WorldWideScience

Sample records for aps topical group

  1. History of the APS Topical Group on Shock Compression of Condensed Matter

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-10-19

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wavehigh pressure sessions at APS general meetings in even numbered years.

  2. The History of the APS Shock Compression of Condensed Matter Topical Group

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-05-02

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wave/high pressure sessions at APS general meetings in even numbered years.

  3. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Spring 1997

    CERN Document Server

    Pullin, J

    1997-01-01

    Contents: News: April 1997 Joint APS/AAPT Meeting, by Beverly Berger TGG News, by Jim Isenberg Report from NSF, by David Berley We hear that..., by Jorge Pullin Research briefs: GR in GPS, by Neil Ashby What happens near the innermost stable circular orbit? by Doug Eardley Conference reports: Journees Relativistes 96, by D. Brill, M. Heusler, G. Lavrelashvili TAMA Workshop, by Peter Saulson Midwest gravity meeting, by Comer Duncan OMNI-1 Workshop by N.S. Magalhaes, W. F. Velloso Jr and O.D. Aguiar Chandra Symposium, by Robert Wald Penn State Meeting, by Lee Smolin Aspen Winter Conference, by Syd Meshkov

  4. Topics in cohomology of groups

    CERN Document Server

    Lang, Serge

    1996-01-01

    The book is a mostly translated reprint of a report on cohomology of groups from the 1950s and 1960s, originally written as background for the Artin-Tate notes on class field theory, following the cohomological approach. This report was first published (in French) by Benjamin. For this new English edition, the author added Tate's local duality, written up from letters which John Tate sent to Lang in 1958 - 1959. Except for this last item, which requires more substantial background in algebraic geometry and especially abelian varieties, the rest of the book is basically elementary, depending only on standard homological algebra at the level of first year graduate students.

  5. Factorizations of groups and related topics

    Institute of Scientific and Technical Information of China (English)

    AMBERG; Bernhard; KAZARIN; Lev

    2009-01-01

    This is a survey of some recent progress in the theory of groups with factorizations. Some of the methods can be used to obtain information about finite groups in general, nilpotent algebras and nearrings.

  6. Expansion and Functional Divergence of AP2 Group Genes in Spermatophytes Determined by Molecular Evolution and Arabidopsis Mutant Analysis

    Science.gov (United States)

    Wang, Pengkai; Cheng, Tielong; Lu, Mengzhu; Liu, Guangxin; Li, Meiping; Shi, Jisen; Lu, Ye; Laux, Thomas; Chen, Jinhui

    2016-01-01

    The APETALA2 (AP2) genes represent the AP2 group within a large group of DNA-binding proteins called AP2/EREBP. The AP2 gene is functional and necessary for flower development, stem cell maintenance, and seed development, whereas the other members of AP2 group redundantly affect flowering time. Here we study the phylogeny of AP2 group genes in spermatophytes. Spermatophyte AP2 group genes can be classified into AP2 and TOE types, six clades, and we found that the AP2 group homologs in gymnosperms belong to the AP2 type, whereas TOE types are absent, which indicates the AP2 type gene are more ancient and TOE type was split out of AP2 type and losing the major function. In Brassicaceae, the expansion of AP2 and TOE type lead to the gene number of AP2 group were up to six. Purifying selection appears to have been the primary driving force of spermatophyte AP2 group evolution, although positive selection occurred in the AP2 clade. The transition from exon to intron of AtAP2 in Arabidopsis mutant leads to the loss of gene function and the same situation was found in AtTOE2. Combining this evolutionary analysis and published research, the results suggest that typical AP2 group genes may first appear in gymnosperms and diverged in angiosperms, following expansion of group members and functional differentiation. In angiosperms, AP2 genes (AP2 clade) inherited key functions from ancestors and other genes of AP2 group lost most function but just remained flowering time controlling in gene formation. In this study, the phylogenies of AP2 group genes in spermatophytes was analyzed, which supported the evidence for the research of gene functional evolution of AP2 group.

  7. Independent Consulting Topical Interest Group: 2004 Industry Survey

    Science.gov (United States)

    Jarosewich, Tania; Essenmacher, Victoria L.; Lynch, Christina Olenik; Williams, Jennifer E.; Doino-Ingersoll, Jo Ann

    2006-01-01

    The American Evaluation Association's (AEA) Independent Consulting Topical Interest Group (IC TIG) has a membership of over eight hundred individuals who generally work as sole proprietors, in partnerships, or in small consulting firms. Well over a decade ago, the IC TIG conducted a survey of its membership (Bonnet, 1992). To gather current data…

  8. Nuclear Forensics: Report of the AAAS/APS Working Group

    Science.gov (United States)

    Tannenbaum, Benn

    2008-04-01

    This report was produced by a Working Group of the American Physical Society's Program on Public Affairs in conjunction with the American Association for the Advancement of Science Center for Science, Technology and Security Policy. The primary purpose of this report is to provide the Congress, U.S. government agencies and other institutions involved in nuclear forensics with a clear unclassified statement of the state of the art of nuclear forensics; an assessment of its potential for preventing and identifying unattributed nuclear attacks; and identification of the policies, resources and human talent to fulfill that potential. In the course of its work, the Working Group observed that nuclear forensics was an essential part of the overall nuclear attribution process, which aims at identifying the origin of unidentified nuclear weapon material and, in the event, an unidentified nuclear explosion. A credible nuclear attribution capability and in particular nuclear forensics capability could deter essential participants in the chain of actors needed to smuggle nuclear weapon material or carry out a nuclear terrorist act and could also encourage states to better secure such materials and weapons. The Working Group also noted that nuclear forensics result would take some time to obtain and that neither internal coordination, nor international arrangements, nor the state of qualified personnel and needed equipment were currently enough to minimize the time needed to reach reliable results in an emergency such as would be caused by a nuclear detonation or the intercept of a weapon-size quantity of material. The Working Group assesses international cooperation to be crucial for forensics to work, since the material would likely come from inadequately documented foreign sources. In addition, international participation, if properly managed, could enhance the credibility of the deterrent effect of attribution. Finally the Working Group notes that the U.S. forensics

  9. Report of the APS Neutrino Study Reactor Working Group

    Energy Technology Data Exchange (ETDEWEB)

    Abouzaid, E.; Anderson, K.; Barenboim, G.; Berger, B.; Blucher, E.; Bolton, T.; Choubey, S.; Conrad, J.; Formaggio, J.; Freedman, S.; Finely, D.; Fisher, P.; Fujikawa, B.; Gai, M.; Goodman, M.; de Goueva, A.; Hadley, N.; Hahn, R.; Horton-Smith, G.; Kadel, R.; Kayser, B.; Heeger, K.; Klein, J.; Learned, J.; Lindner, M.; Link, J.; Luk, K.-B.; McKeown, R.; Mocioiu, I.; Mohapatra, R.; Naples, D.; Peng, J.; Petcov, S.; Pilcher, J.; Rapidis, P.; Reyna, D.; Shaevitz, M.; Shrock, R.; Stanton, N.; Stefanski, R.; Yamamoto, R.; Worcester, M.

    2004-10-28

    The worldwide program to understand neutrino oscillations and determine the neutrino mixing parameters, CP violating effects, and mass hierarchy will require a broad combination of measurements. The group believes that a key element of this future neutrino program is a multi-detector neutrino experiment (with baselines of {approx} 200 m and {approx} 1.5 km) with a sensitivity of sin{sup 2} 2{theta}{sub 13} = 0.01. In addition to oscillation physics, the reactor experiment may provide interesting measurements of sin{sup 2} {theta}{sub W} at Q{sup 2} = 0, neutrino couplings, magnetic moments, and mixing with sterile neutrino states. {theta}{sub 13} is one of the twenty-six parameters of the standard model, the best model of electroweak interactions for energies below 100 GeV and, as such, is worthy of a precision measurement independent of other considerations. A reactor experiment of the proposed sensitivity will allow a measurement of {theta}{sub 13} with no ambiguities and significantly better precision than any other proposed experiment, or will set limits indicating the scale of future experiments required to make progress. Figure 1 shows a comparison of the sensitivity of reactor experiments of different scales with accelerator experiments for setting limits on sin{sup 2} 2{theta}{sub 13} if the mixing angle is very small, or for making a measurement of sin{sup 2} 2{theta}{sub 13} if the angle is observable. A reactor experiment with a 1% precision may also resolve the degeneracy in the {theta}{sub 23} parameter when combined with long-baseline accelerator experiments. In combination with long-baseline measurements, a reactor experiment may give early indications of CP violation and the mass hierarchy. The combination of the T2K and Nova long-baseline experiments will be able to make significant measurements of these effects if sin{sup 2} 2{theta}{sub 13} > 0.05 and with enhanced beam rates can improve their reach to the sin{sup 2} 2{theta}{sub 13} > 0.02 level

  10. 77 FR 22622 - AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc...

    Science.gov (United States)

    2012-04-16

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc., CardioVascular... lack of current and accurate information concerning the securities of BPO Management Services,...

  11. Eighth meeting of the ITPA Topical Group on Diagnostics

    International Nuclear Information System (INIS)

    The Eighth Meeting of the ITPA Topical Group (TG) on Diagnostics was held at the Culham Science Centre, UKAEA, from 14-18 March 2005. The meeting was opened by Professor Llewellyn Smith, Director of the Culham Science Centre. Professor Llewellyn Smith stressed the importance of diagnostics in operating and evaluating the performance of tokamak plasmas and highlighted that this will also be the case in ITER. The meeting was combined with a progress meeting on ITER-relevant diagnostic developments on-going in Europe, which was held on 14 March. More than 60 participants attended the meeting and all six ITPA partners were represented. Special sessions were devoted to alpha-particle diagnostics and to the ITER relevance of present and future diagnostic upgrades of JET

  12. Experimental Evaluation of Unicast and Multicast CoAP Group Communication

    Directory of Open Access Journals (Sweden)

    Isam Ishaq

    2016-07-01

    Full Text Available The Internet of Things (IoT is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP, but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP.

  13. Experimental Evaluation of Unicast and Multicast CoAP Group Communication.

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Moerman, Ingrid; Demeester, Piet

    2016-07-21

    The Internet of Things (IoT) is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP) is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP), but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP.

  14. Experimental Evaluation of Unicast and Multicast CoAP Group Communication.

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Moerman, Ingrid; Demeester, Piet

    2016-01-01

    The Internet of Things (IoT) is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP) is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP), but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP. PMID:27455262

  15. Experimental Evaluation of Unicast and Multicast CoAP Group Communication

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Moerman, Ingrid; Demeester, Piet

    2016-01-01

    The Internet of Things (IoT) is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP) is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP), but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP. PMID:27455262

  16. Eficácia de hipotensores oculares tópicos após capsulotomia posterior Efficacy of topic ocular hipotensive agents after posterior capsulotomy

    Directory of Open Access Journals (Sweden)

    Antonieta Antunes Pereira Minello

    2008-10-01

    (p=0,001. Quanto à freqüência de hipertensão entre os grupos, não houve diferença significante (p=0,148. CONCLUSÃO: A apraclonidina apresentou o maior efeito hipotensor após a capsulotomia com YAG laser quando comparada aos grupos brimonidina, dorzolamida, latanoprosta, pilocarpina, timolol e grupo controle.PURPOSE: To analyze and compare the effects on intraocular pressure (IOP of several topic hypotensive agents after posterior capsulotomy with Nd:YAG laser in non glaucoma patients. METHODS: 145 pseudophakic eyes underwent to Nd:YAG laser posterior capsulotomy. Before capsulotomy. 21 were treated with apraclonidine, 20 with brimonidine, 23 with dorzolamide, 20 with latanoprost, 20 with pilocarpine, and 20 with timolol. Controls (21 eyes received placebo. IOP measurements (Goldmann applanation tonometry were taken under masked conditions 1 hour before procedure and after 1 and 2 hours. If postoperative PIO was above 20 mmHg its measurements were extended to 4 and 24 hours. Capsulotomy was performed with Abraham lens, under topic anesthetic, using Nd:YAG laser. Ocular hypertension would be considered if the IOP had suffered an increase of 4 mmHg above the initial. Mean total energy used was 2.1 ± 1 mJ. RESULTS: The preoperative IOP did not differ statistically among groups. Mean IOPs of treated eyes 1h (11.9 ± 3.8 and 2h (11.5 ± 3.0 were statistically lower than IOP compared with control group (12,6 ± 2,8 (p=0.001. There were no statistically significant differences for the other measurements. Control and pilocarpine had a percentual IOP increase after 2 hours of 8.7 ± 19.1% (13.5 ± 3.2 mmHg and 1.2 ± 26.3% (12.5 ± 3.6 mmHg respectively. Mean percentual postoperative IOP reduction was detected in the apraclonidine group -24.7 ± 15.5% (9.8 ± 2.6 mmHg, in the brimonidine group -8.9 ± 15.5% (10.1 ± 1.7 mmHg, in the dorzolamide group -6.9 ± 20.3% (12.1 ± 2.8 mmHg, in the latanoprost group -0.4 ± 25.9% (12.1 ± 2.9 mmHg and in timolol group -16.2

  17. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Fall 2004

    CERN Document Server

    Pullin, J

    2004-01-01

    Contents: Community news: Message from the Chair, by Jim Isenberg We hear that..., by Jorge Pullin THE TGG WYP Speakers Program, by Richard Price Research Briefs: Gravity Probe B is launched, by Bill Hamilton Questions and progress in mathematical general relativity, by Jim Isenberg Summary of recent preliminary LIGO results, by Alan Wiseman for the LSC 100 Years ago, by Jorge Pullin Conference reports: Einstein 125, by Abhay Ashtekar The 7th Eastern Gravity Meeting, by Deirdre Shoemaker 2004 Aspen GWADW, by Syd Meshkov Fifth LISA Symposium, by Curt Cutler GR17, by Brien Nolan Loops and Spinfoams, by Carlo Rovelli 20th Pacific coast gravity meeting, by Michele Vallisneri

  18. Matters of Gravity, the newsletter of the APS Topical Group on Gravitation, Fall 2005

    CERN Document Server

    Pullin, J

    2005-01-01

    GGR News: The WYP speakers program, by Richard Price We hear that..., by Jorge Pullin 100 Years ago, by Jorge Pullin Research Briefs: What's new in LIGO, by David Shoemaker Recent developments in the information loss paradox, by Eanna Flanagan Gravity Probe B mission ends, by Bob Kahn Conference reports: 6th Edoardo Amaldi Meeting, by Matthew Benacquista Workshop on Numerical Relativity, BIRS, by Carsten Gundlach 8th Capra Meeting on Radiation Reaction, by Leor Barack Theory and experiment in quantum gravity, by Elizabeth Winstanley

  19. Transcription of ColE1Ap mbeC induced by conjugative plasmids from twelve different incompatibility groups.

    OpenAIRE

    Selvaratnam, S; Gealt, M A

    1993-01-01

    Although nonconjugative mobilizable plasmids require helping functions of conjugative plasmids in order to be mobilized into recipients, at least some genes from the nonconjugative plasmids may be induced to assist in the DNA transfer process. Conjugative plasmids from 12 different incompatibility groups mobilized the nonconjugative plasmid ColE1Ap between Escherichia coli strains. Introduction of any of the conjugative plasmids into the ColE1Ap-containing strain resulted in an induction of m...

  20. LDA-Based Unified Topic Modeling for Similar TV User Grouping and TV Program Recommendation.

    Science.gov (United States)

    Pyo, Shinjee; Kim, Eunhui; Kim, Munchurl

    2015-08-01

    Social TV is a social media service via TV and social networks through which TV users exchange their experiences about TV programs that they are viewing. For social TV service, two technical aspects are envisioned: grouping of similar TV users to create social TV communities and recommending TV programs based on group and personal interests for personalizing TV. In this paper, we propose a unified topic model based on grouping of similar TV users and recommending TV programs as a social TV service. The proposed unified topic model employs two latent Dirichlet allocation (LDA) models. One is a topic model of TV users, and the other is a topic model of the description words for viewed TV programs. The two LDA models are then integrated via a topic proportion parameter for TV programs, which enforces the grouping of similar TV users and associated description words for watched TV programs at the same time in a unified topic modeling framework. The unified model identifies the semantic relation between TV user groups and TV program description word groups so that more meaningful TV program recommendations can be made. The unified topic model also overcomes an item ramp-up problem such that new TV programs can be reliably recommended to TV users. Furthermore, from the topic model of TV users, TV users with similar tastes can be grouped as topics, which can then be recommended as social TV communities. To verify our proposed method of unified topic-modeling-based TV user grouping and TV program recommendation for social TV services, in our experiments, we used real TV viewing history data and electronic program guide data from a seven-month period collected by a TV poll agency. The experimental results show that the proposed unified topic model yields an average 81.4% precision for 50 topics in TV program recommendation and its performance is an average of 6.5% higher than that of the topic model of TV users only. For TV user prediction with new TV programs, the average

  1. LDA-Based Unified Topic Modeling for Similar TV User Grouping and TV Program Recommendation.

    Science.gov (United States)

    Pyo, Shinjee; Kim, Eunhui; Kim, Munchurl

    2015-08-01

    Social TV is a social media service via TV and social networks through which TV users exchange their experiences about TV programs that they are viewing. For social TV service, two technical aspects are envisioned: grouping of similar TV users to create social TV communities and recommending TV programs based on group and personal interests for personalizing TV. In this paper, we propose a unified topic model based on grouping of similar TV users and recommending TV programs as a social TV service. The proposed unified topic model employs two latent Dirichlet allocation (LDA) models. One is a topic model of TV users, and the other is a topic model of the description words for viewed TV programs. The two LDA models are then integrated via a topic proportion parameter for TV programs, which enforces the grouping of similar TV users and associated description words for watched TV programs at the same time in a unified topic modeling framework. The unified model identifies the semantic relation between TV user groups and TV program description word groups so that more meaningful TV program recommendations can be made. The unified topic model also overcomes an item ramp-up problem such that new TV programs can be reliably recommended to TV users. Furthermore, from the topic model of TV users, TV users with similar tastes can be grouped as topics, which can then be recommended as social TV communities. To verify our proposed method of unified topic-modeling-based TV user grouping and TV program recommendation for social TV services, in our experiments, we used real TV viewing history data and electronic program guide data from a seven-month period collected by a TV poll agency. The experimental results show that the proposed unified topic model yields an average 81.4% precision for 50 topics in TV program recommendation and its performance is an average of 6.5% higher than that of the topic model of TV users only. For TV user prediction with new TV programs, the average

  2. Discovering associations among diagnosis groups using topic modeling.

    Science.gov (United States)

    Li, Ding Cheng; Thermeau, Terry; Chute, Christopher; Liu, Hongfang

    2014-01-01

    With the rapid growth of electronic medical records (EMR), there is an increasing need of automatically extract patterns or rules from EMR data with machine learning and data mining technqiues. In this work, we applied unsupervised statistical model, latent Dirichlet allocations (LDA), to cluster patient diagnoics groups from Rochester Epidemiology Projects (REP). The initial results show that LDA holds the potential for broad application in epidemiogloy as well as other biomedical studies due to its unsupervised nature and great interpretive power. PMID:25954576

  3. Leucodermia punctata após tratamento com Puvasol tópico Leukoderma punctata following topical PUVAsol treatment

    OpenAIRE

    Nurimar Conceição Fernandes; Juliana Carnevale Pina

    2010-01-01

    Duas adolescentes e uma menina com vitiligo clinicamente diagnosticado foram tratadas com 8-metoxipsoraleno a 0,2% em creme Lanette com subsequente exposição solar. Um ano após, apresentaram máculas acrômicas na área do vitiligo. A biópsia de pele em um dos casos revelou melanócitos com escassa pigmentação melânica. Os achados clínicos e histológicos sugerem o diagnóstico de leucodermia punctata.Two adolescent females and a girl, all with clinically diagnosed vitiligo, were treated with 0.2% ...

  4. Leucodermia punctata após tratamento com Puvasol tópico Leukoderma punctata following topical PUVAsol treatment

    Directory of Open Access Journals (Sweden)

    Nurimar Conceição Fernandes

    2010-08-01

    Full Text Available Duas adolescentes e uma menina com vitiligo clinicamente diagnosticado foram tratadas com 8-metoxipsoraleno a 0,2% em creme Lanette com subsequente exposição solar. Um ano após, apresentaram máculas acrômicas na área do vitiligo. A biópsia de pele em um dos casos revelou melanócitos com escassa pigmentação melânica. Os achados clínicos e histológicos sugerem o diagnóstico de leucodermia punctata.Two adolescent females and a girl, all with clinically diagnosed vitiligo, were treated with 0.2% 8-methoxypsoralen cream followed by exposure to solar ultraviolet light. One year later, they developed hypopigmented and achromic spots on the areas affected by the vitiligo. Biopsy of skin tissue taken from one of these cases showed a marked reduction in melanin. Clinical and histological findings point to a diagnosis of leukoderma punctata.

  5. AP Trends: Tests Soar, Scores Slip--Gaps between Groups Spur Equity Concerns

    Science.gov (United States)

    Cech, Scott J.

    2008-01-01

    More students are taking Advanced Placement tests, but the proportion of tests receiving what is deemed a passing score has dipped, and the mean score is down for the fourth year in a row. Data released here this week by the New York City-based nonprofit organization that owns the AP brand shows that a greater-than-ever proportion of students…

  6. Temporal Variation of Different Categories Sunspot Groups since 1996: Their Relation with Geomagnetic Ap and Dst Indices

    Science.gov (United States)

    Kilcik, Ali; Ozguc, Atila; Rozelot, Jean Pierre; Donmez, Burcin; Yurchyshyn, Vasyl

    2016-07-01

    We studied the temporal variation of the number of sunspot groups and sunspot counts in these groups in four categories as small (A, B), medium (C), large (D, E, F) and final (H modified Zurich classes) since 1996. Then we compared these data sets with geomagnetic Ap and Dst indices. In results of our analysis we found followings: 1) different categories sunspot groups and sunspot counts in these groups behave differently during a solar cycle. ii) Response of geomagnetic indices to these data sets are also different.

  7. Tomorrow's Journalists: In-Groups, Out-Groups, and News Topic Preference

    Science.gov (United States)

    Netzley, Sara Baker; Banning, Stephen A.

    2011-01-01

    This study explored whether student journalists believed they shared news topic preferences with the public. Previous research suggests journalists are very different from the audiences they serve, which may influence their perceptions of audience story preferences because of the social identity theory and the social distance corollary. A national…

  8. A Topic Space Oriented User Group Discovering Scheme in Social Network: A Trust Chain Based Interest Measuring Perspective

    Directory of Open Access Journals (Sweden)

    Wang Dong

    2016-01-01

    Full Text Available Currently, user group has become an effective platform for information sharing and communicating among users in social network sites. In present work, we propose a single topic user group discovering scheme, which includes three phases: topic impact evaluation, interest degree measurement, and trust chain based discovering, to enable selecting influential topic and discovering users into a topic oriented group. Our main works include (1 an overview of proposed scheme and its related definitions; (2 topic space construction method based on topic relatedness clustering and its impact (influence degree and popularity degree evaluation; (3 a trust chain model to take user relation network topological information into account with a strength classification perspective; (4 an interest degree (user explicit and implicit interest degree evaluation method based on trust chain among users; and (5 a topic space oriented user group discovering method to group core users according to their explicit interest degrees and to predict ordinary users under implicit interest and user trust chain. Finally, experimental results are given to explain effectiveness and feasibility of our scheme.

  9. Third party access to LNG terminals. GIIGNL - Commercial Study Group Topic 8

    International Nuclear Information System (INIS)

    This report has been elaborated in the context of the GIIGNL Commercial Study Group (CSG) activities, which include as one of its topics the 'Third Party Access to LNG terminals' (Topic 8), led by Enagas. The 2010 edition is the third update to the report presented during the meeting of the GIIGNL Commercial Study Group in Tokyo, Japan, in September 2007. - Section 1 includes a review of the regulatory TPA regimes of LNG terminals in operation in Europe. The existing regime in each country, or for each terminal, is reviewed following a number of subsections. Each subsection follows the same structure in order to better understand the different arrangements and facilitate comparisons. - Section 2 shows data on effective usage and TPA access to each LNG terminal since 2000. Three main data are shown where available: number of cargoes delivered, volumes unloaded / sent-out, and the part of these cargoes/volumes that correspond to third parties. - Section 3 includes a tariff comparison for TPA to LNG terminals in Europe, taking into account the terms and conditions in force as of July 2010. - A description of the regulatory situation in the US in Sections 4. Access conditions to the three terminals under regulated TPA have been included for the first time: Lake Charles, Cove Point and Elba Island. An overview of Mexico and Canada is also reported. - An overview of the regulatory situation in Japan is provided in Section 5. The information required for the elaboration of this report has been collected from official web sites (LNG operators, regulatory authorities and industry associations), public reports and industry and statistical data Enagas deems to be reliable. For the adoption of certain hypothesis in Section 3 Enagas has also relied in information directly provided by operators

  10. Climate Change on Twitter: Topics, Communities and Conversations about the 2013 IPCC Working Group 1 Report

    Science.gov (United States)

    Pearce, Warren; Holmberg, Kim; Hellsten, Iina; Nerlich, Brigitte

    2014-01-01

    In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report. PMID:24718388

  11. Climate change on Twitter: topics, communities and conversations about the 2013 IPCC Working Group 1 report.

    Directory of Open Access Journals (Sweden)

    Warren Pearce

    Full Text Available In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report.

  12. Climate change on Twitter: topics, communities and conversations about the 2013 IPCC Working Group 1 report.

    Science.gov (United States)

    Pearce, Warren; Holmberg, Kim; Hellsten, Iina; Nerlich, Brigitte

    2014-01-01

    In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report. PMID:24718388

  13. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  14. [Qualitative research: the systematization of the generating topics and group technics].

    Science.gov (United States)

    Laganá, M T

    1989-04-01

    This study describes the systematization of generating themes into social representations, followed by group works with interventions that go through the stages of identification, domestication, relearning and performance redefinitions.

  15. Topics in mode conversion theory and the group theoretical foundations of path integrals

    Science.gov (United States)

    Richardson, Andrew Stephen

    This dissertation reports research about the phase space perspective for solving wave problems, with particular emphasis on the phenomenon of mode conversion in multicomponent wave systems, and the mathematics which underlie the phase space perspective. Part I of this dissertation gives a review of the phase space theory of resonant mode conversion. We describe how the WKB approximation is related to geometrical structures in phase space, and how in particular ray-tracing algorithms can be used to construct the WKB solution. We further review how to analyze the phenomena of mode conversion from the phase space perspective. By making an expansion of the dispersion matrix about the mode conversion point in phase space, a local coupled wave equation is obtained. The solution of this local problem then provides a way to asymptotically match the WKB solutions on either side of the mode conversion region. We describe this theory in the context of a pedagogical example; that of a pair of coupled harmonic oscillators undergoing resonant conversion. Lastly, we present new higher order corrections to the local solution for the mode conversion problem which allow better asymptotic matching to the WKB solutions. The phase space tools used in Part I rely on the Weyl symbol calculus, which gives a way to relate operators to functions on phase space. In Part II of this dissertation, we explore the mathematical foundations of the theory of symbols. We first review the theory of representations of groups, and the concept of a group Fourier transform. The Fourier transform for commutative groups gives the ordinary transform, while the Fourier transform for non-commutative groups relates operators to functions on the group. We go on to present the group theoretical formulation of symbols, as developed recently by Zobin. This defines the symbol of an operator in terms of a double Fourier transform on a non-commutative group. We give examples of this new type of symbol, using the

  16. Selected source term topics. Report to CSNI by an OECD/NEA Group of experts

    International Nuclear Information System (INIS)

    CSNI Report 136 summarizes the results of the work performed by the Group of Experts on the Source Term and Environmental Consequences (PWG4) during the period extending from 1983 and 1986. This report is complementary to Part 1, 'Technical Status of the Source Term' of CSNI Report 135, 'Report to CSNI on Source Term Assessment, Containment atmosphere control systems, and accident consequences'; it considers in detail a number of very specific issues thought to be important in the source term area. It consists of: an executive summary (prepared by the Chairman of the Group), a section on conclusions and recommendations, and five technical chapters (fission product chemistry in the primary circuit of a LWR during severe accidents; resuspension/re-entrainment of aerosols in LWRs following a meltdown accident; iodine chemistry under severe accident conditions; effects of combustion, steam explosions and pressurized melt ejection on fission product behaviour; radionuclide removal by pool scrubbing), a technical annex and two appendices

  17. Winfrith Nuclear Data Group notes on topics in nuclear data evaluation, 1964-8

    International Nuclear Information System (INIS)

    This memorandum collects together a selection of brief notes written, during the course of the past few years, by the members of the Nuclear Data Group at the A.E.E., Winfrith. Many of the notes were tentative in nature and of ephemeral interest only, but it is felt that those presented here may have a wider interest to the fraternity of evaluators. (author)

  18. Developing clinical practice guidelines: target audiences, identifying topics for guidelines, guideline group composition and functioning and conflicts of interest.

    Science.gov (United States)

    Eccles, Martin P; Grimshaw, Jeremy M; Shekelle, Paul; Schünemann, Holger J; Woolf, Steven

    2012-07-04

    Clinical practice guidelines are one of the foundations of efforts to improve health care. In 1999, we authored a paper about methods to develop guidelines. Since it was published, the methods of guideline development have progressed both in terms of methods and necessary procedures and the context for guideline development has changed with the emergence of guideline clearing houses and large scale guideline production organisations (such as the UK National Institute for Health and Clinical Excellence). It therefore seems timely to, in a series of three articles, update and extend our earlier paper. In this first paper we discuss: the target audience(s) for guidelines and their use of guidelines; identifying topics for guidelines; guideline group composition (including consumer involvement) and the processes by which guideline groups function and the important procedural issue of managing conflicts of interest in guideline development.

  19. Developing clinical practice guidelines: target audiences, identifying topics for guidelines, guideline group composition and functioning and conflicts of interest

    Directory of Open Access Journals (Sweden)

    Eccles Martin P

    2012-07-01

    Full Text Available Abstract Clinical practice guidelines are one of the foundations of efforts to improve health care. In 1999, we authored a paper about methods to develop guidelines. Since it was published, the methods of guideline development have progressed both in terms of methods and necessary procedures and the context for guideline development has changed with the emergence of guideline clearing houses and large scale guideline production organisations (such as the UK National Institute for Health and Clinical Excellence. It therefore seems timely to, in a series of three articles, update and extend our earlier paper. In this first paper we discuss: the target audience(s for guidelines and their use of guidelines; identifying topics for guidelines; guideline group composition (including consumer involvement and the processes by which guideline groups function and the important procedural issue of managing conflicts of interest in guideline development.

  20. Matters of Gravity, The Newsletter of the Topical Group on Gravitation of the American Physical Society, Volume 46, December 2015

    CERN Document Server

    Garfinkle, David

    2015-01-01

    GGR News: Remembering Jacob Bekenstein we hear that ... 100 years ago GGR program at the APS meeting in Salt Lake City Conference reports: Hawking Radiation Quantum Information in Quantum Gravity Gravity-new perspectives from strings and higher dimensions

  1. Matters of Gravity, The Newsletter of the Topical Group in Gravitation of the American Physical Society, Volume 31, Winter 2008

    OpenAIRE

    Garfinkle, David; Comer, Greg

    2008-01-01

    GGR News: GGR program at the APS meeting in St. Louis we hear that... by David Garfinkle 100 years ago, by David Garfinkle Research Briefs: The Torsion Pendulum's Contribution to Dark Energy, by Bill Hamilton Conference Reports: 10th Capra Meeting on Radiation Reaction, by Carlos Sopuerta Quantum Gravity in the Southern Cone IV, by Rafael A. Porto

  2. Synthesis and evaluation structure/extracting and complexing properties of new bi-topic ligands for group actinides extraction

    International Nuclear Information System (INIS)

    The aim of this project is to design and study new extractants for spent nuclear fuel reprocessing. To decrease the long-term radiotoxicity of the waste, the GANEX process is an option to homogeneously recycle actinides. All actinides (U, Np, Pu, Am, Cm) would be extracted together from a highly acidic media and separated from fission products (especially from lanthanides). In this context, fourteen new bi-topic ligands constituted of a nitrogen poly-aromatic unit from the dipyridyl-phenanthroline and dipyridyl-1,3,5-triazine families and functionalized by amid groups were synthesized. Extraction studies performed with some of these ligands confirmed their interest to selectively separate actinides at different oxidation states from an aqueous solution 3M HNO3. To determine the influence of ligands structure on cation complexation, a study in a homogenous media (MeOH/H2O) has been carried out. Electro-spray ionization mass spectrometry have been used to characterize the complexes stoichiometries formed with several cations (Eu3+, Nd3+, Am3+, Pu4+ and NpO2+). Stability constants, evaluated by UV-Visible spectrophotometry, confirm the selectivity of these ligands toward actinides. Lanthanides and actinides complexes have also been characterized in the solid state by infra-red spectroscopy and X-Ray diffraction. Associated to nuclear magnetic resonance experiments and DFT calculations (Density Functional Theory), a better knowledge of their coordination mode was achieved. (author)

  3. Topic Discovery of Network Group Events Based on Ontology%基于本体的网络群体性事件主题发现研究

    Institute of Scientific and Technical Information of China (English)

    黄炜; 程宝生; 杨青

    2012-01-01

    In the environment of network information which is incompleteness and colloquial style, the diversity and complexity of Chinese semanteme are more prominent. The existing Web information analysis method is based on key word matching and traditional statistics, its topic discovery rate can not reach the requirement of network group events' warning. As network information topic's cognitive extent is large, the current improved text cluster's description of semanteme is also imperfect. So this paper introduces the relative technology of ontology and semantic computation to network group events' topic discovery research and produces empirical research by establishing a domain ontology of food safety. The results show that the method can obtain topic information effectively and it is helpful to the topic discovery of network group events.%将本体论和语义计算的相关技术引入到网络群体性事件的主题发现研究中,并通过构建食品安全领域本体进行实证研究。实验结果表明,该方法能够有效地获取主题信息,有助于实现网络群体性事件的主题发现。

  4. Exploring Perspectives of Individuals with Intellectual Disabilities and Histories of Challenging Behaviors about Family Relationships: An Emergent Topic in a Grounded Theory Focus Group Study

    Science.gov (United States)

    Brown, Julie F.; Hamilton-Mason, Johnnie; Maramaldi, Peter; Barnhill, L. Jarrett

    2016-01-01

    The perspectives of individuals with intellectual disabilities (ID) about family relationships are underrepresented in the literature. The topic of family relationships emerged in a grounded theory exploratory focus group study that involved thirty dually diagnosed participants with moderate or mild intellectual disabilities and histories of…

  5. Hot Topics in Noninvasive Ventilation : Report of a Working Group at the International Symposium on Sleep-Disordered Breathing in Leuven, Belgium

    NARCIS (Netherlands)

    Vrijsen, Bart; Chatwin, Michelle; Contal, Oliver; Derom, Eric; Janssens, Jean-Paul; Kampelmacher, Mike J.; Muir, Jean-Francois; Pinto, Susana; Rabec, Claudio; Ramsay, Michelle; Randerath, Winfried J.; Storre, Jan H.; Wijkstra, Peter J.; Windisch, Wolfram; Testelmans, Dries

    2015-01-01

    During the last few decades, attention has increasingly focused on noninvasive ventilation (NIV) in the treatment of chronic respiratory failure. The University of Leuven and the University Hospitals Leuven therefore chose this topic for a 2-day working group session during their International Sympo

  6. Effects of a Topical Saffron (Crocus sativus L) Gel on Erectile Dysfunction in Diabetics: A Randomized, Parallel-Group, Double-Blind, Placebo-Controlled Trial.

    Science.gov (United States)

    Mohammadzadeh-Moghadam, Hossein; Nazari, Seyed Mohammad; Shamsa, Ali; Kamalinejad, Mohammad; Esmaeeli, Habibollah; Asadpour, Amir Abbas; Khajavi, Abdoljavad

    2015-10-01

    Erectile dysfunction is a man's persistent or recurrent inability to achieve and maintain erection for a satisfactory sexual relationship. As diabetes is a major risk factor for erectile dysfunction, the prevalence of erectile dysfunction among diabetic men has been reported as 35% to 90%. This randomized, parallel-group, double-blind, placebo-controlled trial investigated the effects of a topical saffron (Crocus sativus L) gel on erectile dysfunction in diabetic men. Patients were randomly allocated to 2 equal groups (with 25 patients each). The intervention group was treated with topical saffron, and the control received a similar treatment with placebo. The 2 groups were assessed using the International Index of Erectile Function Questionnaire before the intervention and 1 month after the intervention. Compared to placebo, the prepared saffron gel could significantly improve erectile dysfunction in diabetic patients (P < .001). This preliminary evidence suggests that saffron can be considered as a treatment option for diabetic men with erectile dysfunction.

  7. Social Work and Evaluation: Why You Might Be Interested in the American Evaluation Association Social Work Topical Interest Group

    Science.gov (United States)

    Wharton, Tracy C.; Kazi, Mansoor A.

    2012-01-01

    With increased pressure on programs to evaluate outcomes, the issue of evaluation in social work has never been so topical. In response to these pressures, there has been a growing interest in evidence-based practice and strategies for the evaluation of social work programs. The American Evaluation Association (AEA) is an international…

  8. A note on weighted Ap(G)-modules

    OpenAIRE

    ÖZTOP, Serap

    2011-01-01

    Let G be a locally compact abelian group and w be a weight function on G. In this paper, we show that the space Ap,w(G) is a Banach module over the Figà-Talamanca Herz algebra Ap(G) and study the multiplier space from Ap(G) to Ap,w(G).

  9. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  10. Alkali-soluble fluoride deposition on enamel after professional application of topical fluoride in vitro Formação de flúor fracamente ligado ao esmalte após a aplicação tópica profissional de flúor in vitro

    Directory of Open Access Journals (Sweden)

    Mitsue Fujimaki Hayacibara

    2004-03-01

    Full Text Available Since the efficacy of topical fluoride products is related to the fluoride (F availability and its reactivity with enamel, this study was conducted. The F concentration of the following materials was verified: I- acidulated phosphate fluoride (APF gel (1.23% F, II- APF foam (1.23% F and III- Varnish (2.26% F. Forty blocks of bovine enamel were divided into 4 groups and treated according to the materials described, being one of them used as control. Loosely bound fluoride (''CaF2'' was determined on enamel after extraction with 1.0M KOH and analyzed by ion-selective electrode. Total F concentration found in gel was 12,642, in foam 12,755 and in varnish 23,183 mg F/g. All products formed statistically higher amounts of ''CaF2'' on enamel compared to the control group (p 0.05. Thus, ''CaF2'' formation was not proportional to the total F content in the products, suggesting that the pH and the vehicle used are more important.Considerando que a eficácia dos produtos para aplicação tópica profissional de flúor (géis, espumas e vernizes está relacionada com a reatividade do flúor (F com o esmalte e sendo esta dependente da disponibilidade do F em cada produto, este estudo foi conduzido. A concentração de F nos seguintes produtos foi estudada: I - Flúor Fosfato Acidulado (FFA gel (1,23% F, II - FFA espuma (1,23% F e III- Verniz fluoretado (2,26% F. Foram confeccionados 40 blocos de esmalte bovino, tratados de acordo com os grupos descritos, sendo um deles utilizado como controle. O F fracamente ligado (''CaF2'' ao esmalte foi determinado após a extração com 1.0 M KOH e analisado em eletrodo específico. A concentração de F encontrada no gel foi de 12.642, na espuma 12.755 e no verniz 23.183 mg F/g. Todos os produtos formaram uma quantidade significantemente maior de ''CaF2'' na superfície do esmalte, comparado ao grupo controle (p 0,05. Assim, a formação de ''CaF2'' na superfície do esmalte não foi proporcional ao conteúdo de F nos

  11. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    International Nuclear Information System (INIS)

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  12. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    Energy Technology Data Exchange (ETDEWEB)

    Demetri, K. J.; Leipner, C. I.; Marshall, M. L., E-mail: demetrkj@westinghouse.com [Westinghouse Electric Company, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2015-09-15

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  13. International topical meeting. Research Reactor Fuel Management (RRFM) and meeting of the International Group on Reactor Research (IGORR)

    International Nuclear Information System (INIS)

    Nuclear research and test reactors have been in operation for over 60 years, over 270 research reactors are currently operating in more than 50 countries. This meeting is dedicated to different aspects of research reactor fuels: new fuels for new reactors, the conversion to low enriched uranium fuels, spent fuel management and computational tools for core simulation. About 80 contributions are reported in this document, they are organized into 7 sessions: 1) international topics and overview on new projects and fuel, 2) new projects and upgrades, 3) fuel development, 4) optimisation and research reactor utilisation, 5) innovative methods in research reactors physics, 6) safety, operation and research reactor conversion, 7) fuel back-end management, and a poster session. Experience from Australian, Romanian, Libyan, Syrian, Vietnamese, South-African and Ghana research reactors are reported among other things. The Russian program for research reactor spent fuel management is described and the status of the American-driven program for the conversion to low enriched uranium fuels is presented. (A.C.)

  14. The Demographic Wave: Rethinking Hispanic AP Trends

    Science.gov (United States)

    Edwards, Kelcey; Sawtell, Ellen

    2013-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  15. The AP1000 reactor

    International Nuclear Information System (INIS)

    The design of the AP1000 reactor began 20 years ago when Westinghouse launched the AP600 reactor project. In fact by re-assessing AP600's safety margins Westinghouse realized that the its power output could be raised without putting at risk its safety standard. The AP1000 was born, it yields 1100 MWe. The main AP1000's design features is its passive safety (particularly after the Fukushima accident) and its modularity. The passive safety of the AP1000 implies: -) no humane intervention needed for 72 hours at least after the incident; -) no necessity for redundant complex safety systems. The modularity means that the plant, the reactor and other buildings are constructed from a choice of 300 modular units. These units can be built off-site and fit together on site. The modularity allows more construction activities to be led simultaneously and more chances to cope with the construction schedule. The NRC has approved the operation license for 30 years of the first AP1000 being built in the Usa (Vogtle plant in Georgia). 4 AP1000 are being built in China (Sanmen and Haiyang sites) and 6 others are planned in the Usa. Westinghouse is convinced that the AP1000's passive safety makes it more attractive. Let us not forget that Westinghouse was at the origin of the concept of pressurized water reactors, an idea adopted for half the nuclear power stations in the world and for all the plants now active in France. (A.C.)

  16. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  17. Comparative study in swines' vocal cords healing after excision of fragment with CO2 laser with mitomycin and 5-fluorouracil postoperative topical application Estudo comparado da cicatrização da prega vocal de suínos após exérese de fragmento com laser de CO2 e aplicação tópica pós-operatória de mitomicina e 5-fluorouracil

    Directory of Open Access Journals (Sweden)

    Eduardo Baptistella

    2009-02-01

    Full Text Available PURPOSE: To evaluate the deposition of collagen fibers at pig's vocal folds after topical use of mitomycin or 5-fluorouracil, when partial exeresis of mucosa layer had been promoted by CO2 laser. METHODS: There were used 18 Larger white pigs which were anesthetized and submitted to mucosa fragment's exeresis, bilaterally, at its free border. The animals were divided into 3 groups, each one with 6 animals: control group, without topical drug application; mitomycin group; and 5-fluorouracil group. After 30 days, the animals were subjected to euthanasia, and samples of the vocal folds were collected and stained by picrosirius red technique with polarization for quantification of total collagen deposition. RESULTS: In control group, the mean rate of right vocal fold's collagen deposition at submucosa consisted in a 3428.66 micrometers area. There was found an area whose size had, in average, 2196.36 micrometers, in mitomycin group, and 2269.19 micrometers, in 5-fluorouracil group. CONCLUSION: Mitomycin and 5-fluorouracil had promoted beneficial change in vocal fold's cicatrization with less collagen deposition, but there was no significant statistically difference when they were compared between themselves.OBJETIVO: Avaliar a deposição das fibras de colágeno total em pregas vocais suínas após o uso tópico de mitomicina ou 5-fluorouracil nas exéreses parciais de mucosa com laser de CO2. MÉTODOS: Foram utilizados 18 porcos da raça Larger white anestesiados e submetidos à exérese de fragmento de mucosa de borda livre da prega vocal direita e prega vocal esquerda. Os animais foram divididos em 3 grupos com 6 animais cada: grupo controle, sem aplicação de medicação tópica; grupo mitomicina, com uso tópico dessa substância; grupo 5-fluorouracil, uso tópico. Após 30 dias do experimento os animais foram submetidos à eutanásia, coletadas amostras das pregas vocais e coradas pela técnica do picrosirius red com polarização para a

  18. Do scientists trace hot topics?

    OpenAIRE

    Tian Wei; Menghui Li; Chensheng Wu; Xiao-Yong Yan; Ying Fan; Zengru Di; Jinshan Wu

    2013-01-01

    Do scientists follow hot topics in their scientific investigations? In this paper, by performing analysis to papers published in the American Physical Society (APS) Physical Review journals, it is found that papers are more likely to be attracted by hot fields, where the hotness of a field is measured by the number of papers belonging to the field. This indicates that scientists generally do follow hot topics. However, there are qualitative differences among scientists from various countries,...

  19. Fluorouracil Topical

    Science.gov (United States)

    ... topical solution are used to treat actinic or solar keratoses (scaly or crusted lesions [skin areas] caused by years of too much exposure to sunlight). Fluorouracil cream and topical solution are also used to treat ...

  20. Bimatoprost Topical

    Science.gov (United States)

    Topical bimatoprost is used to treat hypotrichosis (less than the normal amount of hair) of the eyelashes by promoting ... growth of longer, thicker, and darker lashes. Topical bimatoprost is in a class of medications called prostaglandin ...

  1. Bexarotene Topical

    Science.gov (United States)

    ... condition may improve as soon as 4 weeks after you begin to use topical bexarotene, or it may ... notice any improvement. Continue to use topical bexarotene after you notice improvement; your condition may continue to improve. ...

  2. Testosterone Topical

    Science.gov (United States)

    ... in which the body does not produce enough natural testosterone). Testosterone is used only for men with ... topical may control your symptoms but will not cure your condition. Continue to use testosterone topical even ...

  3. Ectopic expression of FaesAP3, a Fagopyrum esculentum (Polygonaceae) AP3 orthologous gene rescues stamen development in an Arabidopsis ap3 mutant.

    Science.gov (United States)

    Fang, Zheng-wu; Qi, Rui; Li, Xiao-fang; Liu, Zhi-xiong

    2014-10-25

    Arabidopsis thaliana APETALA3 (AP3) and Antirrhinum majus DEFICIENS (DEF) MADS box genes are required to specify petal and stamen identity. AP3 and DEF are members of the euAP3 lineage, which arose by gene duplication coincident with radiation of the core eudicots. In order to investigate the molecular mechanisms underlying organ development in early diverging clades of core eudicots, we isolated and identified an AP3 homolog, FaesAP3, from Fagopyrum esculentum (buckwheat, Polygonaceae), a multi-food-use pseudocereal with healing benefits. Protein sequence alignment and phylogenetic analyses revealed that FaesAP3 grouped into the euAP3 lineage. Expression analysis showed that FaesAP3 was transcribed only in developing stamens, and differed from AP3 and DEF, which expressed in developing petals and stamens. Moreover, ectopic expression of FaesAP3 rescued stamen development without complementation of petal development in an Arabidopsis ap3 mutant. Our results suggest that FaesAP3 is involved in the development of stamens in buckwheat. These results also suggest that FaesAP3 holds some potential for biotechnical engineering to create a male sterile line of F. esculentum. PMID:25149019

  4. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  5. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  6. Current topics in red cell biology: report on the Red Cell Special Interest Group meeting held at NHS Blood and Transplant Bristol on 30 October 2015.

    Science.gov (United States)

    Bullock, T; Bruce, L J; Ridgwell, K

    2016-08-01

    The Red Cell Special Interest Group (SIG) meeting, hosted by the British Blood Transfusion Society, provides an annual forum for the presentation of UK- and European-based red cell research. The 2015 meeting was held on Friday 30 October at the National Health Service Blood & Transplant (NHSBT) facility in Filton, Bristol and provided an exciting and varied programme on the themes of erythropoiesis, malaria biology and pathophysiology and red cells properties in stress and disease. Ten speakers presented on these topics over the course of one day. The meeting was well attended by over 90 delegates. Posters were presented during the lunch break, and abstracts from the posters are published at the end of this issue.

  7. APS Science 2009

    International Nuclear Information System (INIS)

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report), the challenge

  8. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  9. AI Topics

    OpenAIRE

    Buchanan, Bruce G; Glick, Jonathan

    2002-01-01

    The debut of the AI in the News column elsewhere in this issue of AI Magazine created a good opportunity to introduce the professional community to the AI Topics web site, home of the AI in the news virtual page. Although AI Topics is designed for the lay public, it serves a much larger audience.

  10. Clindamycin Topical

    Science.gov (United States)

    ... topical clindamycin.you should know that abrasive or medicated soaps and skin products that contain alcohol may ... in, tightly closed, and out of reach of children. Store it at room temperature and away from ...

  11. Estradiol Topical

    Science.gov (United States)

    ... Estradiol topical gel is also used to treat vaginal dryness, itching, and burning in women who are experiencing menopause. However, women whose only bothersome symptoms are vaginal burning, itching, and dryness may benefit more from a medication that is ...

  12. Tretinoin Topical

    Science.gov (United States)

    ... lotions, astringents, and perfumes); they can sting your skin, especially when you first use tretinoin.Do not use any other topical medications, especially benzoyl peroxide, salicylic acid (wart remover), and dandruff shampoos containing sulfur or ...

  13. Spotlight Topics

    Science.gov (United States)

    A Spotlight Topic consists of a set of two or more review articles focused on a specific subject in surface science. The topics are recommended by the Board of Editors. A topic may be chosen because it is particularly new or fast-breaking, thus deserving introduction to the general readership. Or, it may be because a topic is especially controversial or confusing, requiring clarification by experts. Each review will give a critical assessment rather than an encyclopedic report. While our editors always will insist on fairness and accuracy, any review which forwards an opinion is bound to be somewhat subjective. Therefore, it is the editors' wish that the set of reviews written by different authors on the same subject matter will provide a broad and balanced viewpoint. It is often the case that an author who is an expert in a technique or method may be especially enthusiastic or critical about this technique or method. A companion review in the set may provide a different viewpoint. We are hopeful that the reader, after studying these reviews and checking some of the key references, will obtain an informed opinion of the subject. We think the set of reviews in a spotlight area will considerably shorten the ``learning time'' that a nonexpert would otherwise need to become knowledgeable about a subject. In this issue, we feature a spotlight topic on oxide surfaces. The set contains an overview article by Jacques Jupille, and four articles written by G. Pacchioni, F. Cosandey and T. E. Madey, B. G. Daniels, R. Lindsay and G. Thornton, and C. Noguera respectively. Of these, the article by Pacchioni has already appeared in SRL 7, 277 (2000). The other three articles appear in this issue. A reader who wishes to suggest a spotlight topic or recommend authors to write such reviews should contact the Editor-in-Chief. We would like to hear from you.

  14. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  15. Thermodynamics of Damaged DNA Binding and Catalysis by Human AP Endonuclease 1.

    Science.gov (United States)

    Miroshnikova, A D; Kuznetsova, A A; Kuznetsov, N A; Fedorova, O S

    2016-01-01

    Apurinic/apyrimidinic (AP) endonucleases play an important role in DNA repair and initiation of AP site elimination. One of the most topical problems in the field of DNA repair is to understand the mechanism of the enzymatic process involving the human enzyme APE1 that provides recognition of AP sites and efficient cleavage of the 5'-phosphodiester bond. In this study, a thermodynamic analysis of the interaction between APE1 and a DNA substrate containing a stable AP site analog lacking the C1' hydroxyl group (F site) was performed. Based on stopped-flow kinetic data at different temperatures, the steps of DNA binding, catalysis, and DNA product release were characterized. The changes in the standard Gibbs energy, enthalpy, and entropy of sequential specific steps of the repair process were determined. The thermodynamic analysis of the data suggests that the initial step of the DNA substrate binding includes formation of non-specific contacts between the enzyme binding surface and DNA, as well as insertion of the amino acid residues Arg177 and Met270 into the duplex, which results in the removal of "crystalline" water molecules from DNA grooves. The second binding step involves the F site flipping-out process and formation of specific contacts between the enzyme active site and the everted 5'-phosphate-2'-deoxyribose residue. It was shown that non-specific interactions between the binding surfaces of the enzyme and DNA provide the main contribution into the thermodynamic parameters of the DNA product release step. PMID:27099790

  16. Preface: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik; Buttler, William; Furlanetto, Michael; Evans, William

    2014-05-01

    The 18th Biennial International Conference of the APS Topical Group on Shock Compression of Condensed Matter in conjunction with the 24th Biennial International Conference of the International Association for the Advancement of High Pressure Science & Technology (AIRAPT) was held at the Westin Hotel in Seattle, Washington from 7-12 July, 2013. This is only the second time that these two organizations have held a Joint Conference — the first was 20 years previous (1993) in Colorado Springs, Colorado. Seattle was chosen for this joint conference because of its central location for the world-wide attendees as well as its metropolitan vibrancy. The scientific program consisted of 858 scheduled presentations organized into 23 topical areas and included contributed (537), invited (95), and plenary (6) lectures, as well as two poster sessions with 110 posters each. The scientific focus of the Joint Conference was on fundamental and applied research topics related to the static or dynamic compression of condensed matter. This multidisciplinary field of research encompasses areas of physics, chemistry, materials science, mechanics, geophysics and planetary physics, and applied mathematics. Experimental, computational and theoretical studies all play important roles. The organizers endeavored to intertwine static and dynamic experimental alongside computational and theoretical studies of similar materials in the organization of the sessions. This goal was aided by the addition of three special focus sessions on deep carbon budget, high energy density materials, and dynamic response of materials. 722 scientists and engineers from 25 countries registered at the conference, including 132 students from 12 countries. The attendee countries represented included: Argentina (2), Australia (2), Brazil (3), Canada (25), China (22), Czech Republic (2), France (35), Germany (19), India (6), Israel (21), Italy (10), Japan (49), Netherlands (1), Poland (1), Portugal (2), Russia (26

  17. Two Successful Approaches to Teaching AP Government

    Science.gov (United States)

    Ladd, Brian; Stepp, Heidi

    2013-01-01

    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  18. The APS ceramic chambers

    Energy Technology Data Exchange (ETDEWEB)

    Milton, S.; Warner, D.

    1994-07-01

    Ceramics chambers are used in the Advanced Photon Source (APS) machines at the locations of the pulsed kicker and bumper magnets. The ceramic will be coated internally with a resistive paste. The resistance is chosen to allow the low frequency pulsed magnet field to penetrate but not the high frequency components of the circulating beam. Another design goal was to keep the power density experienced by the resistive coating to a minimum. These ceramics, their associated hardware, the coating process, and our recent experiences with them are described.

  19. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine

    2013-01-01

    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  20. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  1. An AP4B1 frameshift mutation in siblings with intellectual disability and spastic tetraplegia further delineates the AP-4 deficiency syndrome.

    Science.gov (United States)

    Abdollahpour, Hengameh; Alawi, Malik; Kortüm, Fanny; Beckstette, Michael; Seemanova, Eva; Komárek, Vladimír; Rosenberger, Georg; Kutsche, Kerstin

    2015-02-01

    The recently proposed adaptor protein 4 (AP-4) deficiency syndrome comprises a group of congenital neurological disorders characterized by severe intellectual disability (ID), delayed or absent speech, hereditary spastic paraplegia, and growth retardation. AP-4 is a heterotetrameric protein complex with important functions in vesicle trafficking. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been reported in patients with the AP-4 deficiency phenotype. We describe two siblings from a non-consanguineous couple who presented with severe ID, absent speech, microcephaly, growth retardation, and progressive spastic tetraplegia. Whole-exome sequencing in the two patients identified the novel homozygous 2-bp deletion c.1160_1161delCA (p.(Thr387Argfs*30)) in AP4B1. Sanger sequencing confirmed the mutation in the siblings and revealed it in the heterozygous state in both parents. The AP4B1-associated phenotype has previously been assigned to spastic paraplegia-47. Identification of a novel AP4B1 alteration in two patients with clinical manifestations highly similar to other individuals with mutations affecting one of the four AP-4 subunits further supports the observation that loss of AP-4 assembly or functionality underlies the common clinical features in these patients and underscores the existence of the clinically recognizable AP-4 deficiency syndrome.

  2. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  3. AP physics B crash course

    CERN Document Server

    Howell, Rebecca

    2012-01-01

    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  4. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000.11.0...

  5. 胡萝卜AP2/ERF-B1亚族两个转录因子基因的克隆及其非生物胁迫响应分析%Isolation and Analysis of Expression Proifles under Abiotic Stress Treatments of Two AP2/ERF-B1 Group Transcription Factor Genes fromDaucus carota

    Institute of Scientific and Technical Information of China (English)

    黄蔚; 王枫; 谭国飞; 徐志胜; 李梦瑶; 熊爱生

    2014-01-01

    AP2/ERF是植物中普遍存在的一类重要转录因子,参与植物整个生命周期的生长发育和逆境信号转导。本研究以胡萝卜(Daucus carota)‘黑田五寸’为试验材料,基于其转录组和基因组数据,检索和拼接获得胡萝卜AP2/ERF家族2个转录因子基因序列g39811和g47170。采用RT-PCR方法,分别从‘黑田五寸’中克隆DcERF-B1-1(g39811)和DcERF-B1-2(g47170)转录因子基因。序列分析显示,胡萝卜DcERF-B1-1和DcERF-B1-2转录因子基因分别含有630个和594个开放阅读框,分别编码209和197个氨基酸;均含有相对保守的AP2结合域,具有典型的植物AP2/ERF类转录因子特征。从氨基酸组成成分、理化性质、亲水性/疏水性和三级结构上分析显示,胡萝卜DcERF-B1-1和DcERF-B1-2转录因子亲水性大于疏水性,其氨基酸序列可能属于亲水性蛋白。空间结构分析显示,它们都具有1个α螺旋和3个β折叠。进化树分析显示,二者均属于AP2/ERF家族转录因子中ERF亚族的B1组。实时定量荧光PCR显示,在低温、干旱、盐胁迫的条件下, DcERF-B1-2转录因子比DcERF-B1-1转录因子对逆境的响应更大;在高温的条件下, DcERF-B1-1转录因子比DcERF-B1-2转录因子对逆境的响应更大。%AP2/ERF is an important family of transcription factors in higher plant, which encoded proteins in-volved in the development and signal transduction of abiotic/biotic resistance in higher plant. Theg39811 and g47170 gene sequences, which encoding two AP2/ERF transcription factors, were isolated based on transcrip-tome and genome sequence data of carrot (Daucus carota). TheDcERF-B1-1 (g39811) andDcERF-B1-2 (g47170) genes were cloned by RT-PCR method using cDNA as template from carrot cultivar ‘Heitianwucun’. Then, nucleic acid and deduced amino acid sequence, phylogenetic tree, and molecular modeling were predicted and analyzed. Sequence analysis indicated that the length of

  6. AP-42 REVISION: COKE OVENS

    Science.gov (United States)

    The document "Compilation of Air Pollutant Emission Factors" (AP-42) has been published by the U. S. Environmental Protection Agency (EPA) since 1972. Supplements to AP-42 have been routinely published to add new emission source categories and to update existing emission factor...

  7. Isolation and expression profiles analysis of AP2/ERF-B3 group transcription factor from Camellia sinensis%茶树AP2/ERF-B3类转录因子基因的克隆与表达特性分析

    Institute of Scientific and Technical Information of China (English)

    吴致君; 卢莉; 黎星辉; 房婉萍; 周琳; 谭国飞; 庄静

    2014-01-01

    植物在受到高温、低温、干旱和盐害等逆境胁迫时,ERF作为信号转导因子被诱导并调控其他抗逆基因的表达.研究茶树AP2/ERF-B3类转录因子在不同茶树品种间的分子特性、组织表达和逆境响应情况,将有助于了解AP2/ERF转录因子在茶树逆境调控中的作用.以2个茶树品种‘安吉白茶’和‘迎霜’为试验材料,通过RT-PCR方法分别从2种茶树的cDNA中克隆得到CsERF-B3基因.利用实时定量PCR技术检测该基因在茶树根、茎、叶、花各组织和4种非生物逆境胁迫处理(4 ℃低温、38℃高温、200 g·L-1 PEG干旱处理、200 mmol· L-1 NaCl)中的表达情况.结果表明:2种茶树中CsERF-B3基因全长均为639 bp,编码212个氨基酸,含有保守的AP2结合域,是植物典型的AP2/ERF家族转录因子;该转录因子属于AP2/ERF转录因子家族中的ERF亚族B3组;该转录因子是亲水性蛋白,无序化特征明显,并与拟南芥AtERF1具有相似的三级结构;该基因在茶树根中表达量最高,并且均能快速响应高温(38℃)、低温(4℃)和高盐(200 mmol·L-1 NaCl)等非生物逆境胁迫.结论:环境中常见非生物胁迫可诱导茶树中CsERF-B3基因的表达,表明该AP2/ERF-B3类转录因子在茶树非生物胁迫中起着重要调节作用.

  8. [Topical contraceptives].

    Science.gov (United States)

    Alipov, V I; Korkhov, V V

    1982-02-01

    Recently there has been little interest in topical contraceptives. The most popular are the cervical cap and the diaphragm. Other types of mechanical contraceptive devices are being investigated. Standley and Kessler have developed a device for introduction into the cervical canal with a reservoir of spermatocide, it does not block the flow of blood during menstruation. New models of vaginal rings are also being developed which are simple enough for self-insertion and also contain a reservoir of spermatocide. Work is being done on spermatocide-containing sponges in many countries. Another project being investigated is the possibility of using natural proteins, collagens, and other substances which absorb spermatozoids. The ancients used various vaginal suppositories to kill spermatozoids; in the late 19th century quinine sulfate was used for this, and a variety of substances have been used recently. These spermicidal creams also have the advantage of acting as anti-infectious agents in many cases. But they do have some negative effects. They are about 85% effective, are local irritants, and some cause discomfort during intercourse. And it is possible that some are resorbed by the body and act on the liver and other organs. Vaginal globules and suppositories are also popular. The "Kontraceptin-T" brand contains quinosol, boric acid, and tannin. There are also foaming tablets which are mixed with water and then introduced. New locally-active chemical substances are being developed in Japan, West Germany, and the USSR. Kontraceptin-E contains paranonyl-phenoxypolyethylene glycol and sodium dioctylsulfosuccinate. The "Norforks" and other preparations contain mercurial compounds which may turn out to be harmful. The future promises the development of products which will act to prevent fertilization by acting on the hyaluronidase and the acrosine of the spermatozoid, thus preventing it from penetrating the ovum. It would be best to find enzyme inhibitors which are

  9. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-03-04

    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP.

  10. Linguistic Extensions of Topic Models

    Science.gov (United States)

    Boyd-Graber, Jordan

    2010-01-01

    Topic models like latent Dirichlet allocation (LDA) provide a framework for analyzing large datasets where observations are collected into groups. Although topic modeling has been fruitfully applied to problems social science, biology, and computer vision, it has been most widely used to model datasets where documents are modeled as exchangeable…

  11. Enfrentamento da violência doméstica por um grupo de mulheres após a denúncia A group of women coping with domestic violence after the denouncements

    Directory of Open Access Journals (Sweden)

    Eriza de Oliveira Parente

    2009-08-01

    Full Text Available Este estudo analisa as formas de enfrentamento encontradas por mulheres vítimas da violência doméstica, no decorrer e após a denúncia, em Fortaleza, Ceará, Brasil. Com abordagem qualitativa e caracterizando-se como pesquisa participante, nove mulheres, que se denominaram vítimas de violência doméstica e romperam com o silêncio fazendo a denúncia, participaram do estudo, de agosto a outubro de 2007, no Centro Estadual de Referência e Apoio à Mulher (CERAM. Grupo focal, anotações no diário de campo e observações foram as técnicas de coleta de dados, e estes foram submetidos à análise categorial e discutidos com suporte no Modelo de Crenças em Saúde. O medo, a falta de apoio, a dependência financeira, a vergonha, a maternidade e a cultura emergiram do estudo como percepção da suscetibilidade e das barreiras identificadas; o risco de morte foi percebido como severidade; o apoio da família e de amigos, a lei, os setores de proteção e Deus foram os benefícios relatados, configurando-se como formas de enfrentamento. Para elas, a violência ultrapassou os limites da natureza física, pois envolveu sofrimento psicológico, emocional, econômico e social. Desse modo, essas mulheres romperam o silêncio presente nas relações violentas e procuraram estratégias para minimizar o sofrimento.This paper provides an analysis of confrontation ways that female victims of domestic violence found during and after denunciation in Fortaleza, Ceará, Brazil. Nine women self-denominated victims of violence who broke silence and denunciated their aggressors participated in this qualitative and participative research from August to October 2007, in the State Center of Reference for Women Support (CERAM. The data collectors used the focal group, the reports in the field diary and observation, and the data were submitted to categorical analysis, and discussed based on Health Belief Model. Fear, lack of support, financial dependence, shame

  12. Do scientists trace hot topics?

    CERN Document Server

    Wei, Tian; Wu, Chensheng; Yan, XiaoYong; Fan, Ying; Di, Zengru; Wu, Jinshan

    2013-01-01

    Do scientists follow hot topics in their scientific investigations? In this paper, by performing analysis to papers published in the American Physical Society (APS) Physical Review journals, it is found that papers are more likely to be attracted by hot fields, where the hotness of a field is measured by the number of papers belonging to the field. This indicates that scientists generally do follow hot topics. However, there are qualitative differences among scientists from various countries, among research works regarding different number of authors, different number of affiliations and different number of references. These observations could be valuable for policy makers when deciding research funding and also for individual researchers when searching for scientific projects.

  13. Meet the APS Journal Editors

    Science.gov (United States)

    2016-05-01

    The Editors of the APS journals invite you to join them for conversation. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  14. Randomized, parallel-group, double-blind, controlled study to evaluate the efficacy and safety of carbohydrate-derived fulvic acid in topical treatment of eczema

    Directory of Open Access Journals (Sweden)

    Gandy JJ

    2011-09-01

    Full Text Available Justin J Gandy, Jacques R Snyman, Constance EJ van RensburgDepartment of Pharmacology, Faculty of Health Sciences, University of Pretoria, Pretoria, South AfricaBackground: The purpose of this study was to evaluate the efficacy and safety of carbohydrate-derived fulvic acid (CHD-FA in the treatment of eczema in patients two years and older.Methods: In this single-center, double-blind, placebo-controlled, parallel-group comparative study, 36 volunteers with predetermined eczema were randomly assigned to receive either the study drug or placebo twice daily for four weeks.Results: All safety parameters remained within normal limits, with no significant differences in either group. Significant differences were observed for both severity and erythema in the placebo and CHD-FA treated groups, and a significant difference was observed for scaling in the placebo-treated group. With regard to the investigator assessment of global response to treatment, a significant improvement was observed in the CHD-FA group when compared with the placebo group. A statistically significant decrease in visual analog scale score was observed in both groups, when comparing the baseline with the final results.Conclusion: CHD-FA was well tolerated, with no difference in reported side effects other than a short-lived burning sensation on application. CHD-FA significantly improved some aspects of eczema. Investigator assessment of global response to treatment with CHD-FA was significantly better than that with emollient therapy alone. The results of this small exploratory study suggest that CHD-FA warrants further investigation in the treatment of eczema.Keywords: fulvic acid, eczema, anti-inflammatory, efficacy, safety

  15. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  16. Foreword: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik

    2014-05-01

    This second joint conference between the APS Topical Group on Shock Compression of Condensed Matter and the International Association for the Advancement of High Pressure Science and Technology (AIRAPT) demonstrates that static and dynamic compression of condensed matter continues to be a vibrant field of science and engineering. It is also by its nature an interdisciplinary field, incorporating chemistry, materials science, solid mechanics, plasma physics, and condensed matter physics, and utilizes theoretical, computational, and experimental tools. Recent years have brought about many advances in loading platforms, diagnostics, and computations that are leading to the emergence of many new avenues of research. These advances are also breathing new life into traditional topics such as equations of state, phase transformations, and chemistry at extreme conditions. The plenary lectures by Gennady Kanel, Karl Syassen, David Ceperley, Jon Eggert, Duck Young Kim, and Richard Kraus spanned the disciplines of static and dynamic high pressure physics and illustrated the breadth of the field. They also showed that interesting and important problems remain for researchers of the future to solve. The main guiding principal in the organization of this conference was to intertwine static and dynamical experimental alongside computational and theoretical studies of similar materials. To achieve this goal, we arranged the conference to include static, dynamic, and computational components in the same sessions, quite often taking presenters out of their comfort zone. The three special sessions on Deep Carbon Budget (organized by Giulia Galli and Rus Hemley), High Energy Density Materials (organized by Raymond Jeanloz and Jon Eggert), and Dynamic Response of Materials (organized by Yogendra Gupta and John Sarrao) furthered this guiding principal. We also endeavored to represent the breadth of static and dynamic high pressure science and technology, notably beyond that done at

  17. Topics in field theory

    CERN Document Server

    Karpilovsky, G

    1989-01-01

    This monograph gives a systematic account of certain important topics pertaining to field theory, including the central ideas, basic results and fundamental methods.Avoiding excessive technical detail, the book is intended for the student who has completed the equivalent of a standard first-year graduate algebra course. Thus it is assumed that the reader is familiar with basic ring-theoretic and group-theoretic concepts. A chapter on algebraic preliminaries is included, as well as a fairly large bibliography of works which are either directly relevant to the text or offer supplementary material of interest.

  18. FRANX. Application for analysis and quantification of the APS fire; FRANK. Aplicacion para el analisis y cuantificacion de los APS de incendios

    Energy Technology Data Exchange (ETDEWEB)

    Snchez, A.; Osorio, F.; Ontoso, N.

    2014-07-01

    The FRANX application has been developed by EPRI within the Risk and Reliability User Group in order to facilitate the process of quantification and updating APS Fire (also covers floods and earthquakes). By applying fire scenarios are quantified in the central integrating the tasks performed during the APS fire. This paper describes the main features of the program to allow quantification of an APS Fire. (Author)

  19. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  20. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  1. The AP-2 family of transcription factors

    OpenAIRE

    Eckert, Dawid; Buhl, Sandra; Weber, Susanne; Jäger, Richard; Schorle, Hubert

    2005-01-01

    The AP-2 family of transcription factors consists of five different proteins in humans and mice: AP-2α, AP-2β, AP-2γ, AP-2δ and AP-2ε. Frogs and fish have known orthologs of some but not all of these proteins, and homologs of the family are also found in protochordates, insects and nematodes. The proteins have a characteristic helix-span-helix motif at the carboxyl terminus, which, together with a central basic region, mediates dimerization and DNA binding. The amino terminus contains the tra...

  2. Environmental Sensitivity in Nuclear Emergencies in Rural and Semi-natural Environments. Report of Working Group 8, Environmental Sensitivity of EMRAS II Topical Heading Approaches for Assessing Emergency Situations. Environmental Modelling for RAdiation Safety (EMRAS II) Programme

    International Nuclear Information System (INIS)

    Environmental assessment models are used for evaluating the radiological impact of actual and potential releases of radionuclides to the environment. They are essential tools for use in the regulatory control of routine discharges to the environment and also in planning measures to be taken in the event of accidental releases. They are also used for predicting the impact of releases which may occur far into the future, for example, from underground radioactive waste repositories. It is important to verify, to the extent possible, the reliability of the predictions of such models by comparison with measured values in the environment or by comparing them with the predictions of other models. The IAEA has been organizing programmes of international model testing since the 1980s. The programmes have contributed to a general improvement in models, in transfer data and in the capabilities of modellers in Member States. IAEA publications on this subject over the past three decades demonstrate the comprehensive nature of the programmes and record the associated advances which have been made. From 2009 to 2011, the IAEA organized a programme entitled Environmental Modelling for RAdiation Safety (EMRAS II), which concentrated on the improvement of environmental transfer models and the development of reference approaches to estimate the radiological impacts on humans, as well as on flora and fauna, arising from radionuclides in the environment. The following topics were addressed in nine working groups: Reference Approaches for Human Dose Assessment - Working Group 1: Reference Methodologies for Controlling Discharges of Routine Releases; - Working Group 2: Reference Approaches to Modelling for Management and Remediation at NORM and Legacy Sites; - Working Group 3: Reference Models for Waste Disposal Reference Approaches for Biota Dose Assessment; - Working Group 4: Biota Modelling; - Working Group 5: Wildlife Transfer Coefficient Handbook; - Working Group 6: Biota Dose

  3. Panel Discussion : Report of the APS Ad-Hoc Committee on LGBT Issues

    Science.gov (United States)

    Atherton, Tim; Barthelemy, Ramon; Garmon, Savannah; Reeves, Kyle; APS Ad-Hoc Committee on LGBT Issues Team

    Following the presentation of the findings and recommendations of the APS Ad-Hoc Committee on LGBT Issues (C-LGBT) by Committee Chair Michael Falk, a panel discussion will be held featuring several members of the committee. The discussion will focus on how APS can best ensure the recommendations of the committee are carried out in a timely fashion and other ideas on future APS efforts toward LGBT inclusion in physics. Discussion topics will also include the research and other input that shaped the committee's findings and recommendations.

  4. PREFACE: CEWQO Topical Issue CEWQO Topical Issue

    Science.gov (United States)

    Bozic, Mirjana; Man'ko, Margarita

    2009-09-01

    Sascha Wallentowitz), 2004 (Trieste, Italy, by Naseem Rahman and Sascha Wallentowitz), 2005 (Bilkent, Ankara, by Alexander Shumovsky), 2006 (Vienna, by Helmut Rauch), 2007 (Palermo, Italy, by Antonino Messina) and 2008 (Belgrade, by Mirjana Bozic). The CEWQO series developed in two directions following the rapid development of quantum optics and the transitional development of the scientific collaboration of Central European researchers with researchers from old and new emerging Central European countries, and from all over the world. The topics discussed at CEWQO 08 were divided into ten groups that aimed to cover the broad scope of modern quantum optics: Fundamental aspects of quantum optics and quantum mechanics Single photons and photon pairs Cavity and circuit QED Atoms in intense fields Neutron, atom and molecular quantum optics Quantum gases and fluids Coherence, entanglement and decoherence Optical properties of condensed matter and nanostructures Open quantum systems and chaos Quantum information processing Central European Workshops on Quantum Optics realize and are consistent with a wider idea, and a social, economical, cultural and political program promoted since 1989 by the Central European Initiative (CEI), the main goal of which was to help transition countries in Central Europe to become closer to the EU. The resulting support of the CEI, first obtained thanks to the scientific reputation, organizing activities, and efforts of Helmut Rauch, has been very important for the organization of the CEWQO in recent years, particularly in 2008. The support of the Sixth and Seventh Framework Programs of the European Commission was also very important. A short review of papers in this topical issue A principal role in this topical issue is played by the photon. Vuletic et al describe the mapping of the photon-polarization state onto a single collective-spin excitation (magnon) shared between two atomic ensembles. A heralded quantum memory based on this mapping is

  5. The APS control system network

    International Nuclear Information System (INIS)

    The APS accelerator control system is a distributed system consisting of operator interfaces, a network, and computer-controlled interfaces to hardware. This implementation of a control system has come to be called the open-quotes Standard Model.close quotes The operator interface is a UNDC-based workstation with an X-windows graphical user interface. The workstation may be located at any point on the facility network and maintain full functionality. The function of the network is to provide a generalized communication path between the host computers, operator workstations, input/output crates, and other hardware that comprise the control system. The crate or input/output controller (IOC) provides direct control and input/output interfaces for each accelerator subsystem. The network is an integral part of all modem control systems and network performance will determine many characteristics of a control system. This paper will describe the overall APS network and examine the APS control system network in detail. Metrics are provided on the performance of the system under various conditions

  6. Preparing Students for the AP Psychology Exam

    Science.gov (United States)

    Whitlock, Kristin

    2013-01-01

    The Advanced Placement Psychology exam is one of the fastest growing exams offered by the College Board. The average percent of change in the number of students taking this exam over the past five years is 12.4%. With 238,962 students taking the exam in 2013, the AP Psychology exam is the sixth largest exam, surpassing AP Biology and AP World…

  7. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  8. Research on Automatic Topic Visual Clustering in the Group Argument Support Systems%群体研讨支持系统中研讨主题的自动可视化聚类研究

    Institute of Scientific and Technical Information of China (English)

    李嘉; 张朋柱; 蒋御柱

    2009-01-01

    群体研讨支持系统(Group Argument Support Systems, GASS)的匿名、并行输入及自动化记录群体发言的特征,在辅助群体产生大量有价值观点的同时,也常常导致"信息过载"和"知识断层".介绍了一个自动化聚类工具来增强群体的认知能力并提高电子会议的效率.首先识别了GASS环境下自动化主题聚类的一些挑战并回顾了相关研究,结合GASS的研讨模式、研讨文本特征及中文文本分析的要求,给出了中文分词、停词表处理以及有效词语识别的文本分析技术.提出基于主题分析的特征向量选择方法,并基于自组织映射的神经网络思想,用Java语言设计并开发了一个自动聚类工具.实验表明,该工具可以达到0.28的聚类准确率,0.35的聚类全面率,产生0.83的聚类错误率.%In Group Argument Support Systems (GASS), the characteristics of parallel and anonymous data entry often result in Information overload and knowledge breakout while improving group performance. This research presents an automatic topic clustering tool to enhance participants' cognitive ability and increase the productivity of electronic meetings. Firstly, we identify some challenges to automatic textual clustering and review the related research. Secondly, we describe a textual analysis method involving Chinese segment, stop list and effective terms identification. Thirdly, we propose a topic analysis method to obtain eigenvector. Fourthly, we design and implement an automatic clustering tool based on the self-Organization Map by Java. Experiment indicated that the tool can achieve clustering recall of 0.35, clustering precision of 0.28 and clustering error of 0.83. Finally, we give some discussions and future research directions.

  9. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  10. Topic and Textual Coherence

    Institute of Scientific and Technical Information of China (English)

    何明烈; 戢焕奇

    2008-01-01

    Based on the investigation of the origin and definition of topic as well as the classification of textual coherence, this paper ana-lyzes the function of topic to non-coherence, imphcit coherence and explicit coherence, and concludes that topic relevance is the primary cri-terion for textual coherence.

  11. APS high heat load monochromator

    International Nuclear Information System (INIS)

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  12. Research on the Grouping Discussion-based Teaching Ap-proach for VB Programming Design%VB程序设计课程分组讨论式教学方式的研究

    Institute of Scientific and Technical Information of China (English)

    王慧娟

    2014-01-01

    Visual Basic is an entry-level programming language easy to learn, generally as a computer public course for non-computer majors. In view of the difficulties which economic management non-computer majors are faced with in learning VB programming language, this paper put forward the grouping dis-cussion-based teaching approach, in order to help students better grasp the VB course.%Visual Basic是一门简单易学的入门级程序语言,一般作为非计算机专业的计算机公共课程。针对经管类等非计算机专业学生在学习VB程序语言中遇到的困难,提出了分组讨论式教学的方式,帮助学生更好地掌握VB这门课程。

  13. An evaluation of the B&W Owners Group BAW-10182 topical report: Justification for increasing the engineered safety features actuation system on-line test intervals. Technical evaluation report

    Energy Technology Data Exchange (ETDEWEB)

    Smith, C.L.; Hansen, J.L.

    1993-09-01

    This Technical Evaluation Report provides an evaluation of the Babcock and Wilcox Owners Group (B&WOG) Technical Specifications Committee Topical Report BAW-10182, entitled, ``Justification for Increasing Engineered Safety Features Actuation System (ESFAS) On-Line Test Intervals.`` This evaluation was performed by the Idaho National Engineering Laboratory in support of the Nuclear Regulatory Commission. The BAW-10182 report presents justification for the extension of on-line test intervals from the existing one-month interval to a three-month interval for the ESFAS system. In the BAW-10182 report, the B&WOG stated that ``{hor_ellipsis}the B&WOG proposes to increase the ESFAS test interval from one to three months and concludes that the effect on plant risk is insignificant.`` The proposed extension was based upon risk-based [i.e., probabilistic risk assessment (PRA)] methods such as reliability block diagrams, uncertainty analyses, and time-dependent system availability analyses. This use of PRA methods requires a detailed evaluation to determine whether the chosen methods and their application are valid in the context of the proposed test interval extension. The results of the evaluation agreed that the effect on plant risk is small if the ESFAS test interval is extended to three months for the ESFAS designs that were evaluated.

  14. Topical report review status

    International Nuclear Information System (INIS)

    A Topical Report Review Status is scheduled to be published semi-annually. The primary purpose of this document is to provide periodic progress reports of on-going topical report reviews, to identify those topical reports for which the Nuclear Regulatory Commission (NRC) staff review has been completed and, to the extent practicable, to provide NRC management with sufficient information regarding the conduct of the topical report program to permit taking whatever actions deemed necessary or appropriate. This document is also intended to be a source of information to NRC Licensing Project Managers and other NRC personnel regarding the status of topical reports which may be referenced in applications for which they have responsibility. This status report is published primarily for internal NRC use in managing the topical report program, but is also used by NRC to advise the industry of report review status

  15. [Topical therapy of rosacea].

    Science.gov (United States)

    Schöfer, H

    2013-07-01

    Metronidazole and azelaic acid are the only topical medications approved for rosacea. All other topical treatments for rosacea and its special forms are used off-label. Topical steroids are not indicated in rosacea, because of their side effects (induction of steroid rosacea, high risk of facial skin atrophy, and high risk of rebound after cessation of therapy). Topical as well as systemic steroids are allowed only as initial and short term therapy for acute forms of rosacea (e.g. rosacea fulminans). Papular and pustular rosacea is the major indication for topical therapy. Sebaceous gland and connective tissue hyperplasia in glandular-hypertrophic rosacea as well as erythema in erythematous rosacea do not respond well to topical measures. A new active substance, the alpha-2-adrenoreceptor agonist brimonidine, will be approved soon for the topical treatment of erythema in rosacea. All severe forms of rosacea should initially be treated with a combination of topical and systemic agents. After improvement of the clinical symptoms, topical treatment alone is usually adequate to maintain the control.

  16. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin

    2012-01-01

    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  17. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  18. Syntacticized topics in Kurmuk

    DEFF Research Database (Denmark)

    Andersen, Torben

    2015-01-01

    . The grammatical relation of the topic is expressed by a voice-like inflection of the verb, here called orientation. While subject-orientation is morphologically unmarked, object-oriented and adjunct-oriented verbs are marked by a subject suffix or by a suffix indicating that the topic is not subject, and adjunct...

  19. Salicylic Acid Topical

    Science.gov (United States)

    ... skin blemishes in people who have acne. Topical salicylic acid is also used to treat skin conditions that involve scaling or overgrowth of skin ... water for 15 minutes.Do not apply topical salicylic acid to skin that is broken, red, swollen, irritated, or infected. ...

  20. Topic Identification in Discourse

    CERN Document Server

    Chen, K

    1995-01-01

    This paper proposes a corpus-based language model for topic identification. We analyze the association of noun-noun and noun-verb pairs in LOB Corpus. The word association norms are based on three factors: 1) word importance, 2) pair co-occurrence, and 3) distance. They are trained on the paragraph and sentence levels for noun-noun and noun-verb pairs, respectively. Under the topic coherence postulation, the nouns that have the strongest connectivities with the other nouns and verbs in the discourse form the preferred topic set. The collocational semantics then is used to identify the topics from paragraphs and to discuss the topic shift phenomenon among paragraphs.

  1. Berberine inhibits cyclin D1 expression via suppressed binding of AP-1 transcription factors to CCND1 AP-1 motif

    Institute of Scientific and Technical Information of China (English)

    Ye LUO; Yu HAO; Tai-ping SHI; Wei-wei DENG; Na LI

    2008-01-01

    Aim: To verify the suppressive effect of berberine on the proliferation of the human pulmonary giant cell carcinoma cell line PG and to demonstrate the mecha-nisms behind the antitumoral effects of berberine. Methods: The proliferative effects of PG cells were detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide colorimetry. The cell cycle was examined by flow cytometry. The expression level of cyclin D1 was detected by RT-PCR. The activities of the activating protein-1 (AP-1) and NF-κB signaling pathways related to cyclin D1 were examined by luciferase assay. The cytoplasmic level of c-Jun was detected by Western blot analysis. An electrophoretic mobility shift assay was used to examiae the binding of transcription factors to the cyclin D1 gene (CCNDl) AP-1 motif. Results: The results showed that the proliferation of PG cells treated with different concentrations (10, 20, and 40 μg/mL) of berberine for 24 and 48 h was suppressed significantly compared to the control group. After treatment with berberine, the proportion of PG cells at the G0/G1 phase increased, while cells at the S and G2/M phases decreased. Berberine could inhibit the expression of cyclin D1 in PG cells. Berberine inhibited the activity of the AP-1 signaling pathway, but had no significant effect on the NF-κB signaling pathway. Berberine suppressed the expression of c-Jun and decreased the binding of tran-scription factors to the CCND1 AP-1 motif. Conclusion: Berberine suppresses the activity of the AP-1 signaling pathway and decreases the binding of transcrip-tion factors to the CCND1 AP-1 motif. This is one of the important mechanisms behind the antitumoral effects of berberine as a regulator of cyclin D1.

  2. Duplication of AP1 within the Spinacia oleracea L. AP1/FUL clade is followed by rapid amino acid and regulatory evolution.

    Science.gov (United States)

    Sather, D Noah; Golenberg, Edward M

    2009-02-01

    The AP1/FUL clade of MADS box genes have undergone multiple duplication events among angiosperm species. While initially identified as having floral meristem identity and floral organ identity function in Arabidopsis, the role of AP1 homologs does not appear to be universally conserved even among eudicots. In comparison, the role of FRUITFULL has not been extensively explored in non-model species. We report on the isolation of three AP1/FUL genes from cultivated spinach, Spinacia oleracea L. Two genes, designated SpAPETALA1-1 (SpAP1-1) and SpAPETALA1-2 (SpAP1-2), cluster as paralogous genes within the Caryophyllales AP1 clade. They are highly differentiated in the 3', carboxyl-end encoding region of the gene following the third amphipathic alpha-helix region, while still retaining some elements of a signature AP1 carboxyl motifs. In situ hybridization studies also demonstrate that the two paralogs have evolved different temporal and spatial expression patterns, and that neither gene is expressed in the developing sepal whorl, suggesting that the AP1 floral organ identity function is not conserved in spinach. The spinach FRUITFULL homolog, SpFRUITFULL (SpFUL), has retained the conserved motif and groups with Caryophyllales FRUITFULL homologs. SpFUL is expressed in leaf as well as in floral tissue, and shows strong expression late in flower development, particularly in the tapetal layer in males, and in the endothecium layer and stigma, in the females. The combined evidence of high rates of non-synonymous substitutions and differential expression patterns supports a scenario in which the AP1 homologs in the spinach AP1/FUL gene family have experienced rapid evolution following duplication.

  3. Edema pulmonar após absorção sistêmica de fenilefrina tópica durante cirurgia oftalmológica em criança: relato de caso Edema pulmonar después de absorción de fenilefrina tópica durante cirugía oftalmológica en niño: relato de caso Pulmonary edema after topic phenylephrine absorption during pediatric eye surgery: case report

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Savioli Fischer

    2004-12-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Soluções tópicas de fenilefrina são empregadas freqüentemente em cirurgia oftalmológica com o objetivo de promover descongestionamento capilar ou dilatação pupilar. Este artigo descreve um caso de hipertensão arterial grave seguida de edema pulmonar durante cirurgia para correção de estrabismo. A provável causa desta complicação foi a absorção sistêmica de fenilefrina administrada por via tópica ocular. O objetivo do relato é a discussão de meios de prevenção desta complicação, assim como do tratamento mais adequado. RELATO DO CASO: Paciente do sexo masculino, 12 anos, 50 kg, estado físico ASA I, admitido no centro cirúrgico para realização de correção de estrabismo convergente bilateral em regime ambulatorial. Foi submetido à anestesia geral venosa e a manutenção, realizada com infusão contínua de remifentanil e propofol. Após colocação do bléfaro, 6 gotas de fenilefrina a 10% foram aplicadas por via tópica. Decorridos 5 minutos do início da cirurgia, o paciente desenvolveu hipertensão arterial e taquicardia, refratárias à elevação da dose administrada de remifentanil e propofol, bem como à administração de droperidol. O controle da pressão arterial e da freqüência cardíaca foi possível após o emprego do sevoflurano, mas houve diminuição da saturação de oxigênio e o aparecimento de crepitações pulmonares difusas por provável desenvolvimento de edema pulmonar agudo. A furosemida foi administrada e os anestésicos foram suspensos. O paciente apresentou melhora progressiva do quadro pulmonar, enquanto os valores de pressão arterial permaneciam dentro da normalidade. Recebeu alta da sala de recuperação pós-anestésica 6 horas após a cirurgia, quando se apresentava em ventilação espontânea em ar ambiente, com saturação de O2, ausculta pulmonar e pressão arterial normais. CONCLUSÕES: A administração de fenilefrina tópica deve ser realizada com

  4. Coaching Strategies for AP: Building a Successful AP European History Program

    Science.gov (United States)

    Fornaciari, Jim

    2014-01-01

    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's…

  5. AP Courses Get Audited for Quality

    Science.gov (United States)

    Ashford, Ellie

    2007-01-01

    As the college admissions process has gotten much more competitive, the number of high school students taking Advanced Placement (AP) courses has soared. At the same time, policymakers and education leaders seek to get more minorities and students not on the college track to sign up for AP and other rigorous classes. But as high schools have…

  6. AP-42 ADDITIONS AND REVISIONS - WILDLAND FIRES

    Science.gov (United States)

    This project is aimed at consolidating, selecting, and disseminating the most appropriate data and methods for estimating air emissions from wildfires and prescribed burns. The product will replace a current section of AP-42, but may not take the precise form of an AP-42 secti...

  7. The status of APS, BESSRC, and NEET.

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Dunford, R. W.; Esbensen, H.; Gemmell, D. S.; Kanter, E. P.; Kraessig, B.; Rutt, U.; Southworth, S. H.

    1999-03-10

    We present a brief summary of the current status of the Advanced Photon Source (APS) at Argonne National Laboratory and of the facilities at two of the APS sectors operated by the Basic Energy Sciences Synchrotrons Radiation Center (BESSRC). This is followed by a report on recent measurements at BESSRC on the phenomenon of Nuclear Excitation by Electronic Transition (NEET).

  8. APS undulator radiation: First results

    International Nuclear Information System (INIS)

    The first undulator radiation has been extracted from the Advanced Photon Source (APS). The results from the characterization of this radiation are very satisfactory. With the undulator set at a gap of 15.8 mm (K=1.61), harmonics as high as the 17th were observed using a crystal spectrometer. The angular distribution of the third-harmonic radiation was measured, and the source was imaged using a zone plate to determine the particle beam emittance. The horizontal beam emittance was found to be 6.9 ± 1.0 nm-rad, and the vertical emittance coupling was found to be less than 3%. The absolute spectral flux was measured over a wide range of photon energies, and it agrees remarkably well with the theoretical calculations based on the measured undulator magnetic field profile and the measured beam emittance. These results indicate that both the emittance of the electron beam and the undulator magnetic field quality exceed the original specifications

  9. An Insider's History of Some of the Significant Changes In the APS from the 1960s to Today

    Science.gov (United States)

    Schwartz, Brian

    2014-03-01

    It has been over 50 years since I first joined the American Physical Society. A lot has changed. The APS in the 60s did not have a single Forum and all divisions were related to sub-field of physics research plus the History of Physics Division. The APS governance and meeting's structure did not provide for issues relate to physics and society, undergraduate and graduate education, minorities, women, industrial physics, international physics, communication of science, and many more subjects quite typical of APS in 2014. From the start, I was a very active member of APS and one of the original petitioners for the Division on Physics and Society. Ultimately this led to the APS Forum structure, the Panel on Public Affairs and many APS formal committees. Two of the major impetuses for change in the late 60s were the need to debate the role of science in the unpopular war in Vietnam and the overproduction and poor employment prospects for new Ph.D.s. I, and colleagues, (with little original encouragement from the APS leadership), arranged for the discussion on many new topics at the meeting and proposed changes within the governance of the Society. In the late 1980s I joined the APS and was involved in many changes over the next 20 years. ultimately as Associate Executive Officer and Director of the APS Centennial in 1999. As indicated earlier, I've been with the APS for over 50 years and will present its history as a participant-insider. Topic covered include my surprise election to the APS governance in 1972, the establishment of the Forum on Physics and Society (and the restrictions imposed on its governance), my role as the father (or mother) of the women's movement at APS, the complexities and politics of the move of APS headquarters from New York to College Park, the establishment of the tabloid APS News and many more subjects. Currently I am producing staged-readings of science-based plays at the March and April 2014 APS meetings for the Forum on History of

  10. Topics in Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Some topics in nuclear astrophysics are discussed, e.g.: highly evolved stellar cores, stellar evolution (through the temperature analysis of stellar surface), nucleosynthesis and finally the solar neutrino problem. (L.C.)

  11. Diclofenac Topical (osteoarthritis pain)

    Science.gov (United States)

    ... should know that you should not apply sunscreens, cosmetics, lotions, moisturizers, insect repellents, or other topical medications ... that is bloody or looks like coffee grounds slow, shallow, or irregular breathing hives itching difficulty breathing ...

  12. Advanced Topics in Aerodynamics

    DEFF Research Database (Denmark)

    Filippone, Antonino

    1999-01-01

    "Advanced Topics in Aerodynamics" is a comprehensive electronic guide to aerodynamics,computational fluid dynamics, aeronautics, aerospace propulsion systems, design and relatedtechnology. We report data, tables, graphics, sketches,examples, results, photos, technical andscientific literature, for...

  13. Supplemental topics on voids

    Energy Technology Data Exchange (ETDEWEB)

    Rood, H.J.

    1988-09-01

    Several topics concerning voids are presented, supplementing the report of Rood (1988). The discovery of the Coma supercluster and void and the recognition of the cosmological significance of superclusters and voids are reviewed. Galaxy redshift surveys and redshift surveys for the Abell clusters and very distant objects are discussed. Solar system and extragalactic dynamics are examined. Also, topics for future observational research on voids are recommended. 50 references.

  14. Topical treatment of melasma

    Directory of Open Access Journals (Sweden)

    Bandyopadhyay Debabrata

    2009-01-01

    Full Text Available Melasma is a common hypermelanotic disorder affecting the face that is associated with considerable psychological impacts. The management of melasma is challenging and requires a long-term treatment plan. In addition to avoidance of aggravating factors like oral pills and ultraviolet exposure, topical therapy has remained the mainstay of treatment. Multiple options for topical treatment are available, of which hydroquinone (HQ is the most commonly prescribed agent. Besides HQ, other topical agents for which varying degrees of evidence for clinical efficacy exist include azelaic acid, kojic acid, retinoids, topical steroids, glycolic acid, mequinol, and arbutin. Topical medications modify various stages of melanogenesis, the most common mode of action being inhibition of the enzyme, tyrosinase. Combination therapy is the preferred mode of treatment for the synergism and reduction of untoward effects. The most popular combination consists of HQ, a topical steroid, and retinoic acid. Prolonged HQ usage may lead to untoward effects like depigmentation and exogenous ochronosis. The search for safer alternatives has given rise to the development of many newer agents, several of them from natural sources. Well-designed controlled clinical trials are needed to clarify their role in the routine management of melasma.

  15. Topical Drugs for Pain Relief

    Directory of Open Access Journals (Sweden)

    Anjali Srinivasan

    2015-03-01

    Full Text Available Topical therapy helps patients with oral and perioral pain problems such as ulcers, burning mouth syndrome, temporomandibular disorders, neuromas, neuropathies and neuralgias. Topical drugs used in the field of dentistry are topical anaesthetics, topical analgesics, topical antibiotics and topical corticosteroids. It provides symptomatic/curative effect. Topical drugs are easy to apply, avoids hepatic first pass metabolism and more sites specific. But it can only be used for medications that require low plasma concentrations to achieve a therapeutic effect.

  16. Implicit stage topics

    Directory of Open Access Journals (Sweden)

    Karen Lahousse

    2008-04-01

    Full Text Available Il a souvent été proposé que les éléments spatio-temporels en position initiale de phrase spécifient le cadre de l’événement dénoté par la proposition et ont une interprétation thématique ou topicale. Alors que les topiques spatio-temporels explicites ont souvent été étudiés, Erteschik-Schir (1997, 1999 propose l’idée que les topiques spatio-temporels, ou topiques scéniques (stage topics peuvent aussi être implicites.Dans cet article, nous offrons des arguments en faveur de la notion de topique scénique implicite. Nous montrons qu’un certain nombre de cas d’inversion nominale en français, une configuration syntaxique qui est favorisée par la présence d’un topique scénique explicite, s’expliquent par la présence d’un topique scénique implicite. Le fait que les topiques scéniques implicites interagissent avec la structure syntaxique de la même façon que les topiques scéniques explicites constitue un argument empirique en faveur de leur existence.It has often been proposed that sentence-initial spatio-temporal elements specify the frame in which the whole proposition takes place and are topical (i.e. thematic. Whereas considerable attention has been paid to explicit spatio-temporal topics, Erteschik-Shir (1997, 1999 argues that spatio-temporal topics, or stage topics, can also be implicit.In this article we provide evidence in favour of the notion of implicit stage topic. We show that a certain number of nominal inversion cases in French, a syntactic configuration which is triggered by the presence of an explicit stage topic, are explained by the presence of an implicit stage topic. The fact that implicit stage topics interact with syntactic structure the same way explicit stage topics do constitutes a strong empirical argument in favour of their existence.

  17. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded

  18. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.

    1999-08-12

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  19. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  20. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2016-09-14

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  1. Topical ketoprofen patch.

    Science.gov (United States)

    Mazières, Bernard

    2005-01-01

    Although oral nonsteroidal anti-inflammatory drugs (NSAIDs) are effective in the treatment of a variety of acute and chronic pain conditions, their use may be associated with serious systemic adverse effects, particularly gastrointestinal disorders. In order to minimise the incidence of systemic events related to such agents, topical NSAIDs have been developed. Topical NSAIDs, applied as gels, creams or sprays, penetrate the skin, subcutaneous fatty tissue and muscle in amounts that are sufficient to exert a therapeutic effect on peripheral and central mechanisms in the absence of high plasma concentrations. Data indicate that topical NSAIDs are effective at relieving pain in a number of acute and chronic pain indications. This review article discusses the pharmacokinetics, efficacy and tolerability of a new formulation of ketoprofen available as a topical patch. The topical patch containing ketoprofen 100mg as the active principle has been developed using a novel delivery system that dispenses therapeutic doses of the drug directly to the site of injury. Pharmacokinetic data indicate that although plasma levels of ketoprofen are higher when the drug is administered as a patch versus a gel, the total systemic bioavailability of ketoprofen 100 mg administered via a patch is no more than 10% of that reported for ketoprofen 100 mg administered orally. Because the patch facilitates ketoprofen delivery over a 24-hour period, the drug remains continually present in the tissue subjacent to the site of application. High tissue but low plasma ketoprofen concentrations mean that while tissue concentrations are high enough to exert a therapeutic effect, plasma concentrations remain low enough to not result in systemic adverse events caused by elevated serum NSAID levels. Phase III clinical trials in patients with non-articular rheumatism and traumatic painful soft tissue injuries showed that the topical ketoprofen patch was significantly more effective than placebo at

  2. Topics in Physical Mathematics

    CERN Document Server

    Marathe, Kishore

    2010-01-01

    This title adopts the view that physics is the primary driving force behind a number of developments in mathematics. Previously, science and mathematics were part of natural philosophy and many mathematical theories arose as a result of trying to understand natural phenomena. This situation changed at the beginning of last century as science and mathematics diverged. These two fields are collaborating once again; 'Topics in Mathematical Physics' takes the reader through this journey. The author discusses topics where the interaction of physical and mathematical theories has led to new points o

  3. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  4. Digital Social Network Mining for Topic Discovery

    Science.gov (United States)

    Moradianzadeh, Pooya; Mohi, Maryam; Sadighi Moshkenani, Mohsen

    Networked computers are expanding more and more around the world, and digital social networks becoming of great importance for many people's work and leisure. This paper mainly focused on discovering the topic of exchanging information in digital social network. In brief, our method is to use a hierarchical dictionary of related topics and words that mapped to a graph. Then, with comparing the extracted keywords from the context of social network with graph nodes, probability of relation between context and desired topics will be computed. This model can be used in many applications such as advertising, viral marketing and high-risk group detection.

  5. In situ gel-forming AP-57 peptide delivery system for cutaneous wound healing.

    Science.gov (United States)

    Li, Xiaoling; Fan, Rangrang; Tong, Aiping; Yang, Meijia; Deng, Jiaojiao; Zhou, Liangxue; Zhang, Xiaoning; Guo, Gang

    2015-11-10

    In situ gel-forming system as local drug delivery system in dermal traumas has generated a great interest. Accumulating evidence shows that antimicrobial peptides play pivotal roles in the process of wound healing. Here in this study, to explore the potential application of antimicrobial peptide in wound healing, biodegradable poly(L-lactic acid)-Pluronic L35-poly(L-lactic acid) (PLLA-L35-PLLA) was developed at first. Then based on this polymer, an injectable in situ gel-forming system composed of human antimicrobial peptides 57 (AP-57) loaded nanoparticles and thermosensitive hydrogel was prepared and applied for cutaneous wound healing. AP-57 peptides were enclosed with biocompatible nanoparticles (AP-57-NPs) with high drug loading and encapsulation efficiency. AP-57-NPs were further encapsulated in a thermosensitive hydrogel (AP-57-NPs-H) to facilitate its application in cutaneous wound repair. As a result, AP-57-NPs-H released AP-57 in an extended period and exhibited quite low cytotoxicity and high anti-oxidant activity in vitro. Moreover, AP-57-NPs-H was free-flowing liquid at room temperature, and can form non-flowing gel without any crosslink agent upon applied on the wounds. In vivo wound healing assay using full-thickness dermal defect model of SD rats indicated that AP-57-NPs-H could significantly promote wound healing. At day 14 after operation, AP-57-NPs-H treated group showed nearly complete wound closure of 96.78 ± 3.12%, whereas NS, NPs-H and AP-57-NPs group recovered by about 68.78 ± 4.93%, 81.96 ± 3.26% and 87.80 ± 4.62%, respectively. Histopathological examination suggested that AP-57-NPs-H could promote cutaneous wound healing through enhancing granulation tissue formation, increasing collagen deposition and promoting angiogenesis in the wound tissue. Therefore, AP-57-NPs-H might have potential application in wound healing.

  6. Comparison of topical tretinoin and betamethasone in oral lichen planus

    Directory of Open Access Journals (Sweden)

    Kar H

    1996-01-01

    Full Text Available Thirty-one patients of oral lichen planus were enrolled in this study and two groups were made. Group 1 consisting of 16 patients who applied topical tretinoin 0.05% and Group 2 comprising of 15 patients who were given topical betamethasone dipropionate 0.05%. The patients applying tretinoin showed statistically significant improvement as compared to patients applying betamethasone.

  7. Research on Network Public Opinion Evolution Topics Subdivision and Grouping Law%网络舆情信息的衍变话题细分及组配规律研究

    Institute of Scientific and Technical Information of China (English)

    黄微; 李瑞; 高俊峰

    2016-01-01

    文章以新浪网站真实数据为基础,通过识别热门事件衍变子话题的互信息度构建衍变话题网络,进而通过复杂网络分析的方法测度衍变话题网络中结点的中介中心性以及可视化衍变话题的次第组配网络拓扑,达到细分热点事件衍变话题,明确其组配规律的研究目标,以期为热点事件舆情的危机定性、技术干预、舆情跟踪反馈等工作提供实践依据。%This paper takes the real data in Sina as object, constructing the topic network by measure the mutual information degree of subtopic evolutionary from online event. Then complex network analysis been used to measure the nodes’ betweenness centrality and visualize the sub network topology of topic relation, achieve the target of seg-ment the developed topic and clear the polarity transition rules of public opinion. The result can provide the practice reference of crisis qualitative, technical intervention, event tracking and other crisis management work.

  8. Topics in Nonlinear Dynamics

    DEFF Research Database (Denmark)

    Mosekilde, Erik

    Through a significant number of detailed and realistic examples this book illustrates how the insights gained over the past couple of decades in the fields of nonlinear dynamics and chaos theory can be applied in practice. Aomng the topics considered are microbiological reaction systems, ecological...

  9. Historical Topics in Algebra.

    Science.gov (United States)

    National Council of Teachers of Mathematics, Inc., Reston, VA.

    This is a reprint of the historical capsules dealing with algebra from the 31st Yearbook of NCTM,"Historical Topics for the Mathematics Classroom." Included are such themes as the change from a geometric to an algebraic solution of problems, the development of algebraic symbolism, the algebraic contributions of different countries, the origin and…

  10. Transportation: Topic Paper E.

    Science.gov (United States)

    National Council on the Handicapped, Washington, DC.

    As one of a series of topic papers assessing federal laws and programs affecting persons with disabilities, this paper reviews the issue of transportation services. In the area of urban mass transit, four relevant pieces of legislation and public transportation accessibility regulations are cited, and cost issues are explored. Paratransit systems,…

  11. Differential Topic Models.

    Science.gov (United States)

    Chen, Changyou; Buntine, Wray; Ding, Nan; Xie, Lexing; Du, Lan

    2015-02-01

    In applications we may want to compare different document collections: they could have shared content but also different and unique aspects in particular collections. This task has been called comparative text mining or cross-collection modeling. We present a differential topic model for this application that models both topic differences and similarities. For this we use hierarchical Bayesian nonparametric models. Moreover, we found it was important to properly model power-law phenomena in topic-word distributions and thus we used the full Pitman-Yor process rather than just a Dirichlet process. Furthermore, we propose the transformed Pitman-Yor process (TPYP) to incorporate prior knowledge such as vocabulary variations in different collections into the model. To deal with the non-conjugate issue between model prior and likelihood in the TPYP, we thus propose an efficient sampling algorithm using a data augmentation technique based on the multinomial theorem. Experimental results show the model discovers interesting aspects of different collections. We also show the proposed MCMC based algorithm achieves a dramatically reduced test perplexity compared to some existing topic models. Finally, we show our model outperforms the state-of-the-art for document classification/ideology prediction on a number of text collections. PMID:26353238

  12. Selected topics in magnetism

    CERN Document Server

    Gupta, L C

    1993-01-01

    Part of the ""Frontiers in Solid State Sciences"" series, this volume presents essays on such topics as spin fluctuations in Heisenberg magnets, quenching of spin fluctuations by high magnetic fields, and kondo effect and heavy fermions in rare earths amongst others.

  13. Topic: Mastery Learning.

    Science.gov (United States)

    Killoran, James, Ed.

    1983-01-01

    This journal issue addresses the topic of mastery learning at both the elementary and secondary school levels. The first article, "The Theory and Practice of Mastery Learning" (Guskey), gives a definition of and information about the development, operation, and application of mastery learning, based on the theories of Benjamin Bloom. In addition,…

  14. Topical Research: Africa.

    Science.gov (United States)

    Lynn, Karen

    This lesson plan can be used in social studies, language arts, or library research. The instructional objective is for students to select a topic of study relating to Africa, write a thesis statement, collect information from media sources, and develop a conclusion. The teacher may assign the lesson for written or oral evaluation. The teacher…

  15. Contrastive topics decomposed

    Directory of Open Access Journals (Sweden)

    Michael Wagner

    2012-12-01

    Full Text Available The analysis of contrastive topics introduced in Büring 1997b and further developed in Büring 2003 relies on distinguishing two types of constituents that introduce alternatives: the sentence focus, which is marked by a FOC feature, and the contrastive topic, which is marked by a CT feature. A non-compositional rule of interpretation that refers to these features is used to derive a topic semantic value, a nested set of sets of propositions. This paper presents evidence for a correlation between the restrictive syntax of nested focus operators and the syntax of contrastive topics, a correlation which is unexpected under this analysis. A compositional analysis is proposed that only makes use of the flatter focus semantic values introduced by focus operators. The analysis aims at integrating insights from the original analysis while at the same time capturing the observed syntactic restrictions. http://dx.doi.org/10.3765/sp.5.8 BibTeX info

  16. Characters and Topical Diversity

    DEFF Research Database (Denmark)

    Eriksson, Rune

    2014-01-01

    The purpose of this article is to contribute to our understanding of the difference between the bestseller and the non-bestseller in nonfiction. It is noticed that many bestsellers in nonfiction belongs to the sub-genre of creative nonfiction, but also that the topics in this kind of literature i...

  17. Topics and topic prominence in two sign languages

    NARCIS (Netherlands)

    V. Kimmelman

    2015-01-01

    In this paper we describe topic marking in Russian Sign Language (RSL) and Sign Language of the Netherlands (NGT) and discuss whether these languages should be considered topic prominent. The formal markers of topics in RSL are sentence-initial position, a prosodic break following the topic, and non

  18. Abelian Groups

    Energy Technology Data Exchange (ETDEWEB)

    Mishina, A.P.

    1995-10-15

    This fifth survey of reviews on abelian groups comprises papers reviewed in 1985-1992. Just as in the preceding surveys, the issues concerning finite abelian groups, topological groups, ordered groups, group algebras, modules (with rare exceptions), and topics on logic are not considered. The issues on the lattice of subgroups of an abelian group are included in Section 11. In contrast to the fourth survey, this one does not contain Sections 6 (N-high subgroups), 9 (rings with a given additive group), and 10 (valuated groups); since only a few papers treated these topics, the material discussed earlier in Sections 9, and 10 is now included in Section 11 and the material of the former Section 6 will be found in Sections 1, 7, 8, and 11 of this survey. On the other hand, the fifth survey has three new sections devoted to separable groups (a new Sect. 5), Butler groups (a new Sect. 6), and the endormorphism rings and automorphism groups of abelian groups (a new Sect. 9).

  19. Problem topics and readers' responses on online forums

    OpenAIRE

    Tršan, Barbara

    2013-01-01

    Problem topics are among the most common thematic groups in modern youth literature. Problem topics or taboo topics emerged in literature in the 1960s. Taboos appearing in youth literature are the following: alcohol, drugs, sexual abuse, homosexuality, violence, disease, death, suicide, poverty, homelessness, religion, separation of parents, fear ... The thesis explores the question of which Slovenian youth texts containing problem topics are the most commented on the Internet forums and ...

  20. Effect of Topical Probiotic on MMP-13 and Collagen III Expression in the Dermis Layer of Male Rats Irradiated with Ultraviolet-B

    Directory of Open Access Journals (Sweden)

    Vita M. Tawaran

    2016-06-01

    Full Text Available Nowadays, there is a big interest in the use of topical probiotic preparations for skin health. One of the probiotics therurapeutic benefits is used as anti-aging. During aging, there is stimulation of activator protein-1 (AP-1 which is a transcription factor that inhibits the production of collagen and AP-1 supports the breakdown of collagen by enzymes called matrix metalloproteinases (MMPs. As administration of oral Lactobacillus plantarum could inhibit skin aging by lowering the activity of MMP, so the collagen degradation can be derived so probably topical use of Lactobacillus plantarum may give more prominent effects. We used 24 male rats Sprague-Dawley strain as research objects. This study was divided into two groups, the treatment and control groups. The shaved dorsal skin of rats were irradiated with UVB three times a week for 4 weeks with total irradiation dose of 840 mJ/cm2. Skin cream, containing 247.27x107 CFU non-replicating Lactobacillus plantarum FNCC 0020, was smeared on the treatment group, two times daily, whereas the control group did not receive any treatment. Skin biopsies were done at the end of the study for examination of MMP-13 and collagen III expressions. Intensity, distribution, and histoscore of MMP-13 between the treatment and the control group showed no significant difference (p>0.05. The treatment group showed a significant different in the intensity of collagen III with the density distribution of 20–50% and the highest density was 80% (p<0.01. Administration of topical cream L. plantarum FNCC 0020 increased the expression of collagen III density distribution, but not the MMP-13 expression.

  1. Multiplicity of rapidly oscillating Ap stars

    CERN Document Server

    Schoeller, M; Hubrig, S; Kurtz, D W

    2012-01-01

    Rapidly oscillating Ap (roAp) stars have rarely been found in binary or higher order multiple systems. This might have implications for their origin. We intend to study the multiplicity of this type of chemically peculiar stars, looking for visual companions in the range of angular separation between 0.05" and 8". We carried out a survey of 28 roAp stars using diffraction-limited near-infrared imaging with NAOS-CONICA at the VLT. Additionally, we observed three non-oscillating magnetic Ap stars. We detected a total of six companion candidates with low chance projection probabilities. Four of these are new detections, the other two are confirmations. An additional 39 companion candidates are very likely chance projections. We also found one binary system among the non-oscillating magnetic Ap stars. The detected companion candidates have apparent K magnitudes between 6.8 and 19.5 and angular separations ranging from 0.23" to 8.9", corresponding to linear projected separations of 30-2400AU. While our study confi...

  2. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-12-22

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  3. Topical retinoids for acne.

    Science.gov (United States)

    Yeh, Lindsey; Bonati, Lauren Meshkov; Silverberg, Nanette B

    2016-06-01

    Topical retinoids are currently approved by the US Food and Drug Administration for the treatment of acne vulgaris in nonpregnant, nonlactating patients 12 years of age and older. Their efficacy, safety, and tolerability are well documented for inflammatory and noninflammatory acne with studies repeatedly demonstrating a decrease in the number of lesions, significant improvement in acne severity, improvement in the cosmetic appearance of acne, and the prevention of acne lesions through microcomedone formation. There is some variability between prescription retinoid products regarding efficacy, safety, and tolerability; with erythema, peeling, and dryness being common, potential side effects. Due to their efficacious and safe profile, topical retinoids remain the first-line treatment for acne vulgaris. PMID:27416308

  4. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000.11.0...

  5. Building an AP Social Studies Program with Non-Traditional AP Students

    Science.gov (United States)

    Ashmead, Amanda; Blanchette, Sue

    2013-01-01

    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  6. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  7. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  8. Formalistic approaches to A&P

    Institute of Scientific and Technical Information of China (English)

    赵倩

    2014-01-01

    A&P is a famous short story. Its simple words, the unique point of view and skillful writing technique are expressed successfully. Besides, the first-person narrator is also a good point. From Sammy’s eyes, readers can learn the character’s characteristics. Another point is the usage of symbol, the name of the store, A&P, it shows that people’s life is rich, but their spirit is barren. This article tries to analyze it by formalistic approaches.

  9. Topics in Operator Theory

    CERN Document Server

    Ball, Joseph A; Helton, JWilliam; Rodman, Leiba; Spitkovsky, Iiya

    2010-01-01

    This is the first volume of a collection of original and review articles on recent advances and new directions in a multifaceted and interconnected area of mathematics and its applications. It encompasses many topics in theoretical developments in operator theory and its diverse applications in applied mathematics, physics, engineering, and other disciplines. The purpose is to bring in one volume many important original results of cutting edge research as well as authoritative review of recent achievements, challenges, and future directions in the area of operator theory and its applications.

  10. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.;

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present. Multiper......Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...

  11. Simple Lie groups without the approximation property

    DEFF Research Database (Denmark)

    Haagerup, Uffe; de Laat, Tim

    2013-01-01

    on the space M0A(G). Recently, Lafforgue and de la Salle proved that SL(3,R) does not have the AP, implying the first example of an exact discrete group without it, namely, SL(3,Z). In this paper we prove that Sp(2,R) does not have the AP. It follows that all connected simple Lie groups with finite center...

  12. 2000 Johnston Site 3A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  13. 2000 Johnston Site 2A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  14. 2006 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  15. 2000 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  16. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  17. Topics in Galois theory

    CERN Document Server

    Serre, Jean-Pierre

    2007-01-01

    This book is based on a course given by the author at Harvard University in the fall semester of 1988. The course focused on the inverse problem of Galois Theory: the construction of field extensions having a given finite group as Galois group. In the first part of the book, classical methods and results, such as the Scholz and Reichardt construction for p-groups, p != 2, as well as Hilbert's irreducibility theorem and the large sieve inequality, are presented. The second half is devoted to rationality and rigidity criteria and their application in realizing certain groups as Galois groups of

  18. Preparation of and porosity measurements on oxidic APS spray coatings; Praeparation und Porositaetsmessung an oxidischen APS-Spritzschichten

    Energy Technology Data Exchange (ETDEWEB)

    Motl, Wolfgang [H.C. Starck GmbH, Laufenburg (Germany); Schnarr, Holger [Struers GmbH, Willich (Germany)

    2015-07-01

    Zirconium oxide coatings for application in the field of turbine construction have to exhibit certain properties in order to meet high temperature requirements. One of the most important properties is the porosity, for it provides a thermal insulation of the coated material. For this reason, the porosity is routinely determined as quality parameter for spray coatings which helps determining their suitability for a particular application. The following work summarizes the results of the round robin test ''Preparation of and Porosity Measurements on Oxidic APS Spray Coatings'' by the DGM working group ''Preparation''.

  19. Topical Acne Treatments and Pregnancy

    Science.gov (United States)

    Topical Acne Treatments and Pregnancy In every pregnancy, a woman starts out with a 3-5% chance of having ... This sheet talks about whether exposure to topical acne treatments may increase the risk for birth defects ...

  20. Tank 241-AP-106, grab samples, 6AP-96-1 through 6AP-96-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A., Westinghouse Hanford

    1996-12-11

    This document is the final report for tank 241-AP-106 grab samples. This document presents the analytical results for three samples (6AP-96-1, 6AP-96-2 and 6AP-96-3) taken from riser 1 @ 150{degrees} of tank 241-AP-1 06 on September 12, 1996. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1996) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler, 1995).

  1. Topics in atomic physics

    CERN Document Server

    Burkhardt, Charles E

    2006-01-01

    The study of atomic physics propelled us into the quantum age in the early twentieth century and carried us into the twenty-first century with a wealth of new and, in some cases, unexplained phenomena. Topics in Atomic Physics provides a foundation for students to begin research in modern atomic physics. It can also serve as a reference because it contains material that is not easily located in other sources. A distinguishing feature is the thorough exposition of the quantum mechanical hydrogen atom using both the traditional formulation and an alternative treatment not usually found in textbooks. The alternative treatment exploits the preeminent nature of the pure Coulomb potential and places the Lenz vector operator on an equal footing with other operators corresponding to classically conserved quantities. A number of difficult to find proofs and derivations are included as is development of operator formalism that permits facile solution of the Stark effect in hydrogen. Discussion of the classical hydrogen...

  2. The Clathrin Adaptor AP-1A Mediates Basolateral Polarity

    OpenAIRE

    Gravotta, Diego; Carvajal-Gonzalez, Jose Maria; Mattera, Rafael; Deborde, Sylvie; Banfelder, Jason R.; Bonifacino, Juan S.; Rodriguez-Boulan, Enrique

    2012-01-01

    Clathrin and the epithelial-specific clathrin adaptor AP-1B mediate basolateral trafficking in epithelia. However, several epithelia lack AP-1B and mice knocked-out for AP-1B are viable, suggesting the existence of additional mechanisms that control basolateral polarity. Here, we demonstrate a distinct role of the ubiquitous clathrin adaptor AP-1A in basolateral protein sorting. Knock-down of AP-1A causes missorting of basolateral proteins in MDCK cells but only after knock-down of AP-1B, sug...

  3. Dynamics of intracellular clathrin/AP1 and clathrin/AP3 containing carriers

    OpenAIRE

    2012-01-01

    Clathrin/AP1 and clathrin/AP3 coated vesicular carriers originate from endosomes and the TGN. We report here the real-time visualization of these structures in living cells reliably tracked by using rapid, three-dimensional imaging with a spinning-disk confocal microscope. We imaged relatively sparse, diffraction-limited, fluorescent objects containing chimeric fluorescent protein (clathrin light chain, σ adaptor subunits or dynamin2) with a spatial precision of up to ~ 30 nm and a temporal r...

  4. Structural Determinants of DNA Binding by a P. falciparum ApiAP2 Transcriptional Regulator

    Energy Technology Data Exchange (ETDEWEB)

    Lindner, Scott E.; De Silva, Erandi K.; Keck, James L.; Llinás, Manuel (Princeton); (UW-MED)

    2010-11-05

    Putative transcription factors have only recently been identified in the Plasmodium spp., with the major family of regulators comprising the Apicomplexan Apetala2 (AP2) proteins. To better understand the DNA-binding mechanisms of these transcriptional regulators, we characterized the structure and in vitro function of an AP2 DNA-binding domain from a prototypical Apicomplexan AP2 protein, PF14{_}0633 from Plasmodium falciparum. The X-ray crystal structure of the PF14{_}0633 AP2 domain bound to DNA reveals a {beta}-sheet fold that binds the DNA major groove through base-specific and backbone contacts; a prominent {alpha}-helix supports the {beta}-sheet structure. Substitution of predicted DNA-binding residues with alanine weakened or eliminated DNA binding in solution. In contrast to plant AP2 domains, the PF14{_}0633 AP2 domain dimerizes upon binding to DNA through a domain-swapping mechanism in which the {alpha}-helices of the AP2 domains pack against the {beta}-sheets of the dimer mates. DNA-induced dimerization of PF14{_}0633 may be important for tethering two distal DNA loci together in the nucleus and/or for inducing functional rearrangements of its domains to facilitate transcriptional regulation. Consistent with a multisite binding mode, at least two copies of the consensus sequence recognized by PF14{_}0633 are present upstream of a previously identified group of sporozoite-stage genes. Taken together, these findings illustrate how Plasmodium has adapted the AP2 DNA-binding domain for genome-wide transcriptional regulation.

  5. Discovery of new roAp pulsators in the UVES survey of cool magnetic Ap stars

    CERN Document Server

    Kochukhov, O; Ryabchikova, T; Boyko, S; Cunha, M; Tsymbal, V; Weiss, W

    2013-01-01

    We have carried out a survey of short-period pulsations among a sample of carefully chosen cool Ap stars using time-resolved observations with the UVES spectrometer at the ESO 8-m VLT telescope. Here we report the discovery of pulsations with amplitudes 50-100 m/s and periods 7-12 min in HD132205, HD148593 and HD151860. These objects are therefore established as new rapidly oscillating Ap (roAp) stars. In addition, we independently confirm the presence of pulsations in HD69013, HD96237 and HD143487 and detect, for the first time, radial velocity oscillations in two previously known photometric roAp stars HD119027 and HD185256. At the same time, no pulsation variability is found for HD5823, HD178892 and HD185204. All of the newly discovered roAp stars were previously classified as non-pulsating based on the low-precision ground-based photometric surveys. This shows that such observations cannot be used to reliably distinguish between pulsating and non-pulsating stars and that all cool Ap stars may harbor p-mod...

  6. Is benzoyl peroxide 3% topical gel effective and safe in the treatment of acne vulgaris in Japanese patients? A multicenter, randomized, double-blind, vehicle-controlled, parallel-group study.

    Science.gov (United States)

    Kawashima, Makoto; Hashimoto, Hirofumi; Alio Sáenz, Alessandra B; Ono, Makoto; Yamada, Masahiro

    2014-09-01

    Benzoyl peroxide (BPO) as an anti-acne medication is not yet approved in Japan. This study evaluated the efficacy and safety of a once-daily topical application of BPO 3% gel versus an inert vehicle gel in Japanese acne patients. Three hundred and sixty patients were randomized to receive BPO 3% or vehicle for 12 weeks. The primary efficacy end-point was absolute change in number of total lesions (TL) from baseline to week 12 to demonstrate the superiority of BPO 3% versus vehicle. Secondary efficacy end-points were absolute and percent change in TL, inflammatory lesions (IL), non-inflammatory lesions (non-IL) and Investigator's Static Global Assessment (ISGA). Change in TL counts from baseline to week 12 for BPO 3% was superior to vehicle (difference, -21.0; P BPO 3% at all study visits. The proportion of patients with improvement in ISGA scores was significantly higher with BPO 3% than with vehicle from week 2. All adverse events were mild or moderate. Adverse drug-related reactions were higher for BPO 3% (30%) than with vehicle (5%). Local tolerability scores of grade 1 or more (slight to moderate) were more frequent with BPO 3% than vehicle with the most significant differences observed in dryness (56% vs 27% at week 1-4), peeling (19% vs 9% at week 1-2) and burning/stinging (58% vs 15% at week 1-12). These results indicate that BPO 3% is effective while maintaining a favorable safety and tolerability profile in Japanese acne patients.

  7. The AP-1A and AP-1B clathrin adaptor complexes define biochemically and functionally distinct membrane domains

    OpenAIRE

    Fölsch, Heike; Pypaert, Marc; Maday, Sandra; Pelletier, Laurence; Mellman, Ira

    2003-01-01

    Most epithelial cells contain two AP-1 clathrin adaptor complexes. AP-1A is ubiquitously expressed and involved in transport between the TGN and endosomes. AP-1B is expressed only in epithelia and mediates the polarized targeting of membrane proteins to the basolateral surface. Both AP-1 complexes are heterotetramers and differ only in their 50-kD μ1A or μ1B subunits. Here, we show that AP-1A and AP-1B, together with their respective cargoes, define physically and functionally distinct membra...

  8. Arsenic may be involved in fluoride-induced bone toxicity through PTH/PKA/AP1 signaling pathway.

    Science.gov (United States)

    Zeng, Qi-bing; Xu, Yu-yan; Yu, Xian; Yang, Jun; Hong, Feng; Zhang, Ai-hua

    2014-01-01

    Chronic exposure to combined fluoride and arsenic continues to be a major public health problem worldwide, affecting thousands of people. In recent years, more and more researchers began to focus on the interaction between the fluorine and the arsenic. In this study, the selected investigation site was located in China. The study group was selected from people living in fluoride-arsenic polluted areas due to burning coal. The total number of participants was 196; including the fluoride-arsenic anomaly group (130) and the fluoride-arsenic normal group (63). By observing the changes in gene and protein expression of PTH/PKA/AP1 signaling pathway, the results show that fluoride can increase the expression levels of PTH, PKA, and AP1, but arsenic can only affect the expression of AP1; fluoride and arsenic have an interaction on the expression of AP1. Further study found that fluoride and arsenic can affect the mRNA expression level of c-fos gene (AP1 family members), and have an interaction on the expression of c-fos, but not c-jun. The results indicate that PTH/PKA/AP1 signaling pathway may play an important role in bone toxicity of fluoride. Arsenic can affect the expression of c-fos, thereby affecting the expression of transcription factor AP1, indirectly involved in fluoride-induced bone toxicity.

  9. Magnetic Doppler Imaging of Ap stars

    OpenAIRE

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Landstreet, J. D.; Bagnulo, S.

    2007-01-01

    Historically, the magnetic field geometries of the chemically peculiar Ap stars were modelled in the context of a simple dipole field. However, with the acquisition of increasingly sophisticated diagnostic data, it has become clear that the large-scale field topologies exhibit important departures from this simple model. Recently, new high-resolution circular and linear polarisation spectroscopy has even hinted at the presence of strong, small-scale field structures, which were completely une...

  10. APS storage ring vacuum system performance

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) storage ring was designed to operated with 7-GeV, 100-mA positron beam with lifetimes > 20 hours. The lifetime is limited by residual gas scattering and Touschek scattering at this time. Photon-stimulated desorption and microwave power in the rf cavities are the main gas loads. Comparison of actual system gas loads and design calculations will be given. In addition, several special features of the storage ring vacuum system will be presented

  11. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  12. CYLD Inhibits Tumorigenesis and Metastasis by Blocking JNK/AP1 Signaling at Multiple Levels

    Science.gov (United States)

    de Marval, Paula Miliani; Lutfeali, Shazia; Jin, Jane Y.; Leshin, Benjamin; Selim, M. Angelica; Zhang, Jennifer Y.

    2011-01-01

    CYLD has been recognized as a tumor suppressor due to its dominant genetic linkage to multiple types of epidermal tumors and a range of other cancers. The molecular mechanisms governing CYLD control of skin cancer are still unclear. Here, we demonstrated that K14-driven epidermal expression of a patient relevant and catalytically deficient CYLD truncation mutant (CYLDm) sensitized mice to skin tumor development in response to DMBA/TPA-challenge. Tumors developed on transgenic mice were prone to malignant progression and lymph node metastasis, and displayed increased activation of JNK and the downstream c-Jun and c-Fos proteins. Most importantly, topical application of a pharmacological JNK inhibitor significantly reduced tumor development and abolished metastasis in the transgenic mice. Further in line with these animal data, exogenous expression of CYLDm in A431, a human squamous cell carcinoma (SCC) cell line, markedly enhanced cell growth, migration and subcutaneous tumor growth in an AP1-depdendent manner. In contrast, expression of the wild type CYLD inhibited SCC tumorigenesis and AP1 function. Most importantly, CYLDm not only increased JNK activation but also induced an upregulation of K63-ubiquitination on both c-Jun and c-Fos, leading to sustained AP1 activation. Our findings uncovered c-Jun and c-Fos as novel CYLD-targets and underscore that CYLD controls epidermal tumorigenesis through blocking the JNK/AP1 signaling pathway at multiple levels. PMID:21478324

  13. AP-42 ADDITIONS AND REVISIONS - RESIDENTIAL WOOD COMBUSTION

    Science.gov (United States)

    This project develops emission factors, etc., for residential fireplaces and woodstoves which are incorporated into AP-42. AP42 is a massive collection of material which describes processes which generate air emissions and presents emission factors and control effectiveness infor...

  14. Advanced verification topics

    CERN Document Server

    Bhattacharya, Bishnupriya; Hall, Gary; Heaton, Nick; Kashai, Yaron; Khan Neyaz; Kirshenbaum, Zeev; Shneydor, Efrat

    2011-01-01

    The Accellera Universal Verification Methodology (UVM) standard is architected to scale, but verification is growing and in more than just the digital design dimension. It is growing in the SoC dimension to include low-power and mixed-signal and the system integration dimension to include multi-language support and acceleration. These items and others all contribute to the quality of the SOC so the Metric-Driven Verification (MDV) methodology is needed to unify it all into a coherent verification plan. This book is for verification engineers and managers familiar with the UVM and the benefits it brings to digital verification but who also need to tackle specialized tasks. It is also written for the SoC project manager that is tasked with building an efficient worldwide team. While the task continues to become more complex, Advanced Verification Topics describes methodologies outside of the Accellera UVM standard, but that build on it, to provide a way for SoC teams to stay productive and profitable.

  15. Superconcentration and related topics

    CERN Document Server

    Chatterjee, Sourav

    2014-01-01

    A certain curious feature of random objects, introduced by the author as “super concentration,” and two related topics, “chaos” and “multiple valleys,” are highlighted in this book. Although super concentration has established itself as a recognized feature in a number of areas of probability theory in the last twenty years (under a variety of names), the author was the first to discover and explore its connections with chaos and multiple valleys. He achieves a substantial degree of simplification and clarity in the presentation of these findings by using the spectral approach. Understanding the fluctuations of random objects is one of the major goals of probability theory and a whole subfield of probability and analysis, called concentration of measure, is devoted to understanding these fluctuations. This subfield offers a range of tools for computing upper bounds on the orders of fluctuations of very complicated random variables. Usually, concentration of measure is useful when more direct prob...

  16. Researching Distressing Topics

    Directory of Open Access Journals (Sweden)

    Sharon Jackson

    2013-05-01

    Full Text Available Qualitative researchers who explore sensitive topics may expose themselves to emotional distress. Consequently, researchers are often faced with the challenge of maintaining emotional equilibrium during the research process. However, discussion on the management of difficult emotions has occupied a peripheral place within accounts of research practice. With rare exceptions, the focus of published accounts is concentrated on the analysis of the emotional phenomena that emerge during the collection of primary research data. Hence, there is a comparative absence of a dialogue around the emotional dimensions of working with secondary data sources. This article highlights some of the complex ways in which emotions enter the research process during secondary analysis, and the ways in which we engaged with and managed emotional states such as anger, sadness, and horror. The concepts of emotional labor and emotional reflexivity are used to consider the ways in which we “worked with” and “worked on” emotion. In doing so, we draw on our collective experiences of working on two collaborative projects with ChildLine Scotland in which a secondary analysis was conducted on children’s narratives of distress, worry, abuse, and neglect.

  17. Topics in statistical mechanics

    International Nuclear Information System (INIS)

    This thesis deals with four independent topics in statistical mechanics: (1) the dimer problem is solved exactly for a hexagonal lattice with general boundary using a known generating function from the theory of partitions. It is shown that the leading term in the entropy depends on the shape of the boundary; (2) continuum models of percolation and self-avoiding walks are introduced with the property that their series expansions are sums over linear graphs with intrinsic combinatorial weights and explicit dimension dependence; (3) a constrained SOS model is used to describe the edge of a simple cubic crystal. Low and high temperature results are derived as well as the detailed behavior near the crystal facet; (4) the microscopic model of the lambda-transition involving atomic permutation cycles is reexamined. In particular, a new derivation of the two-component field theory model of the critical behavior is presented. Results for a lattice model originally proposed by Kikuchi are extended with a high temperature series expansion and Monte Carlo simulation. 30 references

  18. Cotidiano de portadores de esquizofrenia após uso de clozapina e acompanhamento grupal El cotidiano de portadores de esquizofrenia después del uso de clozapina y acompañamiento del grupo Daily life of schizofrenia patients after the use of clozapine and group follow up

    Directory of Open Access Journals (Sweden)

    Ana Maria Sertori Durão

    2007-06-01

    Full Text Available Este estudo descreve a visão do portador de esquizofrenia sobre seu cotidiano após o uso da clozapina e acompanhamento em grupo. A amostra foi constituída por 11 pacientes que participam do grupo de medicações atípicas (GRUMA do Hospital das Clínicas da Faculdade de Medicina de Ribeirão Preto-USP. Para coleta de dados, utilizou-se uma entrevista semi-estruturada, guiada por um roteiro, em abril de 2003. As entrevistas foram gravadas e, posteriormente, transcritas na íntegra. Obteve-se, como resultados, melhora do paciente quanto aos sintomas da doença, evidenciada pela diminuição do isolamento social, retomada das atividades domésticas/trabalho, estudo e participação em atividades de convívio social. Tais resultados apontam para a necessidade de um novo olhar dirigido ao portador de transtorno mental, no sentido de buscar atitudes terapêuticas adequadas, que atuem na produção de vida, visando a um novo sentido para a existência, nas diferentes formas de convivência e de sociabilidade.Este estudio describió el punto de vista de los portadores de esquizofrenia en su cotidiano después del uso de clozapina y acompañamiento en grupo. La muestra fue constituida por 11 portadores de esquizofrenia que participaron del grupo de medicación clozapina del Hospital das Clínicas de Ribeirao Preto/USP. Para la colección de datos se utilizó una entrevista orientada por guión, en abril de 2003. Las entrevistas fueron registradas y después transcritas por entero. Los resultados indicaron la mejoría de los pacientes con respecto a los síntomas de la enfermedad, evidenciada por la disminución del aislamiento social, recomienzo de actividades domésticas/trabajo, estudio y participación en actividades de convivencia social. Tales resultados señalan la necesidad de una nueva manera de mirar el portador de trastorno mental y sus familiares en el sentido de buscar actitudes terapéuticas que actúen en la producción de vida, en un

  19. Assessing adherence factors in patients under topical treatment: development of the Topical Therapy Adherence Questionnaire (TTAQ).

    Science.gov (United States)

    Zschocke, Ina; Mrowietz, Ulrich; Lotzin, Annett; Karakasili, Eleni; Reich, Kristian

    2014-04-01

    Medication adherence rates strongly depend on favorable disease outcomes. It is known that medication adherence rates are lower for topical treatment than for systemic treatment. However, to date no validated instrument for the assessment of adherence factors in topical treatment is available. The aim of this study was to develop a new questionnaire to assess adherence risk factors in topical treatment. The development of the Topical Therapy Adherence Questionnaire (TTAQ) and Patient Preference Questionnaire (PPQ) was based on a systematic literature review, and qualitative patient focus interviews and expert focus groups' input. The psychometric properties and comprehensibility of the TTAQ and PPQ were assessed in a feasibility study with 59 psoriasis patients. Our first preliminary results indicate that the TTAQ and PPQ are psychometrically sound and reliable measures for the assessment of factors influencing topical treatment adherence. The questionnaires are currently being further developed and various parameters (e.g., time point of assessment) are currently being tested in an exploratory pilot study with ca. 2,000 psoriasis patients receiving topical treatment in a European clinical trial. The use of the final versions of TTAQ and PPQ in clinical practice may facilitate the early identification of specific non-adherence factors in patients under topical treatment, which could enable designing and applying adherence-enhancing interventions according to the patient's individual needs.

  20. Detection of Embryonic Research Topics by Analysing Semantic Topic Networks

    OpenAIRE

    Salatino, Angelo Antonio; Motta, Enrico

    2016-01-01

    Being aware of new research topics is an important asset for anybody involved in the research environment, including researchers, academic publishers and institutional funding bodies. In recent years, the amount of scholarly data available on the web has increased steadily, allowing the development of several approaches for detecting emerging research topics and assessing their trends. However, current methods focus on the detection of topics which are already associated with a label or a sub...

  1. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  2. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  3. AP Deployment Research Based on Physical Distance and Channel Isolation

    OpenAIRE

    Dangui Yan; Chengchang Zhang; Honghua Liao; Lisheng Yang; Ping Li; Guogang Yang

    2014-01-01

    Aiming at the problem of inefficiency of wireless local area networks (WLAN) access point (AP) deployment in urban environment, a new algorithm for AP deployment based on physical distance and channel isolation (DPDCI) is proposed. First, it detects the position information of deployed APs and then calculates the interference penalty factor combined with physical distance and channel isolation, and finally gets the optimal location and channel of the new AP through the genetic algorithm. Comp...

  4. Discovering health topics in social media using topic models.

    Directory of Open Access Journals (Sweden)

    Michael J Paul

    Full Text Available By aggregating self-reported health statuses across millions of users, we seek to characterize the variety of health information discussed in Twitter. We describe a topic modeling framework for discovering health topics in Twitter, a social media website. This is an exploratory approach with the goal of understanding what health topics are commonly discussed in social media. This paper describes in detail a statistical topic model created for this purpose, the Ailment Topic Aspect Model (ATAM, as well as our system for filtering general Twitter data based on health keywords and supervised classification. We show how ATAM and other topic models can automatically infer health topics in 144 million Twitter messages from 2011 to 2013. ATAM discovered 13 coherent clusters of Twitter messages, some of which correlate with seasonal influenza (r = 0.689 and allergies (r = 0.810 temporal surveillance data, as well as exercise (r =  .534 and obesity (r =  -.631 related geographic survey data in the United States. These results demonstrate that it is possible to automatically discover topics that attain statistically significant correlations with ground truth data, despite using minimal human supervision and no historical data to train the model, in contrast to prior work. Additionally, these results demonstrate that a single general-purpose model can identify many different health topics in social media.

  5. Prediction of three-dimensional femoral offset from AP pelvis radiographs in primary hip osteoarthritis

    International Nuclear Information System (INIS)

    Background: In pre-operative planning for total hip arthroplasty (THA), femoral offset (FO) is frequently underestimated on AP pelvis radiographs as a result of inaccurate patient positioning, imprecise magnification, and radiographic beam divergence. The aim of the present study was to evaluate the accuracy and reliability of predicting three-dimensional (3-D) FO from standardised AP pelvis radiographs. Methods: In a retrospective cohort study, pre-operative AP pelvis radiographs, AP hip radiographs and CT scans of a consecutive series of 345 patients (345 hips, 146 males, 199 females, mean age 60 (range: 40–79) years, mean body-mass-index 27 (range: 19–57) kg/m2) with primary end-stage hip OA were reviewed. Patients were positioned according to a standardised protocol and all images were calibrated. Using validated custom programmes, FO was measured on corresponding radiographs and CT scans. Measurement reliability was evaluated using intra-class-correlation-coefficients. To predict 3-D FO from AP pelvis measurements and to assess the accuracy compared to CT, the entire cohort was randomly split into subgroups A and B. Gender specific regression equations were derived from group A (245 patients) and the accuracy of prediction was evaluated in group B (100 patients) using Bland–Altman plots. Results: In the entire cohort, mean FO was 39.2 mm (95%CI: 38.5–40.0 mm) on AP pelvis radiographs, 44.1 mm (95%CI: 43.4–44.9 mm) on AP hip radiographs and 44.6 mm (95%CI: 44.0–45.2 mm) on CT scans. In group B, we observed no significant difference between gender specific predicted FO (males: 48.0 mm, 95%CI: 47.1–48.8 mm; females: 42.0 mm, 95%CI: 41.1–42.8 mm) and FO as measured on CT (males: 47.7 mm, 95%CI: 46.1–49.4 mm, p = 0.689; females: 41.6 mm, 95%CI: 40.3–43.0 mm, p = 0.607). Conclusions: The present study suggests that FO can be accurately and reliably predicted from AP pelvis radiographs in patients with primary end-stage hip osteoarthritis. Our

  6. Prediction of three-dimensional femoral offset from AP pelvis radiographs in primary hip osteoarthritis

    Energy Technology Data Exchange (ETDEWEB)

    Merle, C., E-mail: christian.merle@med.uni-heidelberg.de [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Waldstein, W., E-mail: wwaldstein@gmail.com [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Pegg, E.C., E-mail: elise.pegg@ndorms.ox.ac.uk [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Streit, M.R., E-mail: marcus.streit@med.uni-heidelberg.de [Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Gotterbarm, T., E-mail: tobias.gotterbarm@med.uni-heidelberg.de [Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Aldinger, P.R., E-mail: peter.aldinger@diak-stuttgart.de [Department of Orthopaedic Surgery, Paulinenhilfe, Diakonieklinikum, Stuttgart (Germany); Murray, D.W., E-mail: david.murray@ndorms.ox.ac.uk [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Gill, H.S., E-mail: r.gill@bath.ac.uk [Department of Mechanical Engineering, University of Bath (United Kingdom)

    2013-08-15

    Background: In pre-operative planning for total hip arthroplasty (THA), femoral offset (FO) is frequently underestimated on AP pelvis radiographs as a result of inaccurate patient positioning, imprecise magnification, and radiographic beam divergence. The aim of the present study was to evaluate the accuracy and reliability of predicting three-dimensional (3-D) FO from standardised AP pelvis radiographs. Methods: In a retrospective cohort study, pre-operative AP pelvis radiographs, AP hip radiographs and CT scans of a consecutive series of 345 patients (345 hips, 146 males, 199 females, mean age 60 (range: 40–79) years, mean body-mass-index 27 (range: 19–57) kg/m{sup 2}) with primary end-stage hip OA were reviewed. Patients were positioned according to a standardised protocol and all images were calibrated. Using validated custom programmes, FO was measured on corresponding radiographs and CT scans. Measurement reliability was evaluated using intra-class-correlation-coefficients. To predict 3-D FO from AP pelvis measurements and to assess the accuracy compared to CT, the entire cohort was randomly split into subgroups A and B. Gender specific regression equations were derived from group A (245 patients) and the accuracy of prediction was evaluated in group B (100 patients) using Bland–Altman plots. Results: In the entire cohort, mean FO was 39.2 mm (95%CI: 38.5–40.0 mm) on AP pelvis radiographs, 44.1 mm (95%CI: 43.4–44.9 mm) on AP hip radiographs and 44.6 mm (95%CI: 44.0–45.2 mm) on CT scans. In group B, we observed no significant difference between gender specific predicted FO (males: 48.0 mm, 95%CI: 47.1–48.8 mm; females: 42.0 mm, 95%CI: 41.1–42.8 mm) and FO as measured on CT (males: 47.7 mm, 95%CI: 46.1–49.4 mm, p = 0.689; females: 41.6 mm, 95%CI: 40.3–43.0 mm, p = 0.607). Conclusions: The present study suggests that FO can be accurately and reliably predicted from AP pelvis radiographs in patients with primary end-stage hip osteoarthritis

  7. Pharmakologische Charakterisierung der vasoaktiven Eigenschaften von Ap7A und Ap8A an der isolierten perfundierten Rattenniere

    OpenAIRE

    Blaschke, Daniela

    2010-01-01

    Recently, diadenosine heptaphosphate and diadenosine octaphosphate have been isolated in human platelets. With thrombin-induced platelet aggregation, Ap7A and Ap8A are released from the platelets into the extracellular space. Like other dinucleoside polyphosphates, maybe they play an important role in the control of vascular tone and platelet aggregation. Here we describe the effects on regulation of vascular tone of Ap7A and Ap8A in isolated perfused rat kidney. Our experiments demonstrate t...

  8. Topic Modeling of Hierarchical Corpora /

    OpenAIRE

    Kim, Do-kyum

    2014-01-01

    The sizes of modern digital libraries have grown beyond our capacity to comprehend manually. Thus we need new tools to help us in organizing and browsing large corpora of text that do not require manually examining each document. To this end, machine learning researchers have developed topic models, statistical learning algorithms for automatic comprehension of large collections of text. Topic models provide both global and local views of a corpus; they discover topics that run through the co...

  9. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  10. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  11. Representation Theory of Algebraic Groups and Quantum Groups

    CERN Document Server

    Gyoja, A; Shinoda, K-I; Shoji, T; Tanisaki, Toshiyuki

    2010-01-01

    Invited articles by top notch expertsFocus is on topics in representation theory of algebraic groups and quantum groupsOf interest to graduate students and researchers in representation theory, group theory, algebraic geometry, quantum theory and math physics

  12. Modelling of Biota Dose Effects. Report of Working Group 6 Biota Dose Effects Modelling of EMRAS II Topical Heading Reference Approaches for Biota Dose Assessment. Environmental Modelling for RAdiation Safety (EMRAS II) Programme

    International Nuclear Information System (INIS)

    Environmental assessment models are used for evaluating the radiological impact of actual and potential releases of radionuclides to the environment. They are essential tools for use in the regulatory control of routine discharges to the environment and in planning the measures to be taken in the event of accidental releases. They are also used for predicting the impact of releases which may occur far into the future, for example, from underground radioactive waste repositories. It is important to verify, to the extent possible, the reliability of the predictions of such models by a comparison with measured values in the environment or with the predictions of other models. The IAEA has been organizing programmes on international model testing since the 1980s. These programmes have contributed to a general improvement in models, in the transfer of data and in the capabilities of modellers in Member States. IAEA publications on this subject over the past three decades demonstrate the comprehensive nature of the programmes and record the associated advances which have been made. From 2009 to 2011, the IAEA organized a project entitled Environmental Modelling for RAdiation Safety (EMRAS II), which concentrated on the improvement of environmental transfer models and the development of reference approaches to estimate the radiological impacts on humans, as well as on flora and fauna, arising from radionuclides in the environment. Different aspects were addressed by nine working groups covering three themes: reference approaches for human dose assessment, reference approaches for biota dose assessment and approaches for addressing emergency situations. This publication describes the work of the Biota Effects Modelling Working Group

  13. Transfer of Tritium in the Environment after Accidental Releases from Nuclear Facilities. Report of Working Group 7 Tritium Accidents of EMRAS II Topical Heading Approaches for Assessing Emergency Situations. Environmental Modelling for Radiation Safety (Emras II) Programme

    International Nuclear Information System (INIS)

    Environmental assessment models are used for evaluating the radiological impact of actual and potential releases of radionuclides to the environment. They are essential tools for use in the regulatory control of routine discharges to the environment and also in planning measures to be taken in the event of accidental releases. They are also used for predicting the impact of releases which may occur far into the future, for example, from underground radioactive waste repositories. It is important to verify, to the extent possible, the reliability of the predictions of such models by a comparison with measured values in the environment or with predictions of other models. The IAEA has been organizing programmes of international model testing since the 1980s. These programmes have contributed to a general improvement in models, in the transfer of data and in the capabilities of modellers in Member States. IAEA publications on this subject over the past three decades demonstrate the comprehensive nature of the programmes and record the associated advances which have been made. From 2009 to 2011, the IAEA organized a programme entitled Environmental Modelling for RAdiation Safety (EMRAS II), which concentrated on the improvement of environmental transfer models and the development of reference approaches to estimate the radiological impacts on humans, as well as on flora and fauna, arising from radionuclides in the environment. Different aspects were addressed by nine working groups covering three themes: reference approaches for human dose assessment, reference approaches for biota dose assessment and approaches for assessing emergency situations. This publication describes the work of the Tritium Accidents Working Group

  14. 77 FR 24480 - Application for New Awards; Advanced Placement (AP) Test Fee Program-Reopening the AP Test Fee...

    Science.gov (United States)

    2012-04-24

    .... ACTION: Notice reopening the AP Test Fee fiscal year 2012 competition. Catalog of Federal Domestic Assistance (CFDA) Number: 84.330B. SUMMARY: On February 15, 2012, we published in the Federal Register (77 FR... Application for New Awards; Advanced Placement (AP) Test Fee Program--Reopening the AP Test Fee Fiscal...

  15. Genomic and transcriptomic analysis of the AP2/ERF superfamily in Vitis vinifera

    Directory of Open Access Journals (Sweden)

    Pezzotti Mario

    2010-12-01

    Full Text Available Abstract Background The AP2/ERF protein family contains transcription factors that play a crucial role in plant growth and development and in response to biotic and abiotic stress conditions in plants. Grapevine (Vitis vinifera is the only woody crop whose genome has been fully sequenced. So far, no detailed expression profile of AP2/ERF-like genes is available for grapevine. Results An exhaustive search for AP2/ERF genes was carried out on the Vitis vinifera genome and their expression profile was analyzed by Real-Time quantitative PCR (qRT-PCR in different vegetative and reproductive tissues and under two different ripening stages. One hundred and forty nine sequences, containing at least one ERF domain, were identified. Specific clusters within the AP2 and ERF families showed conserved expression patterns reminiscent of other species and grapevine specific trends related to berry ripening. Moreover, putative targets of group IX ERFs were identified by co-expression and protein similarity comparisons. Conclusions The grapevine genome contains an amount of AP2/ERF genes comparable to that of other dicot species analyzed so far. We observed an increase in the size of specific groups within the ERF family, probably due to recent duplication events. Expression analyses in different aerial tissues display common features previously described in other plant systems and introduce possible new roles for members of some ERF groups during fruit ripening. The presented analysis of AP2/ERF genes in grapevine provides the bases for studying the molecular regulation of berry development and the ripening process.

  16. Phylogenetic utility of the AP3/DEF K-domain and its molecular evolution in Impatiens (Balsaminaceae)

    OpenAIRE

    Janssens, S.; Geuten, K.; Viaene, T.; Yong-Ming, Y.; Yi, S; Smets, E.

    2007-01-01

    APETALA3 (AP3)/DEFICIENS (DEF) is a MADS-box transcription factor that is involved in establishing the identity of petal and stamen floral organs. The AP3/DEF gene lineage has been extensively examined throughout the angiosperms in order to better understand its role in floral diversity and evolution. As a result, a large number of cloned AP3/DEF orthologues are available, which can be used for the design of taxon specific primers for phylogeny reconstruction of close relatives of the group o...

  17. Hot topic [editorial

    International Nuclear Information System (INIS)

    simulations 'would be seriously in error'. One may ask if this magazine should give space to Lindzen or those involved in geoengineering to air their views. Given the uncertainties still present within climate models and the potential costs of dealing with global warming, it would be wrong for Physics World to ignore those outside the mainstream. After all, as Richard Feynman once wrote: 'There is no harm in doubt and scepticism, for it is through these that new discoveries are made'. Physicists should never take anything at face value, not least a topic as important as climate change. (U.K.)

  18. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  19. Proactive AP Selection Method Considering the Radio Interference Environment

    Science.gov (United States)

    Taenaka, Yuzo; Kashihara, Shigeru; Tsukamoto, Kazuya; Yamaguchi, Suguru; Oie, Yuji

    In the near future, wireless local area networks (WLANs) will overlap to provide continuous coverage over a wide area. In such ubiquitous WLANs, a mobile node (MN) moving freely between multiple access points (APs) requires not only permanent access to the Internet but also continuous communication quality during handover. In order to satisfy these requirements, an MN needs to (1) select an AP with better performance and (2) execute a handover seamlessly. To satisfy requirement (2), we proposed a seamless handover method in a previous study. Moreover, in order to achieve (1), the Received Signal Strength Indicator (RSSI) is usually employed to measure wireless link quality in a WLAN system. However, in a real environment, especially if APs are densely situated, it is difficult to always select an AP with better performance based on only the RSSI. This is because the RSSI alone cannot detect the degradation of communication quality due to radio interference. Moreover, it is important that AP selection is completed only on an MN, because we can assume that, in ubiquitous WLANs, various organizations or operators will manage APs. Hence, we cannot modify the APs for AP selection. To overcome these difficulties, in the present paper, we propose and implement a proactive AP selection method considering wireless link condition based on the number of frame retransmissions in addition to the RSSI. In the evaluation, we show that the proposed AP selection method can appropriately select an AP with good wireless link quality, i.e., high RSSI and low radio interference.

  20. Ozone mitigation tests at the APS

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.; Collins, J.T.; Pisharody, M.; Job, P.K.; Wang Zhibi

    1996-09-01

    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented.

  1. Path Deviation Equations in AP-Geometry

    CERN Document Server

    Wanas, M I

    2005-01-01

    Recently, it has been shown that Absolute Parallelism (AP) geometry admits paths that are naturally quantized. These paths have been used to describe the motion of spinning particles in a background gravitational field. In case of a weak static gravitational field limits, the paths are applied successfully to interpret the discrepancy in the motion of thermal neutrons in the Earth's gravitational field (COW-experiment). The aim of the present work is to explore the properties of the deviation equations corresponding to these paths. In the present work the deviation equations are derived and compared to the geodesic deviation equation of the Riemannian geometry.

  2. The use of focus groups to investigate sensitive topics: an example taken from research on adolescent girls' perceptions about sexual risks O uso de grupos focais para investigar temas de natureza íntima: exemplo de uma pesquisa sobre pontos de vista de meninas adolescentes acerca dos riscos do sexo

    Directory of Open Access Journals (Sweden)

    Dora Lucia de Oliveira

    2011-07-01

    Full Text Available The methodology of focus groups has been increasingly employed in the context of research in the social sciences, particularly in health-related inquiries. Considerations about the sensitive aspects of such research are not, however, very often seen in research reports or discussion on ways of conducting sensitive research. The scope of this paper is to share an experience of conducting focus group research on sensitive topics, such as AIDS, risk and sexual issues, highlighting some methodological issues. More specifically, it suggests ways of working with teenage girls in focus groups about sensitive topics. The advantages of the use of focus groups to explore views on HIV/AIDS and other sexual risks are also discussed. Socio-cultural approaches to risk and feminist thinking permeate the main arguments.A metodologia de grupos focais tem sido cada vez mais usada em pesquisas no campo das ciências sociais, particularmente em investigações relacionadas à saúde. Considerações sobre os aspectos de natureza íntima que permeiam estas pesquisas não são, contudo, muito frequentemente vistas em relatórios de pesquisa, nem em discussões sobre as maneiras de se conduzir tais pesquisas. O objetivo deste artigo é compartilhar uma experiência de pesquisa com grupos focais sobre temas de natureza íntima, tais como AIDS, risco e sexualidade, destacando algumas questões metodológicas. Mais especificamente, o artigo sugere maneiras para desenvolver este tipo de pesquisa com meninas adolescentes. As vantagens do uso de grupos focais para explorar pontos de vista sobre HIV/AIDS e outros riscos sexuais são também discutidas. Abordagens sócio-culturais sobre risco e o pensamento feminista formam os principais argumentos.

  3. The Virtual Robotics Laboratory; TOPICAL

    International Nuclear Information System (INIS)

    The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory secondary education programs. In the past, the ORNL Robotics and Process Systems Division has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics. but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his/her students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations

  4. The topical treatment of psoriasis.

    NARCIS (Netherlands)

    Kerkhof, P.C.M. van de; Vissers, W.H.P.M.

    2003-01-01

    According to the patients, improvement of efficacy, long-term safety and improvement of compliance are needed. The topical treatment has been innovated during the last decade. Most important are the introduction of two new classes of treatments: topical vitamin D(3) analogues and the retinoid tazaro

  5. Topics of Evolutionary Computation 2001

    DEFF Research Database (Denmark)

    Ursem, Rasmus Kjær

    This booklet contains the student reports from the course: Topics of Evolutionary Computation, Fall 2001, given by Thiemo Krink, Rene Thomsen and Rasmus K. Ursem......This booklet contains the student reports from the course: Topics of Evolutionary Computation, Fall 2001, given by Thiemo Krink, Rene Thomsen and Rasmus K. Ursem...

  6. Advancements in Topical Antifungal Vehicles.

    Science.gov (United States)

    Kircik, Leon H

    2016-02-01

    The primary treatment for superficial fungal infections is antifungal topical formulations, and allylamines and azoles represent the two major classes of topical formulations that are used to treat these infections. The stratum corneum (SC) is composed of keratinocytes that are surrounded by a matrix of lipids. The efficacy of topically applied formulations depends on their ability to penetrate this lipid matrix, and the vehicle plays an integral role in the penetration of active molecule into skin. There are several challenges to formulating topical drugs, which include the biotransformation of the active molecules as they pass through the SC and the physical changes that occur to the vehicle itself when it is applied to the skin. This article will review current and emerging topical antifungal vehicles. PMID:26885798

  7. Modern topics in theoretical nuclear physics

    OpenAIRE

    Jennings, B. K.; Schwenk, A

    2005-01-01

    Over the past five years there have been profound advances in nuclear physics based on effective field theory and the renormalization group. In this brief, we summarize these advances and discuss how they impact our understanding of nuclear systems and experiments that seek to unravel their unknowns. We discuss future opportunities and focus on modern topics in low-energy nuclear physics, with special attention to the strong connections to many-body atomic and condensed matter physics, as wel...

  8. SN 2005ap: A Most Brilliant Explosion

    CERN Document Server

    Quimby, Robert M; Wheeler, J Craig; Höflich, Peter; Akerlof, Carl W; Rykoff, Eli S

    2007-01-01

    We present unfiltered photometric observations with ROTSE-III and optical spectroscopic follow-up with the HET and Keck of the most luminous supernova yet identified, SN 2005ap. The spectra taken about 3 days before and 6 days after maximum light show narrow emission lines (likely originating in the dwarf host) and absorption lines at a redshift of z=0.2832, which puts the peak unfiltered magnitude at -22.7 +/- 0.1 absolute. Broad P-Cygni features corresponding to H-alpha, CIII, NIII, and OIII, are further detected with a photospheric velocity of ~20,000 km/s. Unlike other highly luminous supernovae such as 2006gy and 2006tf that show slow photometric evolution, the light curve of SN 2005ap indicates a 1-3 week rise to peak followed by a relatively rapid decay. The spectra also lack the distinct emission peaks from moderately broadened (FWHM ~ 2,000 km/s) Balmer lines seen in SN 2006gy and SN 2006tf. We briefly discuss the origin of the extraordinary luminosity from a strong interaction as may be expected fro...

  9. APS insertion devices: Recent developments and results

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) now has a total of 23 insertion devices (IDs). Over two-thirds of them are installed on the storage ring. The installed devices include 18, 27 and 55 mm-period undulators; an 85 mm-period wiggler; a 16 cm-period elliptical multipole wiggler; and many 33 mm-period undulators. Most of the IDs occupy storage-ring straight sections equipped with 8 mm vertical-aperture vacuum chambers. All of the IDs were measured magnetically at the APS and, in most cases, underwent a final magnetic tuning in order to minimize variation in the various integrals of the field through the ID over the full gap range. Special shimming techniques to correct magnetic field parameters in appropriate gap-dependent ways were developed and applied. Measurements of the closed-orbit distortion as a function of the ID gap variation have been completed, and results are in a good agreement with magnetic measurements. Spectral diagnostics of the ID radiation, including measurements of the absolute spectral flux, brilliance and polarization, show excellent agreement between calculated and measured results. Studies of the sensitivity of IDs to radiation exposure and measurements of the dose rate received by the IDs are in progress

  10. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  11. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  12. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  13. Seven topics in functional magnetic resonance imaging.

    Science.gov (United States)

    Bandettini, Peter A

    2009-09-01

    Functional MRI (fMRI) is a non-invasive brain imaging methodology that started in 1991 and allows human brain activation to be imaged at high resolution within only a few minutes. Because it has extremely high sensitivity, is relatively easy to implement, and can be performed on most standard clinical MRI scanners. It continues to grow at an explosive rate throughout the world. Over the years, at any given time, fMRI has been defined by only a handful of major topics that have been the focus of researchers using and developing the methodology. In this review, I attempt to take a snapshot of the field of fMRI as it is in mid-2009 by discussing the seven topics that I feel are most on the minds of fMRI researchers. The topics are, in no particular order or grouping: (1) Clinical impact, (2) Utilization of individual functional maps, (3) fMRI signal interpretation, (4) Pattern effect mapping and decoding, (5) Endogenous oscillations, (6) MRI technology, and (7) Alternative functional contrast mechanisms. Most of these topics are highly interdependent, each advancing as the others advance. While most fMRI involves applications towards clinical or neuroscience questions, all applications are fundamentally dependent on advances in basic methodology as well as advances in our understanding of the relationship between neuronal activity and fMRI signal changes. This review neglects almost completely an in-depth discussion of applications. Rather the discussions are on the methods and interpretation.

  14. Topic Model for Graph Mining.

    Science.gov (United States)

    Xuan, Junyu; Lu, Jie; Zhang, Guangquan; Luo, Xiangfeng

    2015-12-01

    Graph mining has been a popular research area because of its numerous application scenarios. Many unstructured and structured data can be represented as graphs, such as, documents, chemical molecular structures, and images. However, an issue in relation to current research on graphs is that they cannot adequately discover the topics hidden in graph-structured data which can be beneficial for both the unsupervised learning and supervised learning of the graphs. Although topic models have proved to be very successful in discovering latent topics, the standard topic models cannot be directly applied to graph-structured data due to the "bag-of-word" assumption. In this paper, an innovative graph topic model (GTM) is proposed to address this issue, which uses Bernoulli distributions to model the edges between nodes in a graph. It can, therefore, make the edges in a graph contribute to latent topic discovery and further improve the accuracy of the supervised and unsupervised learning of graphs. The experimental results on two different types of graph datasets show that the proposed GTM outperforms the latent Dirichlet allocation on classification by using the unveiled topics of these two models to represent graphs. PMID:25616091

  15. Mental Mechanisms for Topics Identification

    Directory of Open Access Journals (Sweden)

    Louis Massey

    2014-01-01

    Full Text Available Topics identification (TI is the process that consists in determining the main themes present in natural language documents. The current TI modeling paradigm aims at acquiring semantic information from statistic properties of large text datasets. We investigate the mental mechanisms responsible for the identification of topics in a single document given existing knowledge. Our main hypothesis is that topics are the result of accumulated neural activation of loosely organized information stored in long-term memory (LTM. We experimentally tested our hypothesis with a computational model that simulates LTM activation. The model assumes activation decay as an unavoidable phenomenon originating from the bioelectric nature of neural systems. Since decay should negatively affect the quality of topics, the model predicts the presence of short-term memory (STM to keep the focus of attention on a few words, with the expected outcome of restoring quality to a baseline level. Our experiments measured topics quality of over 300 documents with various decay rates and STM capacity. Our results showed that accumulated activation of loosely organized information was an effective mental computational commodity to identify topics. It was furthermore confirmed that rapid decay is detrimental to topics quality but that limited capacity STM restores quality to a baseline level, even exceeding it slightly.

  16. Genome-wide investigation and expression profiling of AP2/ERF transcription factor superfamily in foxtail millet (Setaria italica L..

    Directory of Open Access Journals (Sweden)

    Charu Lata

    Full Text Available The APETALA2/ethylene-responsive element binding factor (AP2/ERF family is one of the largest transcription factor (TF families in plants that includes four major sub-families, namely AP2, DREB (dehydration responsive element binding, ERF (ethylene responsive factors and RAV (Related to ABI3/VP. AP2/ERFs are known to play significant roles in various plant processes including growth and development and biotic and abiotic stress responses. Considering this, a comprehensive genome-wide study was conducted in foxtail millet (Setaria italica L.. A total of 171 AP2/ERF genes were identified by systematic sequence analysis and were physically mapped onto nine chromosomes. Phylogenetic analysis grouped AP2/ERF genes into six classes (I to VI. Duplication analysis revealed that 12 (∼7% SiAP2/ERF genes were tandem repeated and 22 (∼13% were segmentally duplicated. Comparative physical mapping between foxtail millet AP2/ERF genes and its orthologs of sorghum (18 genes, maize (14 genes, rice (9 genes and Brachypodium (6 genes showed the evolutionary insights of AP2/ERF gene family and also the decrease in orthology with increase in phylogenetic distance. The evolutionary significance in terms of gene-duplication and divergence was analyzed by estimating synonymous and non-synonymous substitution rates. Expression profiling of candidate AP2/ERF genes against drought, salt and phytohormones revealed insights into their precise and/or overlapping expression patterns which could be responsible for their functional divergence in foxtail millet. The study showed that the genes SiAP2/ERF-069, SiAP2/ERF-103 and SiAP2/ERF-120 may be considered as potential candidate genes for further functional validation as well for utilization in crop improvement programs for stress resistance since these genes were up-regulated under drought and salinity stresses in ABA dependent manner. Altogether the present study provides new insights into evolution, divergence and

  17. Genome-wide investigation and expression profiling of AP2/ERF transcription factor superfamily in foxtail millet (Setaria italica L.).

    Science.gov (United States)

    Lata, Charu; Mishra, Awdhesh Kumar; Muthamilarasan, Mehanathan; Bonthala, Venkata Suresh; Khan, Yusuf; Prasad, Manoj

    2014-01-01

    The APETALA2/ethylene-responsive element binding factor (AP2/ERF) family is one of the largest transcription factor (TF) families in plants that includes four major sub-families, namely AP2, DREB (dehydration responsive element binding), ERF (ethylene responsive factors) and RAV (Related to ABI3/VP). AP2/ERFs are known to play significant roles in various plant processes including growth and development and biotic and abiotic stress responses. Considering this, a comprehensive genome-wide study was conducted in foxtail millet (Setaria italica L.). A total of 171 AP2/ERF genes were identified by systematic sequence analysis and were physically mapped onto nine chromosomes. Phylogenetic analysis grouped AP2/ERF genes into six classes (I to VI). Duplication analysis revealed that 12 (∼7%) SiAP2/ERF genes were tandem repeated and 22 (∼13%) were segmentally duplicated. Comparative physical mapping between foxtail millet AP2/ERF genes and its orthologs of sorghum (18 genes), maize (14 genes), rice (9 genes) and Brachypodium (6 genes) showed the evolutionary insights of AP2/ERF gene family and also the decrease in orthology with increase in phylogenetic distance. The evolutionary significance in terms of gene-duplication and divergence was analyzed by estimating synonymous and non-synonymous substitution rates. Expression profiling of candidate AP2/ERF genes against drought, salt and phytohormones revealed insights into their precise and/or overlapping expression patterns which could be responsible for their functional divergence in foxtail millet. The study showed that the genes SiAP2/ERF-069, SiAP2/ERF-103 and SiAP2/ERF-120 may be considered as potential candidate genes for further functional validation as well for utilization in crop improvement programs for stress resistance since these genes were up-regulated under drought and salinity stresses in ABA dependent manner. Altogether the present study provides new insights into evolution, divergence and systematic

  18. Inhibition of Corneal Neovascularization by Topical and Subconjunctival Tigecycline

    Directory of Open Access Journals (Sweden)

    Sertan Goktas

    2014-01-01

    Full Text Available Objective. To investigate the effects of topical and subconjunctival tigecycline on the prevention of corneal neovascularization. Materials and Methods. Following chemical burn, thirty-two rats were treated daily with topical instillation of 1 mg/mL tigecycline (group 1 or subconjunctival instillation of 1 mg/mL tigecycline (group 3 for 7 days. Control rats received topical (group 2 or subconjunctival (group 4 0.9% saline. Digital photographs of the cornea were taken on the eighth day after treatment and analyzed to determine the percentage area of the cornea covered by neovascularization. Corneal sections were analyzed histopathologically. Results. The median percentages of corneal neovascularization in groups 1 and 3 were 48% (95% confidence interval (CI, 44.2–55.8% and 33.5% (95% CI, 26.6–39.2%, respectively. The median percentages of corneal neovascularization of groups 1 and 3 were significantly lower than that of the control group (P=0.03 and P<0.001, resp.. Histologic examination of samples from groups 1 and 3 showed lower vascularity than that of control groups. Conclusion. Topical and subconjunctival administration of tigecycline seems to be showing promising therapeutic effects on the prevention of corneal neovascularization. Furthermore, subconjunctival administration of tigecycline is more potent than topical administration in the inhibition of corneal neovascularization.

  19. Dosimetry: an ARDENT topic

    CERN Multimedia

    CERN Bulletin

    2012-01-01

    The first annual ARDENT workshop took place in Vienna from 20 to 23 November. The workshop gathered together the Early-Stage Researchers (ESR) and their supervisors, plus other people involved from all the participating institutions.   “The meeting, which was organised with the local support of the Austrian Institute of Technology, was a nice opportunity for the ESRs to get together, meet each other, and present their research plans and some preliminary results of their work,” says Marco Silari, a member of CERN Radiation Protection Group and the scientist in charge of the programme. Two full days were devoted to a training course on radiation dosimetry, delivered by renowned experts. The workshop closed with a half-day visit to the MedAustron facility in Wiener Neustadt. ARDENT (Advanced Radiation Dosimetry European Network Training) is a Marie Curie ITN project funded under EU FP7 with €4 million. The project focuses on radiation dosimetry exploiting se...

  20. The future of topical analgesics.

    Science.gov (United States)

    Arnstein, Paul M

    2013-07-01

    Topically applied analgesic therapies have been used throughout history to treat a variety of patient conditions that present with pain. Before modem pharmaceuticals became readily available, mud-based emollients, salves, cold therapies, and other natural remedies were often used. Now we have effective therapies and are developing advanced topical analgesics as we learn more about the physiology and pathophysiology of pain. The use of topical analgesics may be associated with fewer patient systemic side effects than are seen with oral, parenteral, or transdermally administered agents, making the topical route of administration attractive to prescribers and patients. With further refinement of existing drugs and the development of novel agents, topical analgesics may offer relief for treating patient pain conditions that are currently challenging to treat, such as pain resulting from burns, wound debridement, and pressure ulcers. Recognizing the value of a multimodal approach, topical analgesics may offer a therapeutic option that can become part of a comprehensive treatment plan for the patient. With continued advancements in targeted drug-delivery systems, topical analgesics may be able to provide a method to prevent or reverse the phenomena of peripheral and central sensitization, or the neuroplastic changes believed to be responsible for the transition from acute to chronic pain states in patients. For those patients at risk for developing chronic pain states, such as complex regional pain syndrome, the combination of cutaneous stimulation (achieved through rubbing during application) and analgesic effects produced by the drug itself may prevent the disabling pain that often emerges during the subacute phase of disease. In summary, better utilization of currently available topical analgesics and continued research promise to ensure that topical analgesics are, and will continue to be, important tools in the treatment of patients with resistant pain. PMID

  1. High death rate in mice treated topically with diclofenac

    DEFF Research Database (Denmark)

    Lerche, Catharina M; Philipsen, Peter A; Poulsen, Thomas;

    2011-01-01

    Recently, 3% diclofenacnatrium gel (diclofenac) was introduced for the treatment of actinic keratoses. Data on photocarcinogenesis of topical diclofenac are limited, and we wished to investigate whether topical diclofenac can accelerate photocarcinogenesis using simulated solar radiation (SSR......). Diclofenac was applied topically on the backs of hairless, female, C3.Cg/TifBomTac immunocompetent mice three times weekly followed by ultraviolet radiation (2, 3, or 4 Standard Erythema Dose) until death. There was a significant difference in survival between diclofenac-treated groups and control groups (P...

  2. Effects of systemic flunixin meglumine, topical oxytetracycline, and topical prednisolone acetate on tear film proteinases innormal horses

    OpenAIRE

    Rainbow, Marc E

    2004-01-01

    The purpose of this study was to determine the effects of three medical treatments, topical oxytetracycline, topical prednisolone acetate, and systemic flunixin meglumine, on the activity of two proteinases, matrix metalloproteinase-2 (MMP-2) and matrix metalloproteinase-9 (MMP-9), in equine tear film. The study design consisted of twelve ophthalmically normal horses separated into three groups of four in a cross-over study design. Each group was treated for 5 days with flunixin meglumine (...

  3. Clindamycin and Benzoyl Peroxide Topical

    Science.gov (United States)

    ... benzoyl peroxide works by killing the bacteria that cause acne. ... E-Mycin, Erythrocin) and other topical medications for acne. Your doctor ... colitis (a condition which causes swelling and sores in the lining of the ...

  4. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  5. Key Topics in Sports Medicine

    OpenAIRE

    Amir Ali Narvani; Panagiotis Thomas; Burce Lynn

    2006-01-01

    Key Topics in Sports Medicine is a single quick reference source for sports and exercise medicine. It presents the essential information from across relevant topic areas, and includes both the core and emerging issues in this rapidly developing field. It covers: 1) Sports injuries, rehabilitation and injury prevention, 2) Exercise physiology, fitness testing and training, 3) Drugs in sport, 4) Exercise and health promotion, 5) Sport and exercise for special and clinical populations, 6) The ps...

  6. Topics of Bioengineering in Wikipedia

    Directory of Open Access Journals (Sweden)

    Vassia Atanassova

    2009-10-01

    Full Text Available The present report aims to give a snapshot of how topics from the field of bioengineering (bioinformatics, bioprocess systems, biomedical engineering, biotechnology, etc. are currently covered in the free electronic encyclopedia Wikipedia. It also offers insights and information about what Wikipedia is, how it functions, how and when to cite Wikipedian articles, if necessary. Several external wikis, devoted to topics of bioengineering, are also listed and reviewed.

  7. Angular momentum in quantum mechanics as a group study topic

    International Nuclear Information System (INIS)

    A largely practical approach to the teaching of angular momentum in quantum mechanics at the undergraduate level is described. In an intensive seven week period towards the end of their final year, undergraduates working in pairs perform experiments in nuclear physics which demonstrate some of the important properties of angular momentum. Three experiments are selected and discussed in this article to illustrate the teaching method. The existence of intrinsic spin and parity is investigated by measuring the polarisation of annihilation radiation; the conservation of angular momentum is demonstrated by a measurement of orbital angular momentum in a nucleon transfer reaction and the coupling of angular momenta is illustrated by the method of angular correlation. (author)

  8. A Comparative Study On The Action Potential Simulation (APS Therapy And The Routine Physiotherapy Protocol In Knee Osteoarthritisin Elderly People

    Directory of Open Access Journals (Sweden)

    Abbas Rahimi

    2012-04-01

    Full Text Available Background and Aim: Knee osteoarthritis is the most common cause for which the elderly people refere to physiotherapy outpatient clinics. This study aimed to investigate the effects of the Action Potential Stimulation (APS Therapy and the routine physiotherapy (PT protocol on relieving pain and swelling as well as the duration of the relief period in patients with knee osteoarthritis. Materials and Methods: 69 patients (62 females & 7 males with knee osteoarthritis were recruited in this study. The subjects were divided into two groups including APS Therapy (n=37, mean age: 55±13 years old and the routine PT protocol (n=32, mean age: 61±14 years old groups. A 10-session treatment period was carried out for each group; and their pain and swelling were measured at the first, fifth and tenth sessions and also one-month after the last session (follow up. The swelling was measured using measuring the circumference of the knee on the patella, 5 Cm above and 5 Cm below the patella. The routine PT protocol consisted of hot pack, ultrasound, TENS and exercise; and the APS therapy protocol included hot pack, APS Therapy and the same exercise. During the follow up, 50 out of 61 subjects were called on the phone and any pain changes were recorded.Results: In terms of swelling, the results showed significant reduction just on the patella only in the APS Therapy group (P<0.05. Visual Analogue Pain Scale (VAPS indicated a significant pain reduction in both groups. However, the APS Therapy group showed significantly pain reduction at the end of sessions five, ten and the follow up session (P<0.05. It was also revealed that while routine PT subjects showed no significant pain changes between the tenth and the follow up session, a gradual pain reduction was seen in the APS therapy group during this period (P<0.05. A gradual dosage reduction was recorded only in the APS therapy group, indicating a slight correlation with pain reduction (r=0.4.Conclusion: The

  9. Market analysis of APS/SCM applications and technologies

    OpenAIRE

    Prášil, Zdeněk

    2009-01-01

    The bachelor thesis aims to describe a current worldwide market of APS/SCM technologies and applications , i.e. advanced planned scheduling /supply chain management. In the first part, the APS/SCM is described in theory. The APS/SCM is defined and its benefits and impacts on company are discussed. The next part of the work is focused on the market with APS/SCM and the distribution of forces in the market. The demand and supply of this market segment is analyzed. In the last part, solutions of...

  10. Abelian groups

    CERN Document Server

    Fuchs, László

    2015-01-01

    Written by one of the subject’s foremost experts, this book focuses on the central developments and modern methods of the advanced theory of abelian groups, while remaining accessible, as an introduction and reference, to the non-specialist. It provides a coherent source for results scattered throughout the research literature with lots of new proofs. The presentation highlights major trends that have radically changed the modern character of the subject, in particular, the use of homological methods in the structure theory of various classes of abelian groups, and the use of advanced set-theoretical methods in the study of undecidability problems. The treatment of the latter trend includes Shelah’s seminal work on the undecidability in ZFC of Whitehead’s Problem; while the treatment of the former trend includes an extensive (but non-exhaustive) study of p-groups, torsion-free groups, mixed groups, and important classes of groups arising from ring theory. To prepare the reader to tackle these topics, th...

  11. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  12. AP1000主系统先进性分析%The Progressiveness Analysis of the AP1000 Main System

    Institute of Scientific and Technical Information of China (English)

    李家杰

    2012-01-01

      本文总结了第三代先进非能动压水堆核电厂AP1000主系统的主要特点,对AP1000主系统的先进性进行了分析,核电厂主系统设计人员能够从该文中了解到 AP1000主系统与第二代核电厂主系统之间的差别。%  This paper summarizes the main features of the AP1000 main system of the third generation of advanced passive pressurized water reactor nuclear power plant , and analyzes the progressiveness of the AP1000 main system .From this paper, the main system designers of nuclear power factory can learn the difference between the second-generation nuclear power factory main system and AP1000 main system

  13. Genome-Wide Identification of the Target Genes of AP2-O, a Plasmodium AP2-Family Transcription Factor.

    Directory of Open Access Journals (Sweden)

    Izumi Kaneko

    2015-05-01

    Full Text Available Stage-specific transcription is a fundamental biological process in the life cycle of the Plasmodium parasite. Proteins containing the AP2 DNA-binding domain are responsible for stage-specific transcriptional regulation and belong to the only known family of transcription factors in Plasmodium parasites. Comprehensive identification of their target genes will advance our understanding of the molecular basis of stage-specific transcriptional regulation and stage-specific parasite development. AP2-O is an AP2 family transcription factor that is expressed in the mosquito midgut-invading stage, called the ookinete, and is essential for normal morphogenesis of this stage. In this study, we identified the genome-wide target genes of AP2-O by chromatin immunoprecipitation-sequencing and elucidate how this AP2 family transcription factor contributes to the formation of this motile stage. The analysis revealed that AP2-O binds specifically to the upstream genomic regions of more than 500 genes, suggesting that approximately 10% of the parasite genome is directly regulated by AP2-O. These genes are involved in distinct biological processes such as morphogenesis, locomotion, midgut penetration, protection against mosquito immunity and preparation for subsequent oocyst development. This direct and global regulation by AP2-O provides a model for gene regulation in Plasmodium parasites and may explain how these parasites manage to control their complex life cycle using a small number of sequence-specific AP2 transcription factors.

  14. Comparative evaluation of topical Sodium fusidate cream in common pyodermas with topical gentamicin ointment and systemic antibiotics

    Directory of Open Access Journals (Sweden)

    Roy AK

    1996-01-01

    Full Text Available ABSTRACT: One hundred cases of common pyodermas consisting of four groups, namely impetigo, furunculosis and chronic folliculitis were taken. Each group containing twenty five cases were divided again into three subgroups. From each group, 15 were treated with 2 percent Sodium fusidate cream, 5 were with 0.1 percent Gentamycin sulphate cream and the rest 5 with systemic Erythromycin stearate. In the group of Impetigo, Bockhart′s Impetigo and Furunculosis, topical Sodium fusidate cream showed excellent result, better than Gentamycin topical and equal to that of systemic Erythromycin stearate.

  15. Selecting a Topic in Public Speaking

    Institute of Scientific and Technical Information of China (English)

    刘玉霞

    2013-01-01

    The first step in speechmaking is choosing a topic, which will decide the success of the speech. In the paper, we are go⁃ing to discuss how to select a topic in public speaking, and we’ll mainly talk about the following: the speaker, the occasion and the audience, selecting a topic, specific methods for choosing a topic and available topics.

  16. Residual radiation studies at AP0

    Energy Technology Data Exchange (ETDEWEB)

    Alexander J Elwyn et al.

    2002-06-19

    The radiation environment at the NuMI experiment has received a lot of attention in the last few years in preparation for project construction. One important issue is the induced radioactivation of the components in the beam line and the shielding materials. This arises from irradiation by hadrons that are generated in the target. Since the level of the residual activity has to be considered when determining access procedures for maintenance during NuMI operation, an understanding of the properties of the remnant radiation is important. To this end, experimental studies were performed in the target vault at AP0 which is similar in design to the NuMI target area. Here 120 GeV protons bombard a target, generating the hadrons that produce the induced radioactivity. Two sets of samples each consisting of three small cylindrical or rectangular solids of iron and steel, one sample of aluminum, and one of concrete were irradiated. One set was hung just below the bottom of a module near the lithium lens (in-vault), and the other was placed on top of the modules downstream of this location (above-vault), just beneath the movable concrete roof of the vault at AP0. Further, four thin activation foils of Au, Au+Cd, In, and Al (along with small disks of the same iron, aluminum, and concrete samples discussed above) were mounted on four 10.2 cm diameter Al disks, one placed on the in-vault module and three at above-vault downstream locations as well. The radioactivity of all these materials on the 10.2 cm Al disks was determined at the Radioisotope Analysis Facility in an attempt to characterize the radionuclides produced during irradiation. The activities of the thin foils were employed in an effort to unfold a spectrum of the neutrons produced during the hadronic cascades in the target. The MARS Monte Carlo code (MO95, MO00) was used to predict and analyze the residual radiation produced during the beam irradiation. New subroutines have been developed for the MARS14 version

  17. Topical agents in burn care

    Directory of Open Access Journals (Sweden)

    Momčilović Dragan

    2002-01-01

    Full Text Available Introduction Understanding of fluid shifts and recognition of the importance of early and appropriate fluid replacement therapy have significantly reduced mortality in the early post burn period. After the bum patient successfully passes the resuscitation period, the burn wound represents the greatest threat to survival. History Since the dawn of civilization, man has been trying to find an agent which would help burn wounds heal, and at the same time, not harm general condition of the injured. It was not until the XX century, after the discovery of antibiotics, when this condition was fulfilled. In 1968, combining silver and sulfadiazine, fox made silver-sulfadiazine, which is a 1% hydro-soluble cream and a superior agent in topical treatment of burns today. Current topical agents None of the topical antimicrobial agents available today, alone or combined, have the characteristics of ideal prophylactic agents, but they eliminate colonization of burn wound, and invasive infections are infrequent. With an excellent spectrum of activity, low toxicity, and ease of application with minimal pain, silver-sulfadiazine is still the most frequently used topical agent. Conclusion The incidence of invasive infections and overall mortality have been significantly reduced after introduction of topical burn wound antimicrobial agents into practice. In most burn patients the drug of choice for prophylaxis is silver sulfadiazine. Other agents may be useful in certain clinical situations.

  18. AP-42 ADDITIONS AND REVISIONS - LANDFILLS (COMBUSTION CONTROLS)

    Science.gov (United States)

    This project develops emission factors, etc., for landfills, in particular for combustion devices fed by landfill gas, for incorporation into AP-42. AP-42 is a massive collection of information concerning processes which generate air emissions and presents emission factors and co...

  19. Data-Based Decision Making: The Road to AP Equity

    Science.gov (United States)

    Edwards, Kelcey; Duggan, Odette

    2012-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Lake Buena Vista, FL in July 2012. This presentation reviews concepts central to achieving equitable AP access and success for all willing and academically prepared students. We analyze trends in participation and performance by race/ethnicity from the AP Report to the Nation and…

  20. A Closer Examination of the Academic Benefits of AP

    Science.gov (United States)

    McKillip, Mary E. M.; Rawls, Anita

    2013-01-01

    The authors sought to better understand the relationship between students participating in the Advanced Placement (AP) program and subsequent performance on the Scholastic Aptitude Test (SAT). Focusing on students graduating from U.S. public high schools in 2010, the authors used propensity scores to match junior year AP examinees in 3 subjects to…

  1. Quantum mechanics II advanced topics

    CERN Document Server

    Rajasekar, S

    2015-01-01

    Quantum Mechanics II: Advanced Topics uses more than a decade of research and the authors’ own teaching experience to expound on some of the more advanced topics and current research in quantum mechanics. A follow-up to the authors introductory book Quantum Mechanics I: The Fundamentals, this book begins with a chapter on quantum field theory, and goes on to present basic principles, key features, and applications. It outlines recent quantum technologies and phenomena, and introduces growing topics of interest in quantum mechanics. The authors describe promising applications that include ghost imaging, detection of weak amplitude objects, entangled two-photon microscopy, detection of small displacements, lithography, metrology, and teleportation of optical images. They also present worked-out examples and provide numerous problems at the end of each chapter.

  2. Topics in current aerosol research

    CERN Document Server

    Hidy, G M

    1971-01-01

    Topics in Current Aerosol Research deals with the fundamental aspects of aerosol science, with emphasis on experiment and theory describing highly dispersed aerosols (HDAs) as well as the dynamics of charged suspensions. Topics covered range from the basic properties of HDAs to their formation and methods of generation; sources of electric charges; interactions between fluid and aerosol particles; and one-dimensional motion of charged cloud of particles. This volume is comprised of 13 chapters and begins with an introduction to the basic properties of HDAs, followed by a discussion on the form

  3. Topics in millimeter wave technology

    CERN Document Server

    Button, Kenneth

    1988-01-01

    Topics in Millimeter Wave Technology, Volume 1 presents topics related to millimeter wave technology, including fin-lines and passive components realized in fin-lines, suspended striplines, suspended substrate microstrips, and modal power exchange in multimode fibers. A miniaturized monopulse assembly constructed in planar waveguide with multimode scalar horn feeds is also described. This volume is comprised of five chapters; the first of which deals with the analysis and synthesis techniques for fin-lines as well as the various passive components realized in fin-line. Tapers, discontinuities,

  4. Selected topics in nuclear structure

    International Nuclear Information System (INIS)

    The Fourth International Conference on selected topics in nuclear structure was held at Dubna in July 1994 on recent experimental and theoretical investigations in nuclear structure. Topics discussed were the following: nuclear structure at low-energy excitations (collective quasiparticle phenomena, proton-neutron interactions, microscopic and phenomenological theories of nuclear structure; nuclear structure studies with charged particles. heavy ions, neutrons and photons; nuclei at high angular momenta and superdeformation, structure and decay properties of giant resonances, charge-exchange resonances and β-decay; semiclassical approach of large amplitude collective motion and structure of hot nuclei

  5. Application of Topic Map on Knowledge Organization

    Directory of Open Access Journals (Sweden)

    Sou-shan Wu

    2003-06-01

    Full Text Available Knowledge management (KM has received much attention from both academics and practitioners in the past few years. Following the KM trend, many organizations have built their own knowledge repositories or data warehouses. However, information or knowledge is still scattered everywhere without being properly managed. The rapid growth of the Internet accelerates the creation of unstructured and unclassified information and causes the explosion of information overload. The effort of browsing information through general-purpose search engines turns out to be tedious and painstaking. Hence, an effective technology to solve this information retrieval problem is much needed. The purpose of this research is to explore the application of text mining technique in organizing knowledge stored in unstructured natural language text documents. Major components of text mining techniques required for topic map in particular will be presented in detail.Two sets of unstructured documents are utilized to demonstrate the usage of SOM for topic categorization. The first set of documents is a collection of speeches given by Y.C. Wang, Chairman of the Taiwan Plastics Group, and the other is the collection of all laws and regulations related to securities and future markets in Taiwan. We also try to apply text mining to these two sets of documents to generate their respective topic maps, thus revealing the differences between organizing explicit and tacit knowledge as well as the difficulties associated with tacit knowledge.[Article content in Chinese

  6. Genome-wide identification and phylogenetic analysis of the AP2/ERF gene superfamily in sweet orange (Citrus sinensis).

    Science.gov (United States)

    Ito, T M; Polido, P B; Rampim, M C; Kaschuk, G; Souza, S G H

    2014-09-26

    Sweet orange (Citrus sinensis) plays an important role in the economy of more than 140 countries, but it is grown in areas with intermittent stressful soil and climatic conditions. The stress tolerance could be addressed by manipulating the ethylene response factor (ERF) transcription factors because they orchestrate plant responses to environmental stress. We performed an in silico study on the ERFs in the expressed sequence tag database of C. sinensis to identify potential genes that regulate plant responses to stress. We identified 108 putative genes encoding protein sequences of the AP2/ERF superfamily distributed within 10 groups of amino acid sequences. Ninety-one genes were assembled from the ERF family containing only one AP2/ERF domain, 13 genes were assembled from the AP2 family containing two AP2/ERF domains, and four other genes were assembled from the RAV family containing one AP2/ERF domain and a B3 domain. Some conserved domains of the ERF family genes were disrupted into a few segments by introns. This irregular distribution of genes in the AP2/ERF superfamily in different plant species could be a result of genomic losses or duplication events in a common ancestor. The in silico gene expression revealed that 67% of AP2/ERF genes are expressed in tissues with usual plant development, and 14% were expressed in stressed tissues. Because the AP2/ERF superfamily is expressed in an orchestrated way, it is possible that the manipulation of only one gene may result in changes in the whole plant function, which could result in more tolerant crops.

  7. Anesthetic effectiveness of topical levobupivacaine 0.75% versus topical proparacaine 0.5% for intravitreal injections

    Directory of Open Access Journals (Sweden)

    Nurgül Örnek

    2014-01-01

    Full Text Available Background and Purpose: Today no method of topical anesthesia for intravitreal injection administration has been proven to make the patient comfortable yet. We compared the efficacy of topical levobupivacaine 0.75% and proparacaine 0.5% in patients undergoing intravitreal injections. Materials and Methods: A prospective, randomized study comparing two agents for topical anesthesia in intravitreal injections. Ninety-six consecutive patients were enrolled into two groups to receive either topical levobupivacaine 0.75% (n=48 or proparacaine 0.5% (n=48. Patients were asked to score their pain using a visual analog scale (VAS immediately following the injection. The average of these scores was used as the primary outcome. The surgeon performing the procedure scored his perception of the patients′ pain using the Wong-Baker FACES scale. Results: Mean VAS pain scores for two groups were found to be 44.77 ± 16.42 and 34.18 ± 14.83, respectively. Mean VAS pain score in the proparacaine group was significantly lower than that in the levobupivacaine group (P= 0.003. Mean Wong-Baker FACES scores for the two groups were 1.08 ± 0.49 and 1.10 ± 0.30, respectively. There was no statistically significant difference between levobupivacaine and proparacaine groups (P=0.824. Conclusions: Topical proparacaine 0.5% was more effective in preventing pain during intravitreal injections.

  8. Dicty_cDB: FC-AP05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP05 (Link to dictyBase) - - - Contig-U16521-1 FC-AP05Z (Li...nk to Original site) - - FC-AP05Z 532 - - - - Show FC-AP05 Library FC (Link to library) Clone ID FC-AP05 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP05Q.Seq.d/ Representative seq. ID FC-AP...05Z (Link to Original site) Representative DNA sequence >FC-AP05 (FC-AP05Q) /CSM/FC/FC-AP/FC-AP05Q.Seq....GAGA TCCGTCAAAGTTTCAAGCAAAAAAGTTGTTGCCAAGTAAATAAATAATACTTTTTTCCCT AT sequence update 1997. 3.25 Translated Amino Acid sequence ---AP

  9. Dicty_cDB: FC-AP23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP23 (Link to dictyBase) - G03230 DDB0190153 Contig-U16094-1 FC-AP...23P (Link to Original site) FC-AP23F 515 FC-AP23Z 472 FC-AP23P 987 - - Show FC-AP23 Library FC (Link ...ontig Contig-U16094-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...23Q.Seq.d/ Representative seq. ID FC-AP23P (Link to Original site) Representative DNA sequence >FC-AP23 (FC-AP...23Q) /CSM/FC/FC-AP/FC-AP23Q.Seq.d/ CAAATACATAATCTCTTTTTTGAAAATGTCCGAAAATAACGAAATTGAAATGGAACTCC

  10. Dicty_cDB: FC-AP12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP12 (Link to dictyBase) - G01739 DDB0232214 Contig-U15924-1 FC-AP...12P (Link to Original site) FC-AP12F 323 FC-AP12Z 613 FC-AP12P 936 - - Show FC-AP12 Library FC (Link ...ontig Contig-U15924-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...12Q.Seq.d/ Representative seq. ID FC-AP12P (Link to Original site) Representative DNA sequence >FC-AP12 (FC-AP...12Q) /CSM/FC/FC-AP/FC-AP12Q.Seq.d/ CATATTATTTTAAATTTCAGATGTTCCCAAAATAACACATTAATTTGCTTTTTTTGTTG

  11. AP1000R licensing and deployment in the United States

    International Nuclear Information System (INIS)

    In recent years, both domestic and foreign utilities have turned to the standardized Westinghouse AP1000 plant design in satisfying their near - and long-term - sustainable energy needs. As direct support to these actions, licensing the AP1000 design has played a significant role by providing one of the fundamental bases in clearing regulatory hurdles leading to the start of new plant construction. Within the U.S. alone, Westinghouse AP1000 licensing activities have reached unprecedented milestones with the approvals of both AP1000 Design Certification and Southern Company's combined construction permit and operating license (COL) application directly supporting the construction of two new nuclear plants in Georgia. Further COL application approvals are immediately pending for an additional two AP1000 plants in South Carolina. And, across the U.S. nuclear industry spectrum, there are 10 other COL applications under regulatory review representing some 16 new plants at 10 sites. In total, these actions represent the first wave of new plant licensing under the regulatory approval process since 1978. Fundamental to the Nuclear Regulatory Commission's AP1000 Design Certification is the formal recognition of the AP1000 passive safety design through regulatory acceptance rulemaking. Through recognition and deployment of the AP1000 Design Certification, the utility licensee / operator of this reactor design are now offered an opportunity to use a simplified 'one-step' combined license process, thereby managing substantial back-end construction schedule risk from regulatory and intervention delays. Application of this regulatory philosophy represents both acceptance and encouragement of standardized reactor designs like the AP1000. With the recent AP1000 Design Certification and utility COL acceptances, the fundamental licensing processes of this philosophy have successfully proven the attainment of significant milestones with the next stage licensing actions directed

  12. The Health Curriculum: 500 Topics.

    Science.gov (United States)

    Byrd, Oliver E.

    2001-01-01

    This 1958 paper divides 500 health topics into 20 categories: health as a social accomplishment/social problem; nutrition; physical fitness; mental health and disease; heredity/eugenics; infection/immunity; chronic and degenerative disease; substance abuse; skin care; vision, hearing, and speech; dental health; safety; physical environment; health…

  13. Selected topics in nuclear structure

    International Nuclear Information System (INIS)

    19. winter school in Zakopane was devoted to selected topics in nuclear structure such as: production of spin resonances, heavy ions reactions and their applications to the investigation of high spin states, octupole deformations, excited states and production of new elements etc. The experimental data are ofen compared with theoretical predictions. Report contains 28 papers. (M.F.W.)

  14. Topics in optics and music

    Science.gov (United States)

    Sparks, Andrew W.

    2012-10-01

    While the use of optics in the playback of music has been a tremendously successful technology and laser light shows are a common occurrence, other intersections of optics and music tend to be less well known. Topics such as optics-based instruments, performance tools and effects, instrument characterization and manufacturing, recording, playback, and signal processing are explored.

  15. The A.P Møller shares, the US dollar and the price of oil

    DEFF Research Database (Denmark)

    Risager, Ole

    2003-01-01

    1. Brief IntroductionThe two companies D/S Svendborg and D/S 1912 have for almost a century been the parent companiesof the A.P. Møller Group. These companies were founded by Mr. Arnold Peter Møller and his fatherCaptain Peter Mærsk Møller. They were in the beginning entirely into shipping. In 19...

  16. The pharmacology of topical analgesics.

    Science.gov (United States)

    Barkin, Robert L

    2013-07-01

    Pain management of patients continues to pose challenges to clinicians. Given the multiple dimensions of pain--whether acute or chronic, mild, moderate, or severe, nociceptive or neuropathic--a multimodal approach may be needed. Fortunately, clinicians have an array of nonpharmacologic and pharmacologic treatment choices; however, each modality must be chosen carefully, because some often used oral agents are associated with safety and tolerability issues that restrict their use in certain patients. In particular, orally administered nonsteroidal antiinflammatory drugs, opioids, antidepressants, and anticonvulsants are known to cause systemic adverse effects in some patients. To address this problem, a number of topical therapies in various therapeutic classes have been developed to reduce systemic exposure and minimize the risks of patients developing adverse events. For example, topical nonsteroidal anti-inflammatory drug formulations produce a site-specific effect (ie, cyclo-oxygenase inhibition) while decreasing the systemic exposure that may lead to undesired effects in patients. Similarly, derivatives of acetylsalicylic acid (ie, salicylates) are used in topical analgesic formulations that do not significantly enter the patient's systemic circulation. Salicylates, along with capsaicin, menthol, and camphor, compose the counterirritant class of topical analgesics, which produce analgesia by activating and then desensitizing epidermal nociceptors. Additionally, patches and creams that contain the local anesthetic lidocaine, alone or co-formulated with other local anesthetics, are also used to manage patients with select acute and chronic pain states. Perhaps the most common topical analgesic modality is the cautious application of cutaneous cold and heat. Such treatments may decrease pain not by reaching the target tissue through systemic distribution, but by acting more directly on the affected tissue. Despite the tolerability benefits associated with avoiding

  17. Topical nonsteroidal anti-inflammatory drugs for the treatment of pain due to soft tissue injury: diclofenac epolamine topical patch

    OpenAIRE

    Lionberger, David R; Brennan, Michael J.

    2010-01-01

    David R Lionberger1, Michael J Brennan21Southwest Orthopedic Group, Houston, TX, USA; 2Department of Medicine, Bridgeport Hospital, Bridgeport, CT, USAAbstract: The objective of this article is to review published clinical data on diclofenac epolamine topical patch 1.3% (DETP) in the treatment of acute soft tissue injuries, such as strains, sprains, and contusions. Review of published literature on topical nonsteroidal anti-inflammatory drugs (NSAIDs), diclofenac, and DETP in patients with ac...

  18. Facilities removal working group

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    This working group`s first objective is to identify major economic, technical, and regulatory constraints on operator practices and decisions relevant to offshore facilities removal. Then, the group will try to make recommendations as to regulatory and policy adjustments, additional research, or process improvements and/or technological advances, that may be needed to improve the efficiency and effectiveness of the removal process. The working group will focus primarily on issues dealing with Gulf of Mexico platform abandonments. In order to make the working group sessions as productive as possible, the Facilities Removal Working Group will focus on three topics that address a majority of the concerns and/or constraints relevant to facilities removal. The three areas are: (1) Explosive Severing and its Impact on Marine Life, (2) Pile and Conductor Severing, and (3) Deep Water Abandonments This paper will outline the current state of practice in the offshore industry, identifying current regulations and specific issues encountered when addressing each of the three main topics above. The intent of the paper is to highlight potential issues for panel discussion, not to provide a detailed review of all data relevant to the topic. Before each panel discussion, key speakers will review data and information to facilitate development and discussion of the main issues of each topic. Please refer to the attached agenda for the workshop format, key speakers, presentation topics, and panel participants. The goal of the panel discussions is to identify key issues for each of the three topics above. The working group will also make recommendations on how to proceed on these key issues.

  19. AP600 design certification thermal hydraulics testing and analysis

    International Nuclear Information System (INIS)

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power

  20. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.

    1995-09-01

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  1. A new gap separation mechanism for APS insertion devices.

    Energy Technology Data Exchange (ETDEWEB)

    Trakhtenberg, E. M.; Tcheskidov, V.; Den Hartog, P. K.; Deriy, B.; Erdmann, M.; Makarov, O.; Moog, E. R.

    1999-10-25

    A new gap separation mechanism for use with the standard Advanced Photon Source (APS) 3.3-cm-period undulator magnetic structures has been designed and built and the first system has been installed in the APS storage ring. The system allows a minimum magnetic gap of 10 mm for use with the APS 8-mm insertion device vacuum chambers. The mechanism is a bolted steel frame structure with a simple 4-motor mechanical drive train. The control system uses servomotors with incremental rotary encoders and virtual absolute linear encoders.

  2. Efeito da mitomicina C tópica na cicatrização de prega vocal em modelo suíno Topical mitomycin C effect on swine vocal folds healing

    Directory of Open Access Journals (Sweden)

    Paulo Antônio Monteiro Camargo

    2006-10-01

    Full Text Available Várias terapias adjuvantes à cirurgia vêm sendo usadas para modular o processo cicatricial nas pregas vocais, entre elas a Mitomicina tópica (MTC. OBJETIVOS: Avaliar os efeitos da MTC no processo de cicatrização de pregas vocais de suínos 30 dias após exérese de fragmento de mucosa com laser de CO2 mediante a mensuração da deposição de colágeno. FORMA DE ESTUDO: Experimental em suínos. MATERIAIS E MÉTODOS: Dois grupos de 6 suínos cada foram avaliados após exérese de fragmento de mucosa de prega vocal a laser de CO2 (grupo controle sem uso e grupo experimento com uso de MTC tópica. Após 30 dias os animais foram submetidos à eutanásia, sendo coletadas amostras das pregas vocais para análise histológica, a fim de quantificar a deposição de colágeno mediante coloração de Picrosirius Red. RESULTADOS: A média da área do colágeno total das pregas vocais do grupo controle foi de 2648,03 µm2, enquanto a média do colágeno total das pregas vocais do grupo experimento foi de 2200,30 µm2 (p = 0,0043. CONCLUSÃO: A MTC usada topicamente após a exérese de fragmento de mucosa da prega vocal a laser de CO2 em suínos, diminui, significativamente, a deposição do colágeno total.several adjuvant therapies to surgery have been used to modulate the healing process of vocal folds, including topic mitomycin (MTC. AIM: to evaluate the effect of topical MTC in the healing process of vocal folds 30 days after the exeresis of a mucosal fragment with CO2 laser in a swine model (control group without mitomycin and study group with topical MTC, with collagen deposition measurement. STUDY TYPE: prospective experimental in swine. METHODS: two groups of 6 swine each were subjected to exeresis of a mucosal fragment of the vocal fold with CO2 laser. Immediately after the procedure MTC was applied topically for three minutes on the study group. Thirty days later the animals were slaughtered and samples of the vocal folds were collected for

  3. Four (Somewhat Nonstandard) Research Topics

    OpenAIRE

    Paun, Gheorghe; Research Group on Natural Computing (Universidad de Sevilla) (Coordinador)

    2014-01-01

    Four research directions are suggested, dealing with the following four main ideas: computing along the axon (up to now, this topic was only preliminarily investi- gated), using pre-computed resources in order to solve computationally hard problems, considering in P systems both objects \\of matter" and \\of anti-matter" (which annihilate each other when meet), and considering the distance (naturally de ned in a membrane structure of a given type) as a support of information.

  4. Preface to Special Topic: Optofluidics

    OpenAIRE

    Liu, Ai-qun

    2010-01-01

    This Special Topic section of Biomicrofluidics is on optofluidics or micro-optofluidic systems (MOFS), a burgeoning technology that aims to manipulate light and fluid at microscale and exploits their interaction to create highly versatile devices and integrated systems. This special issue puts together various contributed articles focusing on optofluidics or MOFS, which help inspire new research ideas and innovation in the microfluidics and nanofluidics community.

  5. Probabilistic analysis and related topics

    CERN Document Server

    Bharucha-Reid, A T

    1983-01-01

    Probabilistic Analysis and Related Topics, Volume 3 focuses on the continuity, integrability, and differentiability of random functions, including operator theory, measure theory, and functional and numerical analysis. The selection first offers information on the qualitative theory of stochastic systems and Langevin equations with multiplicative noise. Discussions focus on phase-space evolution via direct integration, phase-space evolution, linear and nonlinear systems, linearization, and generalizations. The text then ponders on the stability theory of stochastic difference systems and Marko

  6. Topics in clinical oncology. 15

    International Nuclear Information System (INIS)

    The monograph comprising primarily papers on topical subjects of oncology and cancer research, contains also a selection of papers presented at the 2. Congress of the Czechoslovak Society of Nuclear Medicine and Radiation Hygiene. Seven papers were selected on behalf of their subject related to clinical oncology. All of them were iputted in INIS; five of them deal with the scintiscanning of the skeleton of cancer patients, one with radioimmunodetection of tumors, and one with radionuclide lymphography. (A.K.)

  7. Hot topics from the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Glenzinski, D.; /Fermilab

    2008-01-01

    The Tevatron Run-II began in March 2001. To date, both the CDF and D0 experiments have collected 1 fb{sup -1} of data each. The results obtained from this data set were summarized at this conference in 39 parallel session presentations covering a wide range of topics. The author summarizes the most important of those results here and comments on some of the prospects for the future.

  8. Dicty_cDB: FC-AP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 SJMBIB09 SJM Schistosoma japonicum cDNA, mRNA sequence. 80 8e-20 2 BE859184 |BE859184.1 SsS0499 Suaeda salsa ZAP...FC (Link to library) FC-AP17 (Link to dictyBase) - - - Contig-U16254-1 FC-AP17Z (Li...nk to Original site) - - FC-AP17Z 546 - - - - Show FC-AP17 Library FC (Link to library) Clone ID FC-AP17 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP17Q.Seq.d/ Representative seq. ID FC-AP...17Z (Link to Original site) Representative DNA sequence >FC-AP17 (FC-AP17Q) /CSM/FC/FC-AP/FC-AP17Q.Seq.

  9. Dicty_cDB: FC-AP11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone IMAGE:4920557 5', mRNA sequence. 56 1e-04 2 BF345929 |BF345929.1 602017931F1 NCI_CGAP_Brn67 Homo sap...FC (Link to library) FC-AP11 (Link to dictyBase) - - - Contig-U16101-1 FC-AP11F (Li...nk to Original site) FC-AP11F 394 - - - - - - Show FC-AP11 Library FC (Link to library) Clone ID FC-AP11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP11Q.Seq.d/ Representative seq. ID FC-AP...11F (Link to Original site) Representative DNA sequence >FC-AP11 (FC-AP11Q) /CSM/FC/FC-AP/FC-AP11Q.Seq.

  10. Dicty_cDB: FC-AP18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP18 (Link to dictyBase) - - - Contig-U16455-1 FC-AP18Z (Li...nk to Original site) - - FC-AP18Z 367 - - - - Show FC-AP18 Library FC (Link to library) Clone ID FC-AP18 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP18Q.Seq.d/ Representative seq. ID FC-AP...18Z (Link to Original site) Representative DNA sequence >FC-AP18 (FC-AP18Q) /CSM/FC/FC-AP/FC-AP18Q.Seq....XELTPSRPMCVESFNEYPP LGRFAVRDMGQTVAVGVIKSTVKKAPGKAGDKKGAXAPSKKK*innis**iafynnfkkk kkkkk Translated Amino Acid

  11. Dicty_cDB: FC-AP16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP16 (Link to dictyBase) - - - Contig-U16269-1 FC-AP16Z (Li...nk to Original site) - - FC-AP16Z 552 - - - - Show FC-AP16 Library FC (Link to library) Clone ID FC-AP16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP16Q.Seq.d/ Representative seq. ID FC-AP...16Z (Link to Original site) Representative DNA sequence >FC-AP16 (FC-AP16Q) /CSM/FC/FC-AP/FC-AP16Q.Seq....7. 3.28 Translated Amino Acid sequence ---RNRRYKVRKGPLVVVSGKTTVSQALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWT KSAFEQLD

  12. Tank characterization report for double shell tank 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    Winkelman, W.D., Westinghouse Hanford

    1996-08-07

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AP-104. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  13. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  14. Hemostatic effect of topical hemocoagulase spray in digestive endoscopy

    Science.gov (United States)

    Wang, Tao; Wang, Dan-Na; Liu, Wen-Tian; Zheng, Zhong-Qing; Chen, Xin; Fang, Wei-Li; Li, Shu; Liang, Li; Wang, Bang-Mao

    2016-01-01

    AIM: To evaluate the hemostatic effect of topical hemocoagulase spray in digestive endoscopy. METHODS: Eighty-nine patients who developed oozing bleeding during endoscopic treatment from September 2014 to October 2014 at Center for Digestive Endoscopy, Tianjin Medical University General Hospital were randomly divided into either a study group (n = 39) or a control group (n = 50). The study group was given topical hemocoagulase spray intraoperatively, while the control group was given traditional 8% norepinephrine spray. Hemostatic efficacy was compared between the two groups. Bleeding site, wound cleanliness and perforation were recorded, and the rates of perforation and late bleeding were compared. RESULTS: Successful hemostasis was achieved in 39 (100%) patients of the study group and in 47 (94.0%) patients of the control group, and there was no significant difference in the rate of successful hemostasis between the two groups. Compared with the control group, after topical hemocoagulase spray in the study group, the surgical field was clearer, the bleeding site was more easily identified, and the wound was cleaner. There was no significant difference in the rate of perforation between the study and control groups (16.7% vs 35.0%, P = 0.477), but the rates of late bleeding (0% vs 15.8%, P = 0.048) and overall complications (P = 0.032) were significantly lower in the study group. CONCLUSION: Topical hemocoagulase spray has a definite hemostatic effect for oozing bleeding in digestive endoscopy, and this method is convenient, safe, and reliable. It is expected to become a new method for endoscopic hemostasis. PMID:27433096

  15. Roles of AP-2 in clathrin-mediated endocytosis.

    Directory of Open Access Journals (Sweden)

    Emmanuel Boucrot

    Full Text Available BACKGROUND: The notion that AP-2 clathrin adaptor is an essential component of an endocytic clathrin coat appears to conflict with recent observations that substantial AP-2 depletion, using RNA interference with synthesis of AP-2 subunits, fails to block uptake of certain ligands known to internalize through a clathrin-based pathway. METHODOLOGY/PRINCIPAL FINDINGS: We report here the use of in vivo imaging data obtained by spinning-disk confocal microscopy to study the formation of clathrin-coated structures at the plasma membranes of BSC1 and HeLa cells depleted by RNAi of the clathrin adaptor, AP-2. Very few clathrin coats continue to assemble after AP-2 knockdown. Moreover, there is a total absence of clathrin-containing structures completely lacking AP-2 while all the remaining coats still contain a small amount of AP-2. These observations suggest that AP-2 is essential for endocytic coated-pit and coated-vesicle formation. We also find that AP-2 knockdown strongly inhibits light-density lipoprotein (LDL receptor-mediated endocytosis, as long as cells are maintained in complete serum and at 37 degrees C. If cells are first incubated with LDL at 4 degrees C, followed by warming, there is little or no decrease in LDL uptake with respect to control cells. LDL uptake at 37 degrees C is also not affected in AP-2 depleted cells first deprived of LDL by incubation with either serum-starved or LDL-starved cells for 24 hr. The LDL-deprived cells display a significant increase in endocytic structures enriched on deeply invaginated tubes that contain LDL and we suggest that under this condition of stress, LDL might enter through this alternative pathway. CONCLUSIONS/SIGNIFICANCE: These results suggest that AP-2 is essential for endocytic clathrin coated-pit and coated-vesicle formation. They also indicate that under normal conditions, functional endocytic clathrin coated pits are required for LDL internalization. We also show that under certain

  16. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-05-18

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  17. AP1000 design adaptation to European Markets and EUR compliance

    International Nuclear Information System (INIS)

    The AP1000 plant is an 1100-MWe pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. One of the key approaches in the AP1000 design is to use passive features to mitigate design basis accidents. In addition to redundancy, these features incorporate diversity based on PRA insights. The AP1000 design has incorporated a standardization approach, which together with the level of safety achieved by the passive safety features, results in a plant design that can be applied to different geographical regions with varying regulatory standards and utility expectations without major changes. Westinghouse has cooperated for almost 2 decades with European utilities to ensure adaptation of the AP1000 design to European market. The AP1000 50 Hz standard design (also referred to as European Passive Standard) is the resulting adaptation of the AP1000 design to European market needs and requirements, addressing both customer input from the EPP program and regulatory needs identified in the UK GDA process. This standard 50 Hz design retains the overall AP1000 design (safe, simple, standard), the use of proven components and its cost, safety and operability advantages, while it incorporates some changes to adapt to the European environment. In this paper, the key changes incorporated into the AP1000 50 Hz design are discussed, including: -) Adaptation of the electrical systems and Turbine adaptation from 60 Hz to 50 Hz, including approach to IEC vs IEEE compliance; -) Modifications to defense in depth (US class D, European Class 2) and other systems to simplify European licensing and address customer requirements; -) Option for adoption of KSB RUV type Main Reactor Coolant Pumps; -) Limited design adaptations in the areas of instrumentation-control and ventilation and filtration to adapt to European requirements and simplify the licensing process

  18. Analysis and characterization of double shell tank 241-AP-108

    International Nuclear Information System (INIS)

    This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank

  19. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov

    2005-06-01

    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  20. Topical corticosteroids: clinical pharmacology and therapeutic use.

    Science.gov (United States)

    Miller, J A; Munro, D D

    1980-02-01

    The development of topical corticosteroids has enabled many dermatoses to be more effectively treated than previously, but there is also no doubt that misuse of these preparations can lead to troublesome local effects and potentially serious systemic problems. The most effective assay for comparing different compounds has been their vasoconstrictive activity, and this on the whole correlates well with clinical effect. To be effective, corticosteroid must be absorbed and the importance of concentration, occlusion, the type of vehicle, added penetrants such as urea and the anatomical site, on the amount of absorption and therefore on clinical activity has been demonstrated. Ointments have been shown to be more effective than creams but because of the considerable choice of potencies now available most dermatologists tend to prescribe the different formulations according to the wishes of the patient. For the same reason, dilution of the commercially marketed preparations is now not generally recommended. The main therapeutic activity of topical corticosteroids is their nonspecific anti-inflammatory effect, thought to be primarily a result of their action on the chemical mediators of inflammation. They have also been shown to be antimitotic which may well be relevant not only to the treatment of scaling dermatoses but also to their dermal thinning effect resulting from inhibition of fibroblasts. Combinations of corticosteroids with antibacterial and antifungal agents have been shown to be very effective in flexural eruptions and secondarily infected dermatoses. As a general rule, the use of topical corticosteroids in outpatients, unless badly misused, is not associated with any significant risk of adrenal axis suppression, but care must be exercised as to the amount prescribed, especially if large areas of the body are to be treated with highly potent preparations. Certain groups such as young children and patients with liver failure, and certain anatomical sites such

  1. Analysis of an accident type sbloca in reactor contention AP1000 with 8.0 Gothic code; Analisis de un accidente tipo Sbloca en la contencion del reactor AP1000 con el codigo Gothic 8.0

    Energy Technology Data Exchange (ETDEWEB)

    Goni, Z.; Jimenez Varas, G.; Fernandez, K.; Queral, C.; Montero, J.

    2016-08-01

    The analysis is based on the simulation of a Small Break Loss-of-Coolant-Accident in the AP1000 nuclear reactor using a Gothic 8.0 tri dimensional model created in the Science and Technology Group of Nuclear Fision Advanced Systems of the UPM. The SBLOCA has been simulated with TRACE 5.0 code. The main purpose of this work is the study of the thermo-hydraulic behaviour of the AP1000 containment during a SBLOCA. The transients simulated reveal close results to the realistic behaviour in case of an accident with similar characteristics. The pressure and temperature evolution enables the identification of the accident phases from the RCS point of view. Compared to the licensing calculations included in the AP1000 Safety Analysis, it has been proved that the average pressure and temperature evolution is similar, yet lower than the licensing calculations. However, the temperature and inventory distribution are significantly heterogeneous. (Author)

  2. Topics in black hole evaporation

    International Nuclear Information System (INIS)

    Two major aspects of particle creation by gravitational fields of black holes are studied: the neutrino emission from rotating black holes; and interactions between scalar particles emitted by a black hole. Neutrino emission is investigated under three topics: The asymmetry of the angular dependence of neutrino emission from rotating black holes; the production of a local matter excess by rotating black holes in a baryon symmetric universe; and cosmological magnetic field generation by neutrinos from evaporating black holes. Finally the author studies the effects of interactions on the black hole evaporation process

  3. Topics in atomic collision theory

    CERN Document Server

    Geltman, Sydney; Brueckner, Keith A

    1969-01-01

    Topics in Atomic Collision Theory originated in a course of graduate lectures given at the University of Colorado and at University College in London. It is recommended for students in physics and related fields who are interested in the application of quantum scattering theory to low-energy atomic collision phenomena. No attention is given to the electromagnetic, nuclear, or elementary particle domains. The book is organized into three parts: static field scattering, electron-atom collisions, and atom-atom collisions. These are in the order of increasing physical complexity and hence necessar

  4. Topics in commutative ring theory

    CERN Document Server

    Watkins, John J

    2009-01-01

    Topics in Commutative Ring Theory is a textbook for advanced undergraduate students as well as graduate students and mathematicians seeking an accessible introduction to this fascinating area of abstract algebra. Commutative ring theory arose more than a century ago to address questions in geometry and number theory. A commutative ring is a set-such as the integers, complex numbers, or polynomials with real coefficients--with two operations, addition and multiplication. Starting from this simple definition, John Watkins guides readers from basic concepts to Noetherian rings-one of

  5. Potential theory—selected topics

    CERN Document Server

    Aikawwa, Hiroaki

    1996-01-01

    The first part of these lecture notes is an introduction to potential theory to prepare the reader for later parts, which can be used as the basis for a series of advanced lectures/seminars on potential theory/harmonic analysis. Topics covered in the book include minimal thinness, quasiadditivity of capacity, applications of singular integrals to potential theory, L(p)-capacity theory, fine limits of the Nagel-Stein boundary limit theorem and integrability of superharmonic functions. The notes are written for an audience familiar with the theory of integration, distributions and basic functional analysis.

  6. Algorithms and theoretical topics on selected combinatorial optimization problems

    OpenAIRE

    Kaveh, Arman

    2010-01-01

    We study the Quadratic Assignment Problem (QAP), Three Dimensional Assignment Problem (3AP) and Quadratic Three Dimensional Assignment Problem (Q3AP), which combines aspects of both QAP and 3AP. The three problems are known to be NP-hard. We propose new algorithms for obtaining near optimal solutions of QAP and 3AP and present computational results. Our algorithms obtain improved solutions in some benchmark instances of QAP and 3AP. We also discuss theoretical results on 3AP and Q3AP such as ...

  7. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands.

    Science.gov (United States)

    Abe, Yukiko S; Sasaki, Shigeki

    2016-02-15

    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site.

  8. SU-E-T-14: A Feasibility Study of Using Modified AP Proton Beam for Post-Operative Pancreatic Cancer Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Ding, X; Witztum, A; Kenton, O; Younan, F; Dormer, J; Kremmel, E; Lin, H; Liu, H; Tang, S; Both, S; Kassaee, A; Avery, S [UniversityPennsylvania, Philadelphia, PA (United States)

    2014-06-01

    Purpose: Due to the unpredictability of bowel gas movement, the PA beam direction is always favored for robust proton therapy in post-operative pancreatic cancer treatment. We investigate the feasibility of replacing PA beam with a modified AP beam to take the bowel gas uncertainty into account. Methods: Nine post-operative pancreatic cancer patients treated with proton therapy (5040cGy, 28 fractions) in our institution were randomly selected. The original plan uses PA and lateral direction passive-scattering proton beams. Beam weighting is about 1:1. All patients received weekly verification CTs to assess the daily variations(total 17 verification CTs). The PA direction beam was replaced by two other groups of AP direction beam. Group AP: takes 3.5% range uncertainty into account. Group APmod: compensates the bowel gas uncertainty by expanding the proximal margin to 2cm more. The 2cm margin was acquired from the average bowel diameter in from 100 adult abdominal CT scans near pancreatic region (+/- 5cm superiorly and inferiorly). Dose Volume Histograms(DVHs) of the verification CTs were acquired for robustness study. Results: Without the lateral beam, Group APmod is as robust as Group PA. In Group AP, more than 10% of iCTV D98/D95 were reduced by 4–8%. LT kidney and Liver dose robustness are not affected by the AP/PA beam direction. There is 10% of chance that RT kidney and cord will be hit by AP proton beam due to the bowel gas. Compared to Group PA, APmod plan reduced the dose to kidneys and cord max significantly, while there is no statistical significant increase in bowel mean dose. Conclusion: APmod proton beam for the target coverage could be as robust as the PA direction without sacrificing too much of bowel dose. When the AP direction beam has to be selected, a 2cm proximal margin should be considered.

  9. 5-Substituents in the uridine moiety and their effect on the conformation of ApU-type dinucleoside phosphates.

    Science.gov (United States)

    Hillen, W; Gassen, G

    1978-03-29

    The ApU analogues ApT, Apcl5U, Apbr5U, Apa5U and Apno5(2)U were synthesized with the aid of ribonuclease U2 starting from 2',3'-cyclic Ap and the respective uridine derivatives. For these compounds the ultraviolet data, the difference spectra, the hypochromism and the temperature dependence of the CD spectra are reported. The dimerisation shifts of the pyrimidine protons which were obtained from the 100 MHz PMR spectra confirm the optical results. The influence of the substituents in the 5 position of the uracil ring on base-base interaction and the conformation of the dinucleoside phosphates is discussed with respect to the van der Waals radii and the electronic effects of these groups. As calculated from the hypochromism the dinucleoside phosphates can be arranged according to decreasing base-base interaction: Apno5(2)U greater than Apbr5U approximately ApT greater than Apcl5U greater than ApU greater than Apa5U.

  10. AP@home: The Artificial Pancreas Is Now at Home.

    Science.gov (United States)

    Heinemann, Lutz; Benesch, Carsten; DeVries, J Hans

    2016-07-01

    In the past years the development of an artificial pancreas (AP) has made great progress and many activities are ongoing in this area of research. The major step forward made in the last years was moving the evaluation of AP systems from highly controlled experimental conditions to daily life conditions at the home of patients with diabetes; this was also the aim of the European Union-funded AP@home project. Over a time period of 5 years a series of clinical studies were performed that culminated in 2 "final studies" during which an AP system was used by patients in their home environment for 2 or 3 months without supervision by a physician, living their normal lives. Two different versions of the AP system developed within this project were evaluated. A significant improvement in glycated hemoglobin was observed during closed-loop conditions despite the fact that during the control period the patients used the best currently available therapeutic option. In addition, a "single-port AP system" was developed within the project that combines continuous glucose monitoring and insulin infusion at a single tissue site. By using such a combined device the patients not only have to carry one less device around, the number of access points through the skin is also reduced from 2 to 1. In summary, close cooperation of 12 European partners, both academic centers and industry, enabled the development and evaluation of AP systems under daily life conditions. The next step is to develop these into products in cooperation with commercial partners. PMID:26888971

  11. An alternatively spliced mRNA from the AP-2 gene encodes a negative regulator of transcriptional activation by AP-2.

    OpenAIRE

    Buettner, R; Kannan, P; Imhof, A.; Bauer, R.; Yim, S O; Glockshuber, R; Van Dyke, M W; Tainsky, M A

    1993-01-01

    AP-2 is a retinoic acid-inducible and developmentally regulated activator of transcription. We have cloned an alternative AP-2 transcript (AP-2B) from the human teratocarcinoma cell line PA-1, which encodes a protein differing in the C terminus from the previously isolated AP-2 protein (AP-2A). This protein contains the activation domain of AP-2 and part of the DNA binding domain but lacks the dimerization domain which is necessary for DNA binding. Analysis of overlapping genomic clones spann...

  12. Topical erythromycin-zinc acetate complex lotion versus topical erythromycin gel in treatment of mild to moderate acne vulgaris

    Directory of Open Access Journals (Sweden)

    Hayder R. Al-Hamamy

    2014-10-01

    Full Text Available Introduction: Topical antibiotics are the main step in the treatment of mild to moderate acne vulgaris. Erythromycin is one of the effective topical therapies for this disease. Zinc sulfate 5% solution was reported to be effective in treatment of acne vulgaris and rosacea. Aim: To compare the effectiveness and side effects of topical erythromycin in combination with zinc and erythromycin alone in treatment of mild to moderate acne vulgaris. Material and Methods: This single, blind, therapeutic, comparative study was done in the Department of Dermatology – Baghdad Teaching Hospital, Baghdad, Iraq; from May 2012 – August 2013.Scoring of acne was carried out and the patients were examined every two weeks for 10 weeks of treatment. One month after stopping drugs, patients were evaluated for drug complications and disease recurrence. Eighty patients fulfilling enrollment criteria were included in this study. Patients were divided into two groups: Group A (40 patients treated twice daily with topical erythromycin-zinc complex lotion and Group B (40 patients treated twice daily with topical 2% erythromycin gel. Results: Both topical erythromycin-zinc lotion and erythromycin gel were statistically an effective therapy starting after 6 weeks treatment and up to 4 weeks after stopping treatment. Erythromycin-zinc lotion was more effective and act earlier than erythromycin gel starting from 4 weeks of therapy till the end of treatment (after 10 week and even after 4 weeks after stopping the treatment (p value <0.0001. Conclusions: Erythromycin-zinc complex lotion was an effective and well tolerated topical therapy for mild to moderate inflammatory acne vulgaris and was more effective than erythromycin gel alone.

  13. Cotidiano de portadores de esquizofrenia, após uso de um antipsicótico atípico e acompanhamento em grupo: visão do familiar Cotidiano de los portadores de esquizofrenia después del uso del antipsicótico atípico y acompañamiento en grupo: el punto de vista del familiar Schizophrenia patients' daily life after the use of clozapine and group accompaniment: family's view

    Directory of Open Access Journals (Sweden)

    Ana Maria Sertori Durão

    2006-08-01

    Full Text Available Este estudo descreveu o cotidiano do portador de esquizofrenia, após o uso de antipsicótico atípico e acompanhamento em grupo, na visão do familiar. A população foi constituída por 11 familiares que acompanharam com maior freqüência os 11 portadores de esquizofrenia que participam do grupo e utilizam antipisicótico. Para coleta de dados utilizou-se de entrevista semi-estruturada, guiada por roteiro, no mês de abril de 2003. Essas foram gravadas e, posteriormente, transcritas na íntegra. Obteve-se, como resultados, melhora do paciente quanto aos sintomas da doença evidenciada, pela diminuição do isolamento social, retomada de atividades domésticas/trabalho e estudo e participação em atividades de convívio social. Tais resultados apontam a necessidade de um novo olhar para o portador de transtorno mental e seus familiares, no sentido de buscar atitudes terapêuticas mais adequadas que atuem na produção de vida visando novo sentido para a existência, nas diferentes formas de convivência e de sociabilidade.Este estudio describió el cotidiano del portador de esquizofrenia después del uso de clozapina y acompañamiento en grupo de acuerdo con el punto de vista de los familiares. La población fue constituida por 11 familiares que acompañaron de manera más frecuente los 11 portadores de esquizofrenia que participaron del grupo y utilizan clozapina. Para la recopilación de datos se utilizó una entrevista orientada por guión, en abril de 2003. Las entrevistas fueron registradas y después transcritas por entero. Los resultados indicaron la mejoría de los pacientes con respecto a los síntomas de la enfermedad, evidenciada por la disminución del aislamiento social, recomienzo de actividades domésticas/trabajo y estudio y participación en actividades de convivencia social. Tales resultados señalan la necesidad de una nueva manera de mirar el portador de trastorno mental y sus familiares en el sentido de buscar actitudes

  14. Evaluation of topical n-acetylcysteine in diversion colitis

    Directory of Open Access Journals (Sweden)

    Marcos Gonçalves de Almeida

    2012-09-01

    Full Text Available INTRODUCTION: Diversion colitis (DC is a benign condition characterized by the appearance of inflammation in the mucosa of the colon or rectum devoid of fecal stream. Oxidative stress has been associated with the etiopathogenesis of the disease. N-acetylcysteine (NAC is a substance with antioxidant properties, used in different treatments of inflammatory diseases. The purpose of this study was to evaluate the effects of topical applications of NAC in an experimental model of DC. METHODS: Thirty-six Wistar rats were submitted to deviation of fecal stream by proximal colostomy and a distal mucosal fistula. They were distributed into 3 experimental groups of 12 animals according to the daily application of enemas containing 0.9% saline or 2 doses of NAC, 25 mg/kg and 100 mg/kg, respectively. In each group, half of the animals were sacrificed after two weeks of irrigation and half after four weeks of irrigation. The diagnosis of colitis was assessed by histopathological analysis and the grade of inflammation by inflammatory grading scale. The results were evaluated with the Mann-Whitney test, adopting significance level of 5% (pINTRODUÇÃO: Colite de exclusão (CE é uma condição benigna caracterizada pelo desenvolvimento de inflamação na mucosa do cólon desprovida de trânsito fecal. O estresse oxidativo tem sido implicado na patogênese da doença. A n-acetilcisteína (NAC é uma substância com efeitos antioxidantes, sendo utilizada no tratamento de várias doenças inflamatórias. OBJETIVO: Avaliar os efeitos da aplicação tópica de NAC em modelo de CE. MÉTODO: Trinta e seis ratos Wistar foram submetidos ao desvio do trânsito por meio de colostomia proximal e fístula mucosa distal. Os animais foram distribuídos em três grupos experimentais de igual tamanho segundo a aplicação de enemas diários contendo soro fisiológico 0,9% ou NAC nas concentrações de 25 mg/kg ou 100 mg/kg. Em cada grupo, metade dos animais foi sacrificada ap

  15. Human-competitive automatic topic indexing

    CERN Document Server

    Medelyan, Olena

    2009-01-01

    Topic indexing is the task of identifying the main topics covered by a document. These are useful for many purposes: as subject headings in libraries, as keywords in academic publications and as tags on the web. Knowing a document’s topics helps people judge its relevance quickly. However, assigning topics manually is labor intensive. This thesis shows how to generate them automatically in a way that competes with human performance. Three kinds of indexing are investigated: term assignment, a task commonly performed by librarians, who select topics from a controlled vocabulary; tagging, a popular activity of web users, who choose topics freely; and a new method of keyphrase extraction, where topics are equated to Wikipedia article names. A general two-stage algorithm is introduced that first selects candidate topics and then ranks them by significance based on their properties. These properties draw on statistical, semantic, domain-specific and encyclopedic knowledge. They are combined using a machine learn...

  16. AP1000 - the new standard for nuclear power

    International Nuclear Information System (INIS)

    Full text of publication follows: The AP1000 is the only Generation III+ reactor to receive Final Design Approval (FDA) from the Nuclear Regulatory Commission, and is expected to receive its Design Certification by the end of the year. Building on the proven features of current generation nuclear plants, the AP1000 combines experience with innovation into a design that surpasses current standards of safety and reliability. Use of passive safety features results in a simpler and more compact design that enhances safety, simplifies O and M requirements, and reduces capital and operating costs. At 1117 Mwe, the AP1000 is well suited for almost any grid system and will be fully competitive with combined-cycle gas and comparable fossil fuel plants. The AP1000 is ready to help launch a renaissance in new nuclear plant construction throughout the world. Maturity of Design: In excess of 1300 man-years and $400 million in development funding have been expended on the AP1000. It has undergone extensive, part scale testing at the system, sub-system and component level, in addition to a series of part scale integrated tests. The AP1000 is the most analyzed of the next generation reactors. Simplicity of Design/Economics: The AP1000 uses simplified and innovative passive safety systems to an unprecedented extent. Simplified passive safety systems provide reliable operation, reduced capital costs, and enhanced plant safety with large plant operating margins. The AP1000 features improved reliability through simplicity rather than addition of redundant safety trains. This simpler design is easier and less costly to operate and maintain than larger, more complex plants, while less equipment and smaller buildings translate into lower capital costs and shorter construction durations. After construction, economic benefit will be found in reduced operating and maintenance costs, largely due to reduced operating and maintenance staffing requirements. Construction aspects

  17. Learning through delivery, Westinghouse AP1000 plant construction

    International Nuclear Information System (INIS)

    The AP1000 plant, which is a 1100 MWe class pressurized water reactor with passive safety features, is designed around a conventional 2 loop, 2 steam generator primary system configuration with 2 hot legs, 4 reactor coolant pumps directly mounted in the steam generator lower head and 4 cold legs. A particular feature of AP1000 is its modular construction to minimize the time and cost of construction. Modular construction allows activities to be run in parallel, it allows more activities to be performed in a controlled factory instead of in the field, and it provides a better level of quality. The AP1000 plant design includes 106 structural modules and 52 mechanical modules. Structural modules include all penetrations for piping, cable trays, HVAC duct runs, and all reinforcement for pipe, equipment hangers, and supports. Structural modules are shipped in sub-modules to support transportation by rail or truck or barge. Mechanical modules contain equipment such as pumps, tanks, heat exchangers, air-handling units, and filters along with interconnecting pipes, valves, instruments, wiring and support services. Modular construction requires strong coordination between engineering, supply chain and construction. A total of 8 AP1000 units are currently under construction in China and in the United States. The lessons learned and best practices of each new AP1000 construction are systematically incorporated into the standard design. (A.C.)

  18. "Two Cultures" Topics for General Studies Science Courses.

    Science.gov (United States)

    Larson, James H.

    1982-01-01

    Theses proposed in C. P. Snow's book "The Two Cultures," including uncommunicative scientific and literary groups, gap between rich and poor, overpopulation, and nuclear war remain viable topics. Discusses the scientific and literary cultural gap and what can be done in general studies science courses to ameliorate the condition. (Author/JN)

  19. Markers of topical discourse in child-directed speech.

    Science.gov (United States)

    Rohde, Hannah; Frank, Michael C

    2014-01-01

    Although the language we encounter is typically embedded in rich discourse contexts, many existing models of processing focus largely on phenomena that occur sentence-internally. Similarly, most work on children's language learning does not consider how information can accumulate as a discourse progresses. Research in pragmatics, however, points to ways in which each subsequent utterance provides new opportunities for listeners to infer speaker meaning. Such inferences allow the listener to build up a representation of the speakers' intended topic and more generally to identify relationships, structures, and messages that extend across multiple utterances. We address this issue by analyzing a video corpus of child-caregiver interactions. We use topic continuity as an index of discourse structure, examining how caregivers introduce and discuss objects across utterances. For the analysis, utterances are grouped into topical discourse sequences using three annotation strategies: raw annotations of speakers' referents, the output of a model that groups utterances based on those annotations, and the judgments of human coders. We analyze how the lexical, syntactic, and social properties of caregiver-child interaction change over the course of a sequence of topically related utterances. Our findings suggest that many cues used to signal topicality in adult discourse are also available in child-directed speech.

  20. Topics in Banach space theory

    CERN Document Server

    Albiac, Fernando

    2016-01-01

    This text provides the reader with the necessary technical tools and background to reach the frontiers of research without the introduction of too many extraneous concepts. Detailed and accessible proofs are included, as are a variety of exercises and problems. The two new chapters in this second edition are devoted to two topics of much current interest amongst functional analysts: Greedy approximation with respect to bases in Banach spaces and nonlinear geometry of Banach spaces. This new material is intended to present these two directions of research for their intrinsic importance within Banach space theory, and to motivate graduate students interested in learning more about them. This textbook assumes only a basic knowledge of functional analysis, giving the reader a self-contained overview of the ideas and techniques in the development of modern Banach space theory. Special emphasis is placed on the study of the classical Lebesgue spaces Lp (and their sequence space analogues) and spaces of continuous f...

  1. Synergetics introduction and advanced topics

    CERN Document Server

    Haken, Hermann

    2004-01-01

    This book is an often-requested reprint of two classic texts by H. Haken: "Synergetics. An Introduction" and "Advanced Synergetics". Synergetics, an interdisciplinary research program initiated by H. Haken in 1969, deals with the systematic and methodological approach to the rapidly growing field of complexity. Going well beyond qualitative analogies between complex systems in fields as diverse as physics, chemistry, biology, sociology and economics, Synergetics uses tools from theoretical physics and mathematics to construct an unifying framework within which quantitative descriptions of complex, self-organizing systems can be made. This may well explain the timelessness of H. Haken's original texts on this topic, which are now recognized as landmarks in the field of complex systems. They provide both the beginning graduate student and the seasoned researcher with solid knowledge of the basic concepts and mathematical tools. Moreover, they admirably convey the spirit of the pioneering work by the founder of ...

  2. KEY TOPICS IN SPORTS MEDICINE

    Directory of Open Access Journals (Sweden)

    Amir Ali Narvani

    2006-12-01

    Full Text Available Key Topics in Sports Medicine is a single quick reference source for sports and exercise medicine. It presents the essential information from across relevant topic areas, and includes both the core and emerging issues in this rapidly developing field. It covers: 1 Sports injuries, rehabilitation and injury prevention, 2 Exercise physiology, fitness testing and training, 3 Drugs in sport, 4 Exercise and health promotion, 5 Sport and exercise for special and clinical populations, 6 The psychology of performance and injury. PURPOSE The Key Topics format provides extensive, concise information in an accessible, easy-to-follow manner. AUDIENCE The book is targeted the students and specialists in sports medicine and rehabilitation, athletic training, physiotherapy and orthopaedic surgery. The editors are authorities in their respective fields and this handbook depends on their extensive experience and knowledge accumulated over the years. FEATURES The book contains the information for clinical guidance, rapid access to concise details and facts. It is composed of 99 topics which present the information in an order that is considered logical and progressive as in most texts. Chapter headings are: 1. Functional Anatomy, 2. Training Principles / Development of Strength and Power, 3. Biomechanical Principles, 4. Biomechanical Analysis, 5. Physiology of Training, 6. Monitoring of Training Progress, 7. Nutrition, 8. Hot and Cold Climates, 9. Altitude, 10. Sport and Travelling, 11. Principles of Sport Injury Diagnosis, 12. Principles of Sport and Soft Tissue Management, 13. Principles of Physical Therapy and Rehabilitation, 14. Principles of Sport Injury Prevention, 15. Sports Psychology, 16. Team Sports, 17. Psychological Aspects of Injury in Sport, 18. Injury Repair Process, 19. Basic Biomechanics of Tissue Injury, 20. Plain Film Radiography in Sport, 21. Nuclear Medicine, 22. Diagnostic Ultrasound, 23. MRI Scan, 24. Other Imaging, 5. Head Injury, 26. Eye

  3. Topics in Open Topological Strings

    CERN Document Server

    Prudenziati, Andrea

    2010-01-01

    This thesis is based on some selected topics in open topological string theory which I have worked on during my Ph.D. It comprises an introductory part where I have focused on the points most needed for the later chapters, trading completeness for conciseness and clarity. Then, following [12], we discuss tadpole cancellation for topological strings where we mainly show how its implementation is needed for ensuring the same "odd" moduli decoupling encountered in the closed theory. Next we move to analyse how the open and closed effective field theories for the B model interact writing the complete Lagrangian. We first check it deriving some already known tree level amplitudes in term of target space quantities, and then we extend the recipe to new results; later we implement open closed duality from a target field theory perspective. This last subject is also analysed from a worldsheet point of view extending the analysis of [13]. Some ideas for future research are briefly reported.

  4. Past, Present, and Future of AP Chemistry: A Brief History of Course and Exam Alignment Efforts

    Science.gov (United States)

    Magrogan, Serena

    2014-01-01

    As part of the Advanced Placement (AP) Program's commitment to continually enhance alignment with current best practices in college-level learning, the AP Program is currently evaluating and redesigning courses and exams, one of which launched during the 2013-2014 academic school year: AP chemistry. The history of the AP chemistry course and…

  5. AP Report to the Nation: A Closer Look at the Nation and Florida

    Science.gov (United States)

    Sawtell, Ellen A.; Gillie, Jacqueline M.; Smith, Patricia Z.

    2012-01-01

    In February 2012, the College Board published The 8th Annual AP Report to the Nation. This session provides a deeper dive into key information for the United States with an emphasis on Florida, and participants hear how one school in Florida utilizes AP Potential™ to help build their AP Program. Participants also learn about AP participation and…

  6. Groups, rings, modules

    CERN Document Server

    Auslander, Maurice

    2014-01-01

    This classic monograph is geared toward advanced undergraduates and graduate students. The treatment presupposes some familiarity with sets, groups, rings, and vector spaces. The four-part approach begins with examinations of sets and maps, monoids and groups, categories, and rings. The second part explores unique factorization domains, general module theory, semisimple rings and modules, and Artinian rings. Part three's topics include localization and tensor products, principal ideal domains, and applications of fundamental theorem. The fourth and final part covers algebraic field extensions

  7. Vibration analysis of primary air pump JE01 AP003

    International Nuclear Information System (INIS)

    JE01 AP003 primary coolant pump is one of the main components in the safe operation of the reactor so that needs to be done early detection of damage types and levels of its constituent components. The main components of the pump that is often damaged bearing. The purpose of this paper is to know the symptoms of bearing damage and the level of damage based on vibration analysis. One indication of the bearing has been damaged, that is the vibration or temperature rise in the bearing. One way to detect early symptoms of damage to the pump is to use the vibration response peak Based on the analysis of the measurement results cited the obtained results that the primary coolant pump JE01 AP003 has been damage to a free end looseness bearing with moderate levels of damage. Need JE01 AP003 bearing replacement even though the damage is not severe. (author)

  8. Experience with the EPICS PV Gateway at the APS

    CERN Document Server

    Evans, Kenneth

    2005-01-01

    The EPICS PV Gateway has become a stable, high-performance application that provides access to process variables while minimizing the impact on critical IOCs and implementing additional access security. The additional access security typically prevents write access but is highly configurable. The Advanced Photon Source (APS) currently uses 40 Gateways running on 11 machines to provide access to the machine network from the offices and for the individual experimental teams. These include reverse Gateways that allow administration of all 40 APS Gateways from a single MEDM screen, even though the Gateways are running on separate networks. This administration includes starting, stopping, making and viewing reports, and viewing and editing access security files. There is one Gateway that provides process variable renaming. This paper provides an overview of the Gateways at the APS and describes the procedures that have been set up to use and administer them.

  9. PKA-activated ApAF–ApC/EBP heterodimer is a key downstream effector of ApCREB and is necessary and sufficient for the consolidation of long-term facilitation

    OpenAIRE

    LEE, Jin-A; Lee, Sue-Hyun; Lee, Changhoon; Chang, Deok-Jin; Lee, Yong; Kim, Hyoung; Cheang, Ye-Hwang; Ko, Hyoung-Gon; Lee, Yong-Seok; Jun, Heejung; Bartsch, Dusan; Kandel, Eric R.; Kaang, Bong-Kiun

    2006-01-01

    Long-term memory requires transcriptional regulation by a combination of positive and negative transcription factors. Aplysia activating factor (ApAF) is known to be a positive transcription factor that forms heterodimers with ApC/EBP and ApCREB2. How these heterodimers are regulated and how they participate in the consolidation of long-term facilitation (LTF) has not, however, been characterized. We found that the functional activation of ApAF required phosphorylation of ApAF by PKA on Ser-2...

  10. Transcriptional Regulation of the AP-2α Promoter by BTEB-1 and AP-2rep, a Novel wt-1/egr-Related Zinc Finger Repressor

    OpenAIRE

    Imhof, Axel; Schuierer, Marion; Werner, Oliver; Moser, Markus; Roth, Christina; Bauer, Reinhard; BUETTNER, REINHARD

    1999-01-01

    AP-2 transcription factors have been suggested to exert key regulatory functions in vertebrate embryonic development, in tumorigenicity of various cancer cell types, and in controlling cell cycle and apoptotic effector genes. In this study, we investigated transcriptional regulation of the AP-2α gene promoter mediated by an autoregulatory element (referred to as A32) with a core consensus AP-2 binding site at position −336 relative to the mRNA initiation site. AP-2 and multiple different nucl...

  11. Multilingual Topic Models for Unaligned Text

    CERN Document Server

    Boyd-Graber, Jordan

    2012-01-01

    We develop the multilingual topic model for unaligned text (MuTo), a probabilistic model of text that is designed to analyze corpora composed of documents in two languages. From these documents, MuTo uses stochastic EM to simultaneously discover both a matching between the languages and multilingual latent topics. We demonstrate that MuTo is able to find shared topics on real-world multilingual corpora, successfully pairing related documents across languages. MuTo provides a new framework for creating multilingual topic models without needing carefully curated parallel corpora and allows applications built using the topic model formalism to be applied to a much wider class of corpora.

  12. Antagonism of the presumed presynaptic action of L-AP4 on GABAergic transmission in the ventrobasal thalamus by the novel mGluR antagonist MPPG.

    Science.gov (United States)

    Salt, T E; Turner, J P

    1996-02-01

    The metabotropic glutamate receptor (mGluR) agonists CCG-I and L-AP4, acting at Group II and Group III mGluRs respectively, can reduce GABAergic synaptic inhibition on single neurones in the rat thalamus in vivo via a presumed presynaptic mechanism. The actions of L-AP4 were antagonized by (+/-)-alpha-methyl-4-phosphonophenylglycine (MPPG), whereas CCG-I was significantly less affected. Thus MPPG may be a useful tool for detecting physiological roles for Group III mGluRs. PMID:8734494

  13. Miniature Autonomous Star Tracker Based on CMOS APS

    OpenAIRE

    Ying, Dong; Zheng, You; Fei, Xing; Qin, Chou

    2006-01-01

    An APS (Active Pixel Sensor) based autonomous star tracker (AAST) has been proposed for small satellite and microsatellite attitude determination. A prototype of AAST has been developed. It has low mass of 1kg, low power of 3W, high rate up to 5Hz, and acquisition success rate of higher than 99.9%. The improvements in dimensions and performances are realized with the replacement of the CCD (Charge Coupled Device) by the APS. The optical design of the prototype is based on PSF (Point Spread Fu...

  14. SN 2002ap, the hypernova of class Ic

    OpenAIRE

    Pandey, S. B.; Sahu, D. K.; Anupama, G. C.; Bhattacharya, D; Sagar, Ram

    2003-01-01

    The supernova SN 2002ap was discovered in the outer regions of the nearby spiral M74 on January 29.4 UT. Early photometric and spectroscopic observations indicate the supernova belongs to the class of Ic hypernova. Late time (After JD 2452500) light curve decay slopes are similar to that of the hypernovae SN 1997ef and SN 1998bw. We present here the $BVRI$ photometric light curves and colour evolutions of SN 2002ap to investigate the late time nature of the light curve.

  15. Identifying Topics in Microblogs Using Wikipedia.

    Science.gov (United States)

    Yıldırım, Ahmet; Üsküdarlı, Suzan; Özgür, Arzucan

    2016-01-01

    Twitter is an extremely high volume platform for user generated contributions regarding any topic. The wealth of content created at real-time in massive quantities calls for automated approaches to identify the topics of the contributions. Such topics can be utilized in numerous ways, such as public opinion mining, marketing, entertainment, and disaster management. Towards this end, approaches to relate single or partial posts to knowledge base items have been proposed. However, in microblogging systems like Twitter, topics emerge from the culmination of a large number of contributions. Therefore, identifying topics based on collections of posts, where individual posts contribute to some aspect of the greater topic is necessary. Models, such as Latent Dirichlet Allocation (LDA), propose algorithms for relating collections of posts to sets of keywords that represent underlying topics. In these approaches, figuring out what the specific topic(s) the keyword sets represent remains as a separate task. Another issue in topic detection is the scope, which is often limited to specific domain, such as health. This work proposes an approach for identifying domain-independent specific topics related to sets of posts. In this approach, individual posts are processed and then aggregated to identify key tokens, which are then mapped to specific topics. Wikipedia article titles are selected to represent topics, since they are up to date, user-generated, sophisticated articles that span topics of human interest. This paper describes the proposed approach, a prototype implementation, and a case study based on data gathered during the heavily contributed periods corresponding to the four US election debates in 2012. The manually evaluated results (0.96 precision) and other observations from the study are discussed in detail. PMID:26991442

  16. Identifying Topics in Microblogs Using Wikipedia.

    Directory of Open Access Journals (Sweden)

    Ahmet Yıldırım

    Full Text Available Twitter is an extremely high volume platform for user generated contributions regarding any topic. The wealth of content created at real-time in massive quantities calls for automated approaches to identify the topics of the contributions. Such topics can be utilized in numerous ways, such as public opinion mining, marketing, entertainment, and disaster management. Towards this end, approaches to relate single or partial posts to knowledge base items have been proposed. However, in microblogging systems like Twitter, topics emerge from the culmination of a large number of contributions. Therefore, identifying topics based on collections of posts, where individual posts contribute to some aspect of the greater topic is necessary. Models, such as Latent Dirichlet Allocation (LDA, propose algorithms for relating collections of posts to sets of keywords that represent underlying topics. In these approaches, figuring out what the specific topic(s the keyword sets represent remains as a separate task. Another issue in topic detection is the scope, which is often limited to specific domain, such as health. This work proposes an approach for identifying domain-independent specific topics related to sets of posts. In this approach, individual posts are processed and then aggregated to identify key tokens, which are then mapped to specific topics. Wikipedia article titles are selected to represent topics, since they are up to date, user-generated, sophisticated articles that span topics of human interest. This paper describes the proposed approach, a prototype implementation, and a case study based on data gathered during the heavily contributed periods corresponding to the four US election debates in 2012. The manually evaluated results (0.96 precision and other observations from the study are discussed in detail.

  17. Identifying Topics in Microblogs Using Wikipedia

    Science.gov (United States)

    Yıldırım, Ahmet; Üsküdarlı, Suzan; Özgür, Arzucan

    2016-01-01

    Twitter is an extremely high volume platform for user generated contributions regarding any topic. The wealth of content created at real-time in massive quantities calls for automated approaches to identify the topics of the contributions. Such topics can be utilized in numerous ways, such as public opinion mining, marketing, entertainment, and disaster management. Towards this end, approaches to relate single or partial posts to knowledge base items have been proposed. However, in microblogging systems like Twitter, topics emerge from the culmination of a large number of contributions. Therefore, identifying topics based on collections of posts, where individual posts contribute to some aspect of the greater topic is necessary. Models, such as Latent Dirichlet Allocation (LDA), propose algorithms for relating collections of posts to sets of keywords that represent underlying topics. In these approaches, figuring out what the specific topic(s) the keyword sets represent remains as a separate task. Another issue in topic detection is the scope, which is often limited to specific domain, such as health. This work proposes an approach for identifying domain-independent specific topics related to sets of posts. In this approach, individual posts are processed and then aggregated to identify key tokens, which are then mapped to specific topics. Wikipedia article titles are selected to represent topics, since they are up to date, user-generated, sophisticated articles that span topics of human interest. This paper describes the proposed approach, a prototype implementation, and a case study based on data gathered during the heavily contributed periods corresponding to the four US election debates in 2012. The manually evaluated results (0.96 precision) and other observations from the study are discussed in detail. PMID:26991442

  18. Safety and Health Topics: Asbestos

    Science.gov (United States)

    ... to Z Index Contact Us FAQs What's New Asbestos This page requires that javascript be enabled for ... Hazards and Toxic Substances Hazardous Waste What is asbestos? Asbestos is the name given to a group ...

  19. Main technical topics in 1999

    International Nuclear Information System (INIS)

    This Safety Authority annual report strives to present current organizational provisions and future trends in nuclear safety supervision in France and to describe the most outstanding occurrences during the past year. A first part presents nine documents concerning the main topics of 1999: aging of nuclear installations, the Offsite Emergency Plans (PPI), the impact of nuclear activities on man and the environment, the criticality hazards, EDF in 1999, the EPR project, the Andra in 1999, the transport incidents, the nuclear safety in eastern Europe. The second part presents the missions and actions of the Nuclear Installations Safety in the domains of the liabilities, the organization of the nuclear safety control, the regulations of the INB, the public information, the international relations, the crisis management, the radioactive materials transportation, the radioactive wastes. The equipment, the radiation protection and the exploitation of the pressurized water reactors are also treated just as the experimental reactors, the fuel cycle installations and the the nuclear installations dismantling. (A.L.B.)

  20. Topics in Number Theory Conference

    CERN Document Server

    Andrews, George; Ono, Ken

    1999-01-01

    From July 31 through August 3,1997, the Pennsylvania State University hosted the Topics in Number Theory Conference. The conference was organized by Ken Ono and myself. By writing the preface, I am afforded the opportunity to express my gratitude to Ken for beng the inspiring and driving force behind the whole conference. Without his energy, enthusiasm and skill the entire event would never have occurred. We are extremely grateful to the sponsors of the conference: The National Sci­ ence Foundation, The Penn State Conference Center and the Penn State Depart­ ment of Mathematics. The object in this conference was to provide a variety of presentations giving a current picture of recent, significant work in number theory. There were eight plenary lectures: H. Darmon (McGill University), "Non-vanishing of L-functions and their derivatives modulo p. " A. Granville (University of Georgia), "Mean values of multiplicative functions. " C. Pomerance (University of Georgia), "Recent results in primality testing. " C. ...

  1. Decision Point 1 Topical Report

    Energy Technology Data Exchange (ETDEWEB)

    Yablonsky, Al; Barsoumian, Shant; Legere, David

    2013-05-01

    This Topical Report addresses accomplishments achieved during Phase 2a of the SkyMine® Carbon Mineralization Pilot Project. The primary objectives of this project are to design, construct, and operate a system to capture CO2 from a slipstream of flue gas from a commercial coal-fired cement kiln, convert that CO2 to products having commercial value (i.e., beneficial use), show the economic viability of the CO2 capture and conversion process, and thereby advance the technology to the point of readiness for commercial scale demonstration and proliferation. The overall process is carbon negative, resulting in mineralization of CO2 that would otherwise be released into the atmosphere. The project will also substantiate market opportunities for the technology by sales of chemicals into existing markets, and identify opportunities to improve technology performance and reduce costs at the commercial scale. The project is being conducted in two phases. The primary objectives of Phase 1 were to elaborate proven SkyMine® process chemistry to commercial pilot-scale operation and complete the preliminary design for the pilot plant to be built and operated in Phase 2, complete a NEPA evaluation, and develop a comprehensive carbon life cycle analysis. The objective of the current Phase (2a) is to complete the detailed design of the pilot plant to be built in Phase 2b.

  2. Recent Advances In Topical Therapy In Dermatology

    Directory of Open Access Journals (Sweden)

    Mohan Thappa Devinder

    2003-01-01

    Full Text Available With changing times various newer topical agents are introduced in the field of dermatology. Tacrolimus and pimecrolimus are immunisuppressants, which are effective topically and are tried in the management of atopic dermatitis as well as other disorders including allergic contact dermatitis, atrophic lichen planus, pyoderma gangrenosum. Imiquimod, an immune response modifier, is presently in use for genital warts but has potentials as anti- tumour agent and in various other dermatological conditions when used topically. Tazarotene is a newer addition to the list of topical reginoids, which is effective in psoriasis and has better effect in combination with calcipotriene, phototherapy and topical costicosteroids. Tazarotene and adapelene are also effective in inflammatory acne. Calcipotriol, a vitamin D analogue has been introduced as a topical agent in the treatment of psoriasis. Steroid components are also developed recently which will be devoid of the side effects but having adequate anti-inflammatory effect. Topical photodynamic therapy has also a wide range of use in dermatology. Newer topical agents including cidofovir, capsaicin, topical sensitizers, topical antifungal agents for onychomycosis are also of use in clinical practice. Other promising developments include skin substitutes and growth factors for wound care.

  3. Penetration dynamics of AP8 in thin ceramic tiles

    NARCIS (Netherlands)

    Abadjieva, E.; Khoe, Y.S.

    2013-01-01

    The interaction of thin ceramic tiles with AP8 (WC core, 7,62 mm) at 1000 m/s velocity has been studied experimentally and numerically. “Thin” ceramic tiles refers here to ratio of the tile thickness (t) to the projectile diameter, (d), t/d@ 1, as they are both in the same order. The method applied

  4. Time Trials--An AP Physics Challenge Lab

    Science.gov (United States)

    Jones, David

    2009-01-01

    I have come to the conclusion that for high school physics classroom and laboratory experiences, simpler is better! In this paper I describe a very simple and effective lab experience that my AP students have thoroughly enjoyed year after year. I call this lab exercise "Time Trials." The experiment is simple in design and it is a lot of fun for…

  5. The AP Lever for Boosting Access, Success, and Equity

    Science.gov (United States)

    Roegman, Rachel; Hatch, Thomas

    2016-01-01

    Four New Jersey school districts worked together to increase student achievement by applying a number of strategies focused on getting traditionally underrepresented students to take more AP courses. The districts are members of the New Jersey Network of Superintendents (NJNS), comprising 15 superintendents who work together to develop systemwide…

  6. The New AP Chemistry Exam: Its Rationale, Content, and Scoring

    Science.gov (United States)

    Price, Paul D.; Kugel, Roger W.

    2014-01-01

    The 2013-2014 academic year marks the rollout of the redesigned advanced placement (AP) chemistry course and exam. There have been many questions as to why the course was redesigned and how the new examination will differ from its legacy version. In this article we give a brief overview of the legacy course and examine why a redesign occurred in…

  7. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses

    Science.gov (United States)

    Prilliman, Stephen G.

    2014-01-01

    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  8. Identification of key research needs for topical therapy treatment of psoriasis - a consensus paper by the International Psoriasis Council.

    Science.gov (United States)

    Wu, J J; Lynde, C W; Kleyn, C E; Iversen, L; van der Walt, J M; Carvalho, A; Kirby, B; Bissonnette, R

    2016-07-01

    In this age of expanding choices of therapy for psoriasis, topical therapies still play an important part in the management of patients. There are many knowledge gaps in topical therapy for psoriasis with regard to efficacy and safety as well as various combinations including topical therapy with phototherapy or with systemic agents. Councillors of the International Psoriasis Council comprised a topical therapy working group to describe these gaps in order to help direct future research endeavours. Herein, we present the results of this analysis, discuss topical agents in clinical development and the attributes of the ideal topical treatment for psoriasis.

  9. Genome-Wide Analysis of the AP2/ERF Gene Family in Physic Nut and Overexpression of the JcERF011 Gene in Rice Increased Its Sensitivity to Salinity Stress.

    Directory of Open Access Journals (Sweden)

    Yuehui Tang

    Full Text Available The AP2/ERF transcription factors play crucial roles in plant growth, development and responses to biotic and abiotic stresses. A total of 119 AP2/ERF genes (JcAP2/ERFs have been identified in the physic nut genome; they include 16 AP2, 4 RAV, 1 Soloist, and 98 ERF genes. Phylogenetic analysis indicated that physic nut AP2 genes could be divided into 3 subgroups, while ERF genes could be classed into 11 groups or 43 subgroups. The AP2/ERF genes are non-randomly distributed across the 11 linkage groups of the physic nut genome and retain many duplicates which arose from ancient duplication events. The expression patterns of several JcAP2/ERF duplicates in the physic nut showed differences among four tissues (root, stem, leaf, and seed, and 38 JcAP2/ERF genes responded to at least one abiotic stressor (drought, salinity, phosphate starvation, and nitrogen starvation in leaves and/or roots according to analysis of digital gene expression tag data. The expression of JcERF011 was downregulated by salinity stress in physic nut roots. Overexpression of the JcERF011 gene in rice plants increased its sensitivity to salinity stress. The increased expression levels of several salt tolerance-related genes were impaired in the JcERF011-overexpressing plants under salinity stress.

  10. AP1000 Features Prevent Potential Containment Recirculation Screen Plugging

    International Nuclear Information System (INIS)

    This paper presents the results of plant design development and evaluations that demonstrate that the AP1000 plant is not subject to potential containment recirculation screen plugging following a loss-of-coolant-accident (LOCA). Following a LOCA in a pressurized water reactor, it is necessary to recirculate water from the containment back into the reactor to maintain long term core cooling. The AP1000 utilizes passive safety systems to provide containment recirculation for long term core cooling following a LOCA. The AP1000 also has non-safety pumps which provide a backup means of providing recirculation. Screens are provided around the recirculation pipes to prevent debris from blocking recirculation flow and core cooling passages. Debris may be generated by the LOCA blowdown from insulation and coatings used inside containment. Even with effective cleanliness programs, there may be some resident debris such as dust and dirt. The potential for plugging the recirculation screens is a current PWR licensing issue. The AP1000 design provides inherent advantages with respect to the potential plugging of containment recirculation screens. These characteristics include prevention of fibrous debris generation, improved debris settling and improved recirculation screen design. Debris settling analysis demonstrates that failure of coatings does not result in debris being transported to the screens before it settles to the floor. Additional analysis also shows that the plant can tolerate conservative amounts of resident debris being transported to the screens. The AP1000 significantly reduces the probability of plugging the containment recirculation screens and significantly reduces inspection and maintenance of coatings used inside containment. (authors)

  11. Selected topics of fluid mechanics

    Science.gov (United States)

    Kindsvater, Carl E.

    1958-01-01

    the Euler, Froude, Reynolds, Weber, and Cauchy numbers are defined as essential tools for interpreting and using experimental data. The derivations of the energy and momentum equations are treated in detail. One-dimensional equations for steady nonuniform flow are developed, and the restrictions applicable to the equations are emphasized. Conditions of uniform and gradually varied flow are discussed, and the origin of the Chezy equation is examined in relation to both the energy and the momentum equations. The inadequacy of all uniform-flow equations as a means of describing gradually varied flow is explained. Thus, one of the definitive problems of river hydraulics is analyzed in the light of present knowledge. This report is the outgrowth of a series of short schools conducted during the spring and summer of 1953 for engineers of the Surface Water Branch, Water Resources Division, U. S. Geological Survey. The topics considered are essentially the same as the topics selected for inclusion in the schools. However, in order that they might serve better as a guide and outline for informal study, the arrangement of the writer's original lecture notes has been considerably altered. The purpose of the report, like the purpose of the schools which inspired it, is to build a simple but strong framework of the fundamentals of fluid mechanics. It is believed that this framework is capable of supporting a detailed analysis of most of the practical problems met by the engineers of the Geological Survey. It is hoped that the least accomplishment of this work will be to inspire the reader with the confidence and desire to read more of the recent and current technical literature of modern fluid mechanics.

  12. Functional analysis of the two Brassica AP3 genes involved in apetalous and stamen carpelloid phenotypes.

    Directory of Open Access Journals (Sweden)

    Yanfeng Zhang

    Full Text Available The Arabidopsis homeotic genes APETALA3 (AP3 and PISTILLATA (PI are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8 residues in B.AP3.b led to the change of PI-derived motifs. Meanwhile, B.AP3.a specified petal and stamen development, whereas B.AP3.b only specified stamen development. In B. rapa, the mutations of both genes generated the SC mutant HGMS. In B. napus that contained two B.AP3.a and two B.AP3.b, loss of the two B.AP3.a functions was the key reason for the apetalous mutation, however, the loss-of-function in all four AP3 was related to the SC mutant AMS. We inferred that the 8 residues or the PI-derived motif in AP3 gene probably relates to petal formation.

  13. Topical papers on raw materials

    International Nuclear Information System (INIS)

    In the papers of this working group, the availability of uranium and the long-term supply situation for this raw material are discussed. A problem closely connected with uranium supply are the commercial contracts and their particularities. The points of view of the reporting countries of Great Britain, South Africa, Switzerland, Australia, Japan, and Korea are made clear

  14. Tracking topic birth and death in LDA.

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Andrew T.; Robinson, David Gerald

    2011-09-01

    Most topic modeling algorithms that address the evolution of documents over time use the same number of topics at all times. This obscures the common occurrence in the data where new subjects arise and old ones diminish or disappear entirely. We propose an algorithm to model the birth and death of topics within an LDA-like framework. The user selects an initial number of topics, after which new topics are created and retired without further supervision. Our approach also accommodates many of the acceleration and parallelization schemes developed in recent years for standard LDA. In recent years, topic modeling algorithms such as latent semantic analysis (LSA)[17], latent Dirichlet allocation (LDA)[10] and their descendants have offered a powerful way to explore and interrogate corpora far too large for any human to grasp without assistance. Using such algorithms we are able to search for similar documents, model and track the volume of topics over time, search for correlated topics or model them with a hierarchy. Most of these algorithms are intended for use with static corpora where the number of documents and the size of the vocabulary are known in advance. Moreover, almost all current topic modeling algorithms fix the number of topics as one of the input parameters and keep it fixed across the entire corpus. While this is appropriate for static corpora, it becomes a serious handicap when analyzing time-varying data sets where topics come and go as a matter of course. This is doubly true for online algorithms that may not have the option of revising earlier results in light of new data. To be sure, these algorithms will account for changing data one way or another, but without the ability to adapt to structural changes such as entirely new topics they may do so in counterintuitive ways.

  15. Updates of Topical and Local Anesthesia Agents.

    Science.gov (United States)

    Boyce, Ricardo A; Kirpalani, Tarun; Mohan, Naveen

    2016-04-01

    As described in this article, there are many advances in topical and local anesthesia. Topical and local anesthetics have played a great role in dentistry in alleviating the fears of patients, eliminating pain, and providing pain control. Many invasive procedures would not be performed without the use and advances of topical/local anesthetics. The modern-day dentist has the responsibility of knowing the variety of products on the market and should have at least references to access before, during, and after treatment. This practice ensures proper care with topical and local anesthetics for the masses of patients entering dental offices worldwide. PMID:27040295

  16. Topical Products for the Aging Face.

    Science.gov (United States)

    McCook, John P

    2016-07-01

    This article focuses on nonprescription home-use topical treatment technologies for the aging face and is intended to serve as a guide for the core cosmeceutical technologies currently used and to help educate and assist the selection of topical antiaging products by the professional staff and their patients. Antiaging topical treatments for patient home use should be nonirritating, compatible with the patient skin type, effective, and complementary to surgical and minimally invasive office procedures, and aesthetically elegant. New topical antiaging technologies, formulated as monotherapy or as combinations with well-known cosmeceuticals, should present adequate clinical studies to support their selection for use. PMID:27363774

  17. The treatment of rosacea with topical ivermectin.

    Science.gov (United States)

    Ali, S T; Alinia, H; Feldman, S R

    2015-04-01

    The treatment of rosacea is challenging because several pathophysiologic processes may be involved, including neurovascular dysregulation and alterations in innate immune status. Demodex mites may play a role in the latter mechanism. Topical ivermectin is a new therapeutic modality which demonstrates antiparasitic and anti-inflammatory properties. This article reviews published evidence related to the efficacy and safety of topical ivermectin. PubMed was utilized to search for key words "topical ivermectin", "ivermectin cream" and "rosacea". Three clinical trials were found that studied topical ivermectin as a treatment option for rosacea. Ivermectin was effective, safe and well tolerated. PMID:26020066

  18. Spatial distribution and compositional variation of APS minerals related to uranium deposits in the Kiggavik-Andrew Lake structural trend, Nunavut, Canada

    Science.gov (United States)

    Riegler, Thomas; Quirt, Dave; Beaufort, Daniel

    2016-02-01

    The Kiggavik-Andrew Lake structural trend consists of four mineralized zones, partially outcropping, lying 2 km south of the erosional contact with the unmetamorphosed sandstone and basal conglomerates of the Paleoproterozoic Thelon Formation. The mineralization is controlled by a major E-W fault system associated with illite and sudoite alteration halos developed in the Archean metagraywackes of the Woodburn Lake Group. Aluminum phosphate sulfate (APS) minerals from the alunite group crystallized in association with the clay minerals in the basement alteration halo as well as in the overlying sandstones, which underwent mostly diagenesis. APS minerals are Sr- and S-rich (svanbergite end-member) in the sedimentary cover overlying the unconformity, whereas they are light rare earth elements (LREE)-rich (florencite end-member) in the altered basement rocks below the unconformity. The geochemical signature of each group of APS minerals together with the petrography indicates three distinct generations of APS minerals related to the following: (1) paleoweathering of continental surfaces prior to the basin occurrence, (2) diagenetic processes during the burial history of the lower unit of the Thelon sandstones, and (3) hydrothermal alteration processes which accompanied the uranium deposition in the basement rocks and partially overlap the sedimentary-diagenetic mineral parageneses. In addition, the association of a first generation of APS minerals with both detrital cerium oxide and aluminum oxy-hydroxide highlights the fact that a part of the detrital material of the basal Thelon Formation originated from eroded paleolaterite (allochthonous regolith). The primary rare earth element (REE)-bearing minerals (e.g., monazite, REE carbonates, and allanite) of the host rocks were characterized to identify the potential sources of REE. The REE chemical composition highlights a local re-incorporation of the REE released from the alteration processes in the APS minerals of

  19. Is there a therapeutic window for pentoxifylline after the onset of acute pancreatitis? Existe uma janela terapêutica para a pentoxifilina após o início da pancreatite aguda?

    Directory of Open Access Journals (Sweden)

    Ana Maria Mendonça Coelho

    2012-07-01

    Full Text Available PURPOSE: To investigate the effects of pentoxifylline (PTX in experimental acute pancreatitis (AP starting drug administration after the induction of the disease. METHODS: One hundred male Wistar rats were submitted to taurocholate-induced AP and divided into three groups: Group Sham: sham-operated rats, Group Saline: AP plus saline solution, and Group PTX: AP plus PTX. Saline solution and PTX were administered 1 hour after induction of AP. At 3 hours after AP induction, peritoneal levels of tumor necrosis factor (TNF-α, and serum levels of interleukin (IL-6 and IL-10 levels were assayed by Enzyme-Linked Immunosorbent Assay (ELISA. Determinations of lung myeloperoxidase activity (MPO, histological analysis of lung and pancreas, and mortality study were performed. RESULTS: PTX administration 1 hour after induction of AP caused a significant decrease in peritoneal levels of TNF-α and in serum levels of IL-6 and IL-10 when compared to the saline group. There were no differences in lung MPO activity between the two groups with AP. A decrease in mortality was observed in the PTX treatment compared to the saline group. CONCLUSIONS: Administration of PTX after the onset of AP decreased the systemic levels of proinflammatory cytokines, raising the possibility that there is an early therapeutic window for PTX after the initiation of AP.OBJETIVO: Investigar os efeitos da pentoxifilina (PTX na pancreatite aguda (PA experimental administrando a droga após a indução da doença. MÉTODOS: Cem ratos machos Wistar foram submetidos à indução da PA através da infusão de taurocolato de sódio e divididos em três grupos: Grupo Sham: sham-operated ratos, Grupo Salina: AP e solução salina, e Grupo PTX: AP e PTX. Solução salina e PTX foram administradas 1 hora após a indução da PA. Três horas após indução da PA os níveis de fator de necrose tumoral (TNF-α no líquido peritoneal e os níveis séricos de interleucina (IL-6 e IL-10 foram

  20. Functional Analysis of the Two Brassica AP3 Genes Involved in Apetalous and Stamen Carpelloid Phenotypes

    OpenAIRE

    Zhang, Yanfeng; Wang, Xuefang; Zhang, Wenxue; Yu, Fei; Tian, Jianhua; Li, Dianrong; Guo, Aiguang

    2011-01-01

    The Arabidopsis homeotic genes APETALA3 (AP3) and PISTILLATA (PI) are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC) mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8...

  1. Mammalian Base Excision Repair: Functional Partnership between PARP-1 and APE1 in AP-Site Repair.

    Directory of Open Access Journals (Sweden)

    Rajendra Prasad

    Full Text Available The apurinic/apyrimidinic- (AP- site in genomic DNA arises through spontaneous base loss and base removal by DNA glycosylases and is considered an abundant DNA lesion in mammalian cells. The base excision repair (BER pathway repairs the AP-site lesion by excising and replacing the site with a normal nucleotide via template directed gap-filling DNA synthesis. The BER pathway is mediated by a specialized group of proteins, some of which can be found in multiprotein complexes in cultured mouse fibroblasts. Using a DNA polymerase (pol β immunoaffinity-capture technique to isolate such a complex, we identified five tightly associated and abundant BER factors in the complex: PARP-1, XRCC1, DNA ligase III, PNKP, and Tdp1. AP endonuclease 1 (APE1, however, was not present. Nevertheless, the complex was capable of BER activity, since repair was initiated by PARP-1's AP lyase strand incision activity. Addition of purified APE1 increased the BER activity of the pol β complex. Surprisingly, the pol β complex stimulated the strand incision activity of APE1. Our results suggested that PARP-1 was responsible for this effect, whereas other proteins in the complex had no effect on APE1 strand incision activity. Studies of purified PARP-1 and APE1 revealed that PARP-1 was able to stimulate APE1 strand incision activity. These results illustrate roles of PARP-1 in BER including a functional partnership with APE1.

  2. Genome-wide identification, phylogeny, evolution and expression patterns of AP2/ERF genes and cytokinin response factors in Brassica rapa ssp. pekinensis.

    Directory of Open Access Journals (Sweden)

    Zhenning Liu

    Full Text Available The AP2/ERF transcription factor family is one of the largest families involved in growth and development, hormone responses, and biotic or abiotic stress responses in plants. In this study, 281 AP2/ERF transcription factor unigenes were identified in Chinese cabbage. These superfamily members were classified into three families (AP2, ERF, and RAV. The ERF family was subdivided into the DREB subfamily and the ERF subfamily with 13 groups (I- XI based on sequence similarity. Duplication, evolution and divergence of the AP2/ERF genes in B. rapa and Arabidopsis thaliana were investigated and estimated. Cytokinin response factors (CRFs, as a subclade of the AP2/ERF family, are important transcription factors that define a branch point in the cytokinin two-component signal (TCS transduction pathway. Up to 21 CRFs with a conserved CRF domain were retrieved and designated as BrCRFs. The amino acid sequences, conserved regions and motifs, phylogenetic relationships, and promoter regions of the 21 BrCRFs were analyzed in detail. The BrCRFs broadly expressed in various tissues and organs. The transcripts of BrCRFs were regulated by factors such as drought, high salinity, and exogenous 6-BA, NAA, and ABA, suggesting their involvement in abiotic stress conditions and regulatory mechanisms of plant hormone homeostasis. These results provide new insight into the divergence, variation, and evolution of AP2/ERF genes at the genome-level in Chinese cabbage.

  3. Installation Technology of AP1000 Steam Generator%AP1000蒸汽发生器安装技术

    Institute of Scientific and Technical Information of China (English)

    郑东宏; 王志强; 张明; 门昌华; 胡德全

    2013-01-01

    AP1000 nuclear power plant is a 3rd generation advanced passive 1000 MWe pressurized water reactor plant with two loops of reactor coolant systems .Compared with the conventional 2nd generation pressurized water reactor technology ,the steam generator ( SG) of AP1000 has many improved changes concerning SG property features and arrangement requirements for facilities within the nuclear island . Based on these improved changes and relevant installation practices ,the installation technology of AP 1000 SG has been introduced and analyzed including installation preparation ,transportation ,lifting,and instal-lation construction ,etc., with a view to provide a technical reference to the installation of main equip-ments in steam supply system of nuclear power plant .%AP1000是二环路的1000 MWe级压水堆三代核电厂,采用非能动安全设施,与传统的二代压水堆核电技术相比,蒸汽发生器本体特征和核岛内的就位要求均有较大的改进。根据AP1000蒸汽发生器自身的特点,并在实践的基础上,对蒸汽发生器的现场安装技术,包括安装准备、现场运输、吊装、核岛安装等进行了介绍和分析,为核电站核蒸汽供应系统主设备的现场运输、吊装和安装提供技术参考。

  4. Selected Topics in Teleparallel Gravity

    CERN Document Server

    Aldrovandi, R; Vu, K H

    2003-01-01

    Teleparallel gravity can be seen as a gauge theory for the translation group. As such, its fundamental field is neither the tetrad nor the metric, but a gauge potential assuming values in the Lie algebra of the translation group. This gauge character makes of teleparallel gravity, despite its equivalence to general relativity, a rather peculiar theory. A first important point is that it does not rely on the universality of free fall, and consequently does not require the equivalence principle to describe the gravitational interaction. Another peculiarity is its similarity with Maxwell's theory, which allows an Abelian nonintegrable phase factor approach, and consequently a global formulation for gravitation. Application of these concepts to the motion of spinless particles, as well as to the COW and gravitational Aharonov-Bohm effects are presented and discussed.

  5. PREFACE: Asia-Pacific Interdisciplinary Research Conference 2011 (AP-IRC 2011)

    Science.gov (United States)

    Sandhu, Adarsh; Okada, Hiroshi; Maekawa, Toru; Okano, Ken

    2012-03-01

    ; a novel method for the synthesis of graphene using bacteria extracted from a riverside in Toyohashi by Toyohashi Tech scientists; and ambitious plans to harvest energy by laying massive numbers of solar cells in North Africa as part of the 'Sahara Solar Breeder (SSB) Plan' for a global clean-energy superhighway, described by Hideomi Koinuma. In addition to the technical sessions, the conference banquet included a short session during which the invited speakers described notable trends in research and policy in their part of the world. The short speeches led to animated discussions between the delegates, particularly the young scientists and graduate students, who were able to talk directly with veteran researchers for a first-hand view of the issues raised during the day's presentations. In closing the conference, Professor Makoto Ishida, co-chair of the conference and vice-president of Toyohashi Tech announced that this conference will be held annually at the same time each year, with AP-IRC 2012 scheduled for 15-16 November 2012 at the Irago Sea-Park & Spa Hotel in Aichi Prefecture, Japan. AP-IRC group The PDF also contains lists of the Committees involved.

  6. Topical Session on the Decommissioning and Dismantling Safety Case

    International Nuclear Information System (INIS)

    Set up by the Radioactive Waste Management Committee (RWMC), the WPDD brings together senior representatives of national organisations who have a broad overview of Decommissioning and Dismantling (D and D) issues through their work as regulators, implementers, R and D experts or policy makers. These include representatives from regulatory authorities, industrial decommissioners from the NEA Cooperative Programme on Exchange of Scientific and Technical Information on Nuclear Installation Decommissioning Projects (CPD), and cross-representation from the NEA Committee on Nuclear Regulatory Activities, the Committee on Radiation Protection and Public Health, and the RWMC. The EC is a member of the WPDD and the IAEA also participates. This ensures co-ordination amongst activities in these international programmes. Participation from civil society organisations is considered on a case by case basis, and has already taken place through the active involvement of the Group of Municipalities with Nuclear Installations at the first meeting of the WPDD At its second meeting, in Paris, 5-7 December 2001, the WPDD held two topical sessions on the D and D Safety Case and on the Management of Materials from D and D, respectively. This report documents the topical session on the safety case. The topical session was meant to provide an exchange of information and experience on the following issues: What topics should be included in a safety case? Of what should it consist? Is there sufficient and complete guidance nationally and internationally? How do practices differ internationally? Main boundary condition to this session was that it would deal with plants where spent fuel has been removed. Also the topical sessions was kept at a level that makes the most of the varied constituency of the WPDD. Namely, interface issues are important, and issue-identification and discussion was the immediate goal. There was less interest in examining areas where variability amongst national

  7. "-ing" Project: Encouraging Cohesion in Small Groups

    Science.gov (United States)

    McBride, M. Chad

    2006-01-01

    Group cohesiveness is a topic addressed in most small group communication texts and courses and is often defined as the degree of attraction members feel towards one another, the degree of loyalty within a group, or the "groupness" felt among members. Further, groups which are cohesive tend to be happier and more productive. When working on…

  8. Lattice theory special topics and applications

    CERN Document Server

    Wehrung, Friedrich

    2014-01-01

    George Grätzer's Lattice Theory: Foundation is his third book on lattice theory (General Lattice Theory, 1978, second edition, 1998). In 2009, Grätzer considered updating the second edition to reflect some exciting and deep developments. He soon realized that to lay the foundation, to survey the contemporary field, to pose research problems, would require more than one volume and more than one person. So Lattice Theory: Foundation provided the foundation. Now we complete this project with Lattice Theory: Special Topics and Applications, written by a distinguished group of experts, to cover some of the vast areas not in Foundation. This first volume is divided into three parts. Part I. Topology and Lattices includes two chapters by Klaus Keimel, Jimmie Lawson and Ales Pultr, Jiri Sichler. Part II. Special Classes of Finite Lattices comprises four chapters by Gabor Czedli, George Grätzer and Joseph P. S. Kung. Part III. Congruence Lattices of Infinite Lattices and Beyond includes four chapters by Friedrich W...

  9. Group Formation in Economics

    Science.gov (United States)

    Demange, Gabrielle; Wooders, Myrna

    2005-01-01

    Broad and diverse ranges of activities are conducted within and by organized groups of individuals, including political, economic and social activities. These activities have recently become a subject of intense interest in economics and game theory. Some of the topics investigated in this collection are models of networks of power and privilege, trade networks, co-authorship networks, buyer-seller networks with differentiated products, and networks of medical innovation and the adaptation of new information. Other topics are social norms on punctuality, clubs and the provision of club goods and public goods, research and development and collusive alliances among corporations, and international alliances and trading agreements. While relatively recent, the literature on game theoretic studies of group formation in economics is already vast. This volume provides an introduction to this important literature on game-theoretic treatments of situations with networks, clubs, and coalitions, including some applications.

  10. Corneal staining after treatment with topical tetracycline

    NARCIS (Netherlands)

    R. Lapid-Gortzak; C.P. Nieuwendaal; A.R. Slomovic; L. Spanjaard

    2006-01-01

    Purpose: The purpose of this paper is to report a case of corneal staining after treatment with topical tetracycline. Methods: A patient with crystalline keratopathy caused by Streptococcus viridans after corneal transplantation was treated topically with tetracycline eye drops, based on results of

  11. Psoriasis: improving adherence to topical therapy.

    NARCIS (Netherlands)

    Feldman, S.R.; Horn, E.J.; Balkrishnan, R.; Basra, M.K.; Finlay, A.Y.; McCoy, D.; Menter, A.; Kerkhof, P.C.M. van de

    2008-01-01

    Topical therapy has an important role in psoriasis treatment. It is efficacious and has a favorable safety profile as demonstrated in clinical trials. However, poor treatment outcomes from topical therapy regimens likely result from poor adherence and ineffective use of the medication. The Internati

  12. Fostering Topic Knowledge: Essential for Academic Writing

    Science.gov (United States)

    Proske, Antje; Kapp, Felix

    2013-01-01

    Several researchers emphasize the role of the writer's topic knowledge for writing. In academic writing topic knowledge is often constructed by studying source texts. One possibility to support that essential phase of the writing process is to provide interactive learning questions which facilitate the construction of an adequate situation…

  13. Infantile generalized hypertrichosis caused by topical minoxidil*

    OpenAIRE

    Rampon, Greice; Henkin, Caroline; de Souza, Paulo Ricardo Martins; de Almeida Jr, Hiram Larangeira

    2016-01-01

    Rare cases of hypertrichosis have been associated with topically applied minoxidil. We present the first reported case in the Brazilian literature of generalized hypertrichosis affecting a 5-year-old child, following use of minoxidil 5%, 20 drops a day, for hair loss. The laboratory investigation excluded hyperandrogenism and thyroid dysfunction. Topical minoxidil should be used with caution in children.

  14. Aerodynamics of wind turbines emerging topics

    CERN Document Server

    Amano, R S

    2014-01-01

    Focusing on Aerodynamics of Wind Turbines with topics ranging from Fundamental to Application of horizontal axis wind turbines, this book presents advanced topics including: Basic Theory for Wind turbine Blade Aerodynamics, Computational Methods, and Special Structural Reinforcement Technique for Wind Turbine Blades.

  15. Topic Maps Based Project Knowledge Management

    Institute of Scientific and Technical Information of China (English)

    Wu Xiaofan; Zhou Liang; Zhang Lei; Li Lingzhi; Ding Qiulin

    2006-01-01

    Based on topic maps, a preprocessing scheme using similarity comparision is presented and applied in knowledge management.Topic and occurrence-oriented merging algorithm is also introduced to implement knowledge integration for the sub-system. An Omnigator-supported example from an aeroaustic institute is utilised to validate the preprocessing method and the result indicates it can speed up the research schedule.

  16. Infantile generalized hypertrichosis caused by topical minoxidil*

    Science.gov (United States)

    Rampon, Greice; Henkin, Caroline; de Souza, Paulo Ricardo Martins; de Almeida Jr, Hiram Larangeira

    2016-01-01

    Rare cases of hypertrichosis have been associated with topically applied minoxidil. We present the first reported case in the Brazilian literature of generalized hypertrichosis affecting a 5-year-old child, following use of minoxidil 5%, 20 drops a day, for hair loss. The laboratory investigation excluded hyperandrogenism and thyroid dysfunction. Topical minoxidil should be used with caution in children. PMID:26982785

  17. Infantile generalized hypertrichosis caused by topical minoxidil.

    Science.gov (United States)

    Rampon, Greice; Henkin, Caroline; de Souza, Paulo Ricardo Martins; Almeida, Hiram Larangeira de

    2016-01-01

    Rare cases of hypertrichosis have been associated with topically applied minoxidil. We present the first reported case in the Brazilian literature of generalized hypertrichosis affecting a 5-year-old child, following use of minoxidil 5%, 20 drops a day, for hair loss. The laboratory investigation excluded hyperandrogenism and thyroid dysfunction. Topical minoxidil should be used with caution in children. PMID:26982785

  18. Histiocytosis X: treatment with topical nitrogen mustard.

    Science.gov (United States)

    Berman, B; Chang, D L; Shupack, J L

    1980-07-01

    The case histories of two elderly patients with cutaneous histiocytosis X treated topically with nitrogen mustard are presented. The cutaneous lesions cleared within 2 to 3 weeks, and remission was maintained with daily topical administration of nitrogen mustard. The clinical impression of improvement was substantiated by light and electron microscopic studies prior to and after therapy.

  19. Topics on Electricity Transmission Pricing

    International Nuclear Information System (INIS)

    -subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. To start with, chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently coordinate the allocation of transmission

  20. Status of APS 1-Mwe Parabolic Trough Project

    Energy Technology Data Exchange (ETDEWEB)

    Canada, S.; Brosseau, D.; Kolb, G.; Moore, L.; Cable, R.; Price, H.

    2005-11-01

    Arizona Public Service (APS) is currently installing new power facilities to generate a portion of its electricity from solar resources that will satisfy its obligation under the Arizona Environmental Portfolio Standard (EPS). During FY04, APS began construction on a 1-MWe parabolic trough concentrating solar power plant. This plant represents the first parabolic trough plant to begin construction since 1991. Site preparation and construction activities continued throughout much of FY05, and startup activities are planned for Fall 2005 (with completion early in FY06). The plant will be the first commercial deployment of the Solargenix parabolic trough collector technology developed under contract to the National Renewable Energy Laboratory. The plant will use an organic Rankine cycle (ORC) power plant, provided by Ormat. The ORC power plant is much simpler than the conventional steam Rankine cycle plant and allows unattended operation of the facility.

  1. Comparative advantages of AP1000 passive safety system

    International Nuclear Information System (INIS)

    With the increasing need of nuclear power, almost all countries who want to build new nuclear power plant take the generation Ⅲ technology as their first choice. The main reason is that the safety of generation Ⅲ technology has been improved greatly than generation Ⅱ and Ⅱ + technology. The passive safety technology is introduced by AP1000 and it is one of the best in generation Ⅲ technologies. The representative passive containment cooling system of AP1000 and containment spray system of generation Ⅱ nuclear power plant were compared in the paper and analyzed using probabilistic safety assessment method. The reasons of passive safety system possessing comparative advantages were obtained by the concrete calculation. (authors)

  2. Development of a topic-related sentence corpus for speech perception research

    Science.gov (United States)

    Helfer, Karen S.; Freyman, Richard L.

    2001-05-01

    A large sentence corpus has been developed for use in speech recognition research. Sentences (n=881, three scoring words per sentence) were developed under 23 topics. In the first phase of development subjects rated each individual scoring word for relatedness to its given topic on a Likert scale. Next, two groups of young, normal-hearing listeners (n=16/group) listened and responded to the recordings of the sentences (spoken by a female talker) presented with one of two types of maskers: steady-state noise (S:N=-13 dB) or two other females speaking random sentences (S:N=-8 dB). Each subject responded to half of the sentences with topic supplied and half with no topic supplied. Data analyses focused on addressing two questions: whether supplementation of topic would be more important in the presence of the speech masker versus the noise masker, and how the degree of relatedness of each key word to the topic influenced the effect of topic on recognition. The data showed little difference in how beneficial the topic was for speech versus noise maskers. Moreover, there was a complex relationship between effect of topic, type of masker, and position of the word in the sentence. [Work supported by NIDCD DC01625.

  3. Topical antioxidants in radiodermatitis: a clinical review.

    Science.gov (United States)

    Kodiyan, Joyson; Amber, Kyle T

    2015-09-01

    Radiation-induced skin toxicity is the most prevalent side effect of radiation therapy. Not only does it have a significant effect on patients' quality of life, but it also results in poor follow-up and early termination of radiotherapy treatment. Several skin care practices and topical applications have been studied in the field of radiodermatitis, including skin washing, topical steroids, and mechanical skin barriers. Aside from these methods, many patients turn to complementary and alternative medicine for the prevention and treatment of radiodermatitis. Many of these alternative therapies are topically applied antioxidants. While the rationale behind the use of antioxidants in treating radiodermatitis is strong, clinical studies have been far less consistent. Even in large scale randomised controlled trials, findings have been limited by the inconsistent use of topical vehicles and placebos. In this article, the authors review the role of topical antioxidants to better help the practitioner navigate through different available skin directed antioxidants.

  4. Correlated Topic Model for Web Services Ranking

    Directory of Open Access Journals (Sweden)

    Mustapha AZNAG

    2013-07-01

    Full Text Available With the increasing number of published Web services providing similar functionalities, it’s very tedious for a service consumer to make decision to select the appropriate one according to her/his needs. In this paper, we explore several probabilistic topic models: Probabilistic Latent Semantic Analysis (PLSA, Latent Dirichlet Allocation (LDA and Correlated Topic Model (CTM to extract latent factors from web service descriptions. In our approach, topic models are used as efficient dimension reduction techniques, which are able to capture semantic relationships between word-topic and topic-service interpreted in terms of probability distributions. To address the limitation of keywords-based queries, we represent web service description as a vector space and we introduce a new approach for discovering and ranking web services using latent factors. In our experiment, we evaluated our Service Discovery and Ranking approach by calculating the precision (P@n and normalized discounted cumulative gain (NDCGn.

  5. Review of Topical Treatment of Upper Tract Urothelial Carcinoma

    Directory of Open Access Journals (Sweden)

    Kenneth G. Nepple

    2009-01-01

    Full Text Available A select group of patients with upper tract urothelial carcinoma may be appropriate candidates for minimally invasive management. Organ-preserving endoscopic procedures may be appropriate for patients with an inability to tolerate major surgery, solitary kidney, bilateral disease, poor renal function, small tumor burden, low-grade disease, or carcinoma in situ. We review the published literature on the use of topical treatment for upper tract urothelial carcinoma and provide our approach to treatment in the office setting.

  6. Introducing topics about combustion engine in tehnology education

    OpenAIRE

    Škrjanc, Sebastjan

    2013-01-01

    In the thesis we will briefly present internal combustion engines. We divided them into groups according to the number of cycles, according to the position of pistons, after cooling mode, etc.. We will also present advanced technology with which they are during the development of engines reduce their consumption. Everything will be linked to the primary school. Normaly, pupils, the engines meet in eighth grade. We will check how well these topics covered in elementary textbooks, and nat...

  7. Multibunch working group

    International Nuclear Information System (INIS)

    The goal of this working group was to foment discussions about the use and limitations of multi-bunch, representatives from most operating or in-project synchrotron radiation sources (ALS, SPEAR, BESSY-2, SPRING-8, ANKA, DELTA, PEP-2, DIAMOND, ESRF...) have presented their experience. The discussions have been led around 3 topics: 1) resistive wall instabilities and ion instabilities, 2) higher harmonic cavities, and 3) multibunch feedback systems

  8. Diffusion and Settling in Ap/Bp Stars

    Energy Technology Data Exchange (ETDEWEB)

    Turcotte, S

    2003-04-09

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  9. Diffusion and Settling in Ap/Bp Stars

    CERN Document Server

    Turcotte, S

    2003-01-01

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  10. Electron-cloud measurements and simulations for the APS

    OpenAIRE

    Furman, M.A.; Pivi, M.; Harkay, K.C.; Rosenberg, R. A.

    2001-01-01

    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC.

  11. On the progenitor of the Type Ic supernova 2002ap

    NARCIS (Netherlands)

    Smartt, SJ; Ramirez-Ruiz, E; Gilmore, GF; Meikle, WPS; Ferguson, AMN; Knapen, JH

    2002-01-01

    This Letter presents wide-field optical and near-IR (UBVRIHalphaK') images of the galaxy M74 that were taken between 0.6 and 8.3 yr before the discovery of the Type Ic supernova 2002ap. We have located the position of the supernova on these images with an accuracy of 0."3. We find no sign of a proge

  12. Thermal analysis of the beam missteering in APS storage ring

    International Nuclear Information System (INIS)

    Several bending magnet beam missteering cases have been investigated for the 7-GeV storage ring of the Advanced Photon Source (APS). One of the critical missteering events is presented in this paper. Finite element analyses are performed to solve for both temperature and stress fields. Thermally induced deflections are determined by using beam bending theory. A safe current limit is established for the storage ring chambers

  13. Electron-cloud measurements and simulations for the APS

    International Nuclear Information System (INIS)

    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC

  14. Interrelationships between ALOX5AP polymorphisms, serum leukotriene B4 level and risk of acute coronary syndrome.

    Directory of Open Access Journals (Sweden)

    Guoping He

    Full Text Available BACKGROUND: We investigated the relationships between the ALOX5AP gene rs10507391 and rs4769874 polymorphisms, serum levels of leukotriene (LT B4, and risk of acute coronary syndrome (ACS. METHODS: A total of 709 participants, comprising 508 ACS patients (ACS group and 201 noncoronary artery disease patients with chest pain (control group were recruited from the Han population of the Changwu region in China. Two polymorphic loci were genotyped using polymerase chain reaction and restriction fragment length polymorphism analysis. Serum LTB4 level was determined by enzyme-linked immunosorbent assay. RESULTS: Serum LTB4 levels were significantly higher (P<0.001 in the ACS group (median/interquartile range, 470.27/316.32 pg/ml than in the control group (233.05/226.82 pg/ml. No statistical differences were observed between genotype, allele and haplotype frequencies for the tested loci in either the ACS group or the control group, even after adjustments were made for conventional risk factors by multivariate logistic regression. This suggests there is no association between the ALOX5AP rs10507391 and rs4769874 polymorphisms and ACS risk. Elevated serum LTB4 level was closely linked to ACS risk, and may be independent of traditional risk factors as a risk factor for ACS (P<0.001. There was no significant association between serum LTB4 levels and the two variants in either the ACS group or the control group. CONCLUSIONS: Rs10507391, rs4769874 and its haplotypes in ALOX5AP are unrelated to ACS risk in the Chinese Han population of Changwu, but elevated serum LTB4 level is strongly associated with ACS risk. Serum LTB4 level is not subject to the influence of either the rs10507391, rs4769874 or the haplotype.

  15. Data of evolutionary structure change: 1AP2D-1QLRD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AP2D-1QLRD 1AP2 1QLR D D EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQ...RPEQGLEWIGRIDPANDNTKYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTTVTVPSGS------------------------...--------------------------------------------------------------- EVQLQQWGAGLLKPSETLSLTCAVYGGSFSD...EEE EEEEE 0 1QLR D 1QLRD GEINH-SGST

  16. Work plan, AP-102 mixer pump removal and pump replacement

    International Nuclear Information System (INIS)

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  17. Maternal AP determinants in the Drosophila oocyte and embryo.

    Science.gov (United States)

    Ma, Jun; He, Feng; Xie, Gengqiang; Deng, Wu-Min

    2016-09-01

    An animal embryo cannot initiate its journey of forming a new life on its own. It must rely on maternally provided resources and inputs to kick-start its developmental process. In Drosophila, the initial polarities of the embryo along both the anterior-posterior (AP) and dorsal-ventral (DV) axes are also specified by maternal determinants. Over the past several decades, genetic and molecular studies have identified and characterized such determinants, as well as the zygotic genetic regulatory networks that control patterning in the early embryo. Extensive studies of oogenesis have also led to a detailed knowledge of the cellular and molecular interactions that control the formation of a mature egg. Despite these efforts, oogenesis and embryogenesis have been studied largely as separate problems, except for qualitative aspects with regard to maternal regulation of the asymmetric localization of maternal determinants. Can oogenesis and embryogenesis be viewed from a unified perspective at a quantitative level, and can that improve our understanding of how robust embryonic patterning is achieved? Here, we discuss the basic knowledge of the regulatory mechanisms controlling oogenesis and embryonic patterning along the AP axis. We explore properties of the maternal Bicoid gradient in relation to embryo size in search for a unified framework for robust AP patterning. WIREs Dev Biol 2016, 5:562-581. doi: 10.1002/wdev.235 For further resources related to this article, please visit the WIREs website. PMID:27253156

  18. Standardized safety management of AP1000 nuclear power plant

    International Nuclear Information System (INIS)

    In 2002, China published and implemented the Law of the People's Republic of China on Work Safety and promulgated a series of guidelines and policies, which strengthened the safety management supervision. Standardization of safety, as another important step on safety supervision, comes after safety assesment and safety production licensing system, is also a permanent solution. Standardization of safety is a strategic, long term and fundamental work, which is also the basic access to achieving scientific safety management and increasing the inherent safety of an enterprise. Haiyang AP1000 nuclear power plant, adopting the modularized, 'open-top' and parallel construction means, overturned the traditional construction theory of installation work comes after the civil work and greatly shorten the construction period. At the same time, the notable increase of oversize module transportation and lifting and parallel construction raises higher demands for safety management. This article combines the characteristics and difficulties of safety management for Haiyang AP1000 nuclear power plant, puts forward ideas and methods for standardized safety management, and could also serve as reference to the safety management for other AP1000 projects. (authors)

  19. Special topics in international adoption.

    Science.gov (United States)

    Jenista, Jerri Ann

    2005-10-01

    As international adoption has become more "mainstream," the issues recently addressed in domestic adoption have become more important in adoptions involving children originating in other countries. Certain groups of prospective adoptive parents, such as gay or lesbian couples, single parents, and parents with disabilities, have begun to apply to adopt in ever increasing numbers. Children who may have been considered unadoptable in the past are now routinely being offered to prospective adoptive parents. The numbers and ages of the children placed and the spacing between adoptions have come under scrutiny. The rates of adoption dissolutions and disruptions are being examined carefully by the receiving and sending countries. There is a pressing need for research into numerous social aspects of adoption. PMID:16154473

  20. Assessment of topical versus oral ivermectin as a treatment for head lice.

    Science.gov (United States)

    Ahmad, Hesham M; Abdel-Azim, Eman S; Abdel-Aziz, Rasha T

    2014-01-01

    Many medications are available for treatment of pediculosis capitis including ivermectin. Our aim is to compare the efficacy and safety of topical versus oral ivermectin in treatment of pediculosis capitis. Sixty-two patients with proved head lice infestation were included and divided into group I (31 patients; received single topical application of 1% ivermectin) and group II (31 patients; received single dose of oral ivermectin). Treatment was repeated after 1 week for nonresponders. At 1 week after treatment, the eradication rates and improvement of pruritus were significantly higher among patients who received topical than oral ivermