play pivotal role in alleviating GI disorders through exhibiting numerous activities including antispasmodic, anti-ulcer, anti-secretory, anti-colitis, anti-diarrheal, antibacterial and anthelmintic properties. Several mechanisms underlie these activities including the alleviation of oxidative stress, exhibiting cytoprotective activity, down-regulation of the inflammatory cytokines, suppression of the cellular signaling pathways of inflammatory responses, improving re-epithelialization and angiogenesis, down-regulation of anti-angiogenic factors, blocking activity of acetylcholine, etc.

  20. SUBSTANCES AND CHEMICAL REACTIONS. TOPICS OF THE UNIVERSITARY ENTRY COURSE TREATED WITH DIFFERENT RESOURCES

    OpenAIRE

    René O. Güemes; Adriana E. Ortolani; María del C. Tiburzi; Falicoff, Claudia B.; José M. Raffaelli; Odetti, Héctor S.

    2011-01-01

    This research is focused to detect and compare difficulties presented in the comprehension of the topics "Substances" and "Chemical Reactions" in incoming pupils to the National University of the Litoral (Santa Fe, Argentina) implementing two different didactic strategies during the dictation of the "Course of Introduction to Chemistry". We worked with two groups of students; one group used a textbook, while the other worked with multimedia material in a computer classroom. Both groups were e...

  1. EFFICIENCY OF TOPICAL PHENYTOIN ON HEALING IN DIABETIC ULCER: A RANDOMIZED CONTROL TRIAL

    Directory of Open Access Journals (Sweden)

    Jayaraman

    2016-03-01

    Full Text Available Diabetic foot ulcers are the major complication of diabetes mellitus; 15% of diabetic people suffer from foot ulcers. Phenytoin is used as a topical application in many studies on diabetic foot ulcers and it is found to stimulate the formation of granulation tissue as early as 2-7 days.1 OBJECTIVE The objective of this study was to compare the efficiency of topical phenytoin application on healing in diabetic foot ulcer with control group using conventional wound dressing. METHOD Totally, 100 patients with diabetic foot ulcer attending Thanjavur Government Medical College Hospital are randomized into two groups, assigned regular saline and betadine dressing for the control group. 2 and phenytoin powder application for the study group. Patient with vascular impairment or uncontrolled diabetes are not included. Both study and control group are compared in terms of number of days required for healing, rate of granulations tissue formation. Rate of reduction in mean ulcer surface area. Quality of graft bed. Skin graft take up and serial culture and sensitivity of wound swabs to assess the effect of topical phenytoin on bacterial load. RESULTS The rate of granulation tissue formation was assessed at the end of 2 weeks; 81 to 90% granulation was seen in study group. In study group, 84% cases graft take up was good and 70% in the control group. Graft take up was 72.4% and 58.43% respectively. Hospital stay 21 days in study group and 45 days in control group. CONCLUSION In our present study it was concluded that the rate of granulation tissue formation, overall graft survival and patient compliance was better in topical phenytoin dressing group. 3 as compared to conventional dressing group.4

  2. Preface to Special Topic: Marine Renewable Energy

    Energy Technology Data Exchange (ETDEWEB)

    Pinto, F. T.; Iglesias, G.; Santos, P. R.; Deng, Zhiqun

    2015-12-30

    Marine renewable energy (MRE) is generates from waves, currents, tides, and thermal resources in the ocean. MRE has been identified as a potential commercial-scale source of renewable energy. This special topic presents a compilation of works selected from the 3rd IAHR Europe Congress, held in Porto, Portugal, in 2014. It covers different subjects relevant to MRE, including resource assessment, marine energy sector policies, energy source comparisons based on levelized cost, proof-of-concept and new-technology development for wave and tidal energy exploitation, and assessment of possible inference between wave energy converters (WEC).

  3. Recent topics in differential and analytic geometry

    CERN Document Server

    Ochiai, T

    1990-01-01

    Advanced Studies in Pure Mathematics, Volume 18-I: Recent Topics in Differential and Analytic Geometry presents the developments in the field of analytical and differential geometry. This book provides some generalities about bounded symmetric domains.Organized into two parts encompassing 12 chapters, this volume begins with an overview of harmonic mappings and holomorphic foliations. This text then discusses the global structures of a compact Kähler manifold that is locally decomposable as an isometric product of Ricci-positive, Ricci-negative, and Ricci-flat parts. Other chapters con

  4. TOPICAL REVIEW: Nanoscience and nanotechnology in Europe

    Science.gov (United States)

    Tolles, W. M.

    1996-06-01

    During six months from April to September 1994, the author visited 42 laboratories in eight different European countries involved with research in nanostructures. The scientific thrusts point the way to new methods and properties of matter that may provide useful information. The potential applications of research in this field are likely to be found in information technology, sensors, and new materials, replete with the implications for many industrial interests. It is a suitable topic for the recently introduced `focused technical assessment' activities of the Office of Naval Research Europe where the coordination for this effort was focused. Overviews of multidisciplinary efforts in fields of physics, electrical engineering, materials, chemistry, and biology are presented.

  5. Update on key topics in adolescent gynecology.

    Science.gov (United States)

    Fisher, Martin; Lara-Torre, Eduardo

    2013-02-01

    AM:STARs, the Adolescent Medicine State of the Art Reviews series published by the American Academy of Pediatrics, devoted its April 2012 issue to the topic of Adolescent Gynecology. Developed in conjunction with the North American Society for Pediatric and Adolescent Gynecology (NASPAG), the issue consists of twelve articles, written mostly by members of NASPAG. As editors of the issue, we present in this review for the Journal of Pediatric and Adolescent Gynecology (JPAG) a synopsis of the most salient concepts presented in those 12 articles. This review of reviews is intended to be an update on the "state of the art" in adolescent gynecology.

  6. Topics in multivariate approximation and interpolation

    CERN Document Server

    Jetter, Kurt

    2005-01-01

    This book is a collection of eleven articles, written by leading experts and dealing with special topics in Multivariate Approximation and Interpolation. The material discussed here has far-reaching applications in many areas of Applied Mathematics, such as in Computer Aided Geometric Design, in Mathematical Modelling, in Signal and Image Processing and in Machine Learning, to mention a few. The book aims at giving a comprehensive information leading the reader from the fundamental notions and results of each field to the forefront of research. It is an ideal and up-to-date introduction for gr

  7. Special design topics in digital wideband receivers

    CERN Document Server

    Tsui, James B Y

    2009-01-01

    Offering engineers a thorough examination of special, more advanced aspects of digital wideband receiver design, this practical book builds on fundamental resources on the topic, helping you gain a more comprehensive understanding of the subject. This in-depth volume presents a detailed look at a complete receiver design, including the encoder. Moreover, it discusses the detection of exotic signals and provides authoritative guidance on designing receivers used in electronic warfare. From frequency modulation and biphase shifting keys, to parameter encoders in electronic warfare receivers and

  8. Topical rapamycin (sirolimus) for facial angiofibromas.

    Science.gov (United States)

    Madke, Bhushan

    2013-01-01

    Rapamycin (sirolimus) is a fungal fermentation product that inhibits the proper functioning of a serine/threonine protein kinase in mammalian cells eponymously named mammalian target of rapamycin, or mTOR. Rapamycin is a novel class of anticancer and immunosuppressant drugs targeting the proteins at molecular level. Rapamycin (sirolimus) is routinely incorporated in drug-eluting stents used for cardiac angioplasty. In recent years, rapamycin was found to be efficacious in managing the symptom complex of tuberous sclerosis, i.e. renal angiomyolipoma, giant cell astrocytoma and pulmonary lymphangiomyomatosis. Various investigators have also proved that topically applied rapamycin causes regression of facial angiofibromas, giving better cosmetic results.

  9. Topics in radiation dosimetry radiation dosimetry

    CERN Document Server

    1972-01-01

    Radiation Dosimetry, Supplement 1: Topics in Radiation Dosimetry covers instruments and techniques in dealing with special dosimetry problems. The book discusses thermoluminescence dosimetry in archeological dating; dosimetric applications of track etching; vacuum chambers of radiation measurement. The text also describes wall-less detectors in microdosimetry; dosimetry of low-energy X-rays; and the theory and general applicability of the gamma-ray theory of track effects to various systems. Dose equivalent determinations in neutron fields by means of moderator techniques; as well as developm

  10. Rheology of the lithosphere: selected topics.

    Science.gov (United States)

    Kirby, S.H.; Kronenberg, A.K.

    1987-01-01

    Reviews recent results concerning the rheology of the lithosphere with special attention to the following topics: 1) the flexure of the oceanic lithosphere, 2) deformation of the continental lithosphere resulting from vertical surface loads and forces applied at plate margins, 3) the rheological stratification of the continents, 4) strain localization and shear zone development, and 5) strain-induced crystallographic preferred orientations and anisotropies in body-wave velocities. We conclude with a section citing the 1983-1986 rock mechanics literature by category.-Authors

  11. Purely URL-based Topic Classification

    OpenAIRE

    Baykan, Eda; Henzinger, Monika R.; Marian, Ludmila; Weber, Ingmar

    2009-01-01

    Given only the URL of a web page, can we identify its topic? This is the question that we examine in this paper. Usually, web pages are classified using their content, but a URL-only classifier is preferable, (i) when speed is crucial, (ii) to enable content filtering before an (objectionable) web page is downloaded, (iii) when a page's content is hidden in images, (iv) to annotate hyperlinks in a personalized web browser, without fetching the target page, and (v) when a focused crawler...

  12. Quantum mechanics new approaches to selected topics

    CERN Document Server

    Lipkin, Harry J

    2007-01-01

    Acclaimed as ""excellent"" (Nature) and ""very original and refreshing"" (Physics Today), this collection of self-contained studies is geared toward advanced undergraduates and graduate students. Its broad selection of topics includes the Mössbauer effect, many-body quantum mechanics, scattering theory, Feynman diagrams, and relativistic quantum mechanics.Author Harry J. Lipkin, a well-known teacher at Israel's Weizmann Institute, takes an unusual approach by introducing many interesting physical problems and mathematical techniques at a much earlier point than in conventional texts. This meth

  13. Shock wave dynamics derivatives and related topics

    CERN Document Server

    Emanuel, George

    2012-01-01

    Working knowledge of the relations of various quantities and their derivatives across a shock wave is useful for any advanced research involving shock waves. Although these relations can be derived in principle by any diligent student of the subject, the derivations are often not trivial, and once derived, neither the approach nor the result can be confidently verified. Comprehensive and analytical, Shock Wave Dynamics: Derivatives and Related Topics includes not only the final results but also the methods, which are of great practical value as examples of mathematical procedure in this field.

  14. Effectiveness of Groups in the Schools

    Science.gov (United States)

    Gerrity, Deborah A.; DeLucia-Waack, Janice L.

    2007-01-01

    This article reviews the current literature, specifically meta-analytic research, on the effectiveness of psychoeducational and counseling groups in the schools. Topics for such groups include: eating disorders, anger management/bullying, child sexual abuse prevention, pregnancy prevention, and social competency. There is support for groups in the…

  15. Issues in the Training of Group Workers.

    Science.gov (United States)

    Bertcher, Harvey, Ed.

    1981-01-01

    Various perspectives on the training of group workers are presented in nine articles. Topics considered include: (1) problems in training hospital group leaders; (2) training leaders in a behavorial-cognitive approach; (3) micro-counseling and teacher-less approaches to training; and (4) the impact of race and gender on group work. (RC)

  16. AP fuels and the potential of renewable diesel

    Energy Technology Data Exchange (ETDEWEB)

    Berkley, Mark; Seifkar, Navid; O' Shea, Michael; Peters, Christopher

    2010-09-15

    The decrease in demand for forestry products has been detrimental to the Province of Quebec's industrial base. With increasing energy security and environmental concerns the promotion of innovative technologies is adamant. AP Fuels Inc. has undertaken the development of a biomass-to-liquids facility proposed herein as a hybrid design, combining biomass and natural gas capable of producing diesel and other liquid fuels. The facility would consume 2,200,000 tonnewet per year of biomass and produce 10,600 bbl/day of liquid fuels. Forestry-derived F-T fuels have notable advantages including: improved performance; ultra-low sulphur content; reduced emissions, particulates and fouling; and production of fewer by-products.

  17. Aerosol Polarimetry Sensor (APS): Design Summary, Performance and Potential Modifications

    Science.gov (United States)

    Cairns, Brian

    2014-01-01

    APS is a mature design that has already been built and has a TRL of 7. Algorithmic and retrieval capabilities continue to improve and make better and more sophisticated used of the data. Adjoint solutions, both in one dimensional and three dimensional are computationally efficient and should be the preferred implementation for the calculation of Jacobians (one dimensional), or cost-function gradients (three dimensional). Adjoint solutions necessarily provide resolution of internal fields and simplify incorporation of active measurements in retrievals, which will be necessary for a future ACE mission. Its best to test these capabilities when you know the answer: OSSEs that are well constrained observationally provide the best place to test future multi-instrument platform capabilities and ensure capabilities will meet scientific needs.

  18. Towards a theory of rapidly oscillating Ap stars

    CERN Document Server

    Gough, Douglas

    2011-01-01

    Peculiar A stars are so named because they exhibit abundance peculiarities in their atmospheres. It is believed that these arise as a result of differentiation of chemical species in large magnetic spots in which convective mixing is inhibited: there might be just two antipodal spots, whose axis is inclined to the axis of rotation. Many of the Ap stars that are rotating slowly also pulsate, with periods substantially shorter than the period of the fundamental radial mode. The pulsations appear to be nonradial, but axisymmetric, with their common axis usually aligned with the axis of the spots. In this lecture I shall first discuss the magnetic suppression of convection in the spots, and then I shall try to explain the pulsation phenomenon, reviewing some of the suggestions that have been made to explain the alignment and the excitation mechanism, and finally raising some issues that need to be addressed.

  19. Fabrication and Testing of Deflecting Cavities for APS

    Energy Technology Data Exchange (ETDEWEB)

    Mammosser, John; Wang, Haipeng; Rimmer, Robert; Jim, Henry; Katherine, Wilson; Dhakal, Pashupati; Ali, Nassiri; Jim, Kerby; Jeremiah, Holzbauer; Genfa, Wu; Joel, Fuerst; Yawei, Yang; Zenghai, Li

    2013-09-01

    Jefferson Lab (Newport News, Virginia) in collaboration with Argonne National Laboratory (Argonne, IL) has fabricated and tested four first article, 2.8 GHz, deflecting SRF cavities, for Argonne's Short-Pulse X-ray (SPX) project. These cavities are unique in many ways including the fabrication techniques in which the cavity cell and waveguides were fabricated. These cavity subcomponents were milled from bulk large grain niobium ingot material directly from 3D CAD files. No forming of sub components was used with the exception of the beam-pipes. The challenging cavity and helium vessel design and fabrication results from the stringent RF performance requirements required by the project and operation in the APS ring. Production challenges and fabrication techniques as well as testing results will be discussed in this paper.

  20. Aneurisma gigante del apéndice auricular izquierdo

    OpenAIRE

    Francisco L. Moreno-Martínez; González Alfonso,Osvaldo; Lagomasino Hidalgo,Álvaro L; González Díaz,Alejandro; Oliva Céspedes,Carlos; López Bernal,Omaida J

    2006-01-01

    Los aneurismas de la aurícula izquierda son raros y pueden ser congénitos o adquiridos. Los que interesan la pared libre o el apéndice auricular son entidades más raras aún, hasta 2002 sólo existían 49 casos reportados en la aurícula izquierda y 8 en la derecha. La manifestación clínica más frecuente es la aparición de arritmias auriculares incesantes o recurrentes y pueden presentarse embolias sistémicas que pueden dar al traste con la vida del paciente. Presentamos el caso de una paciente a...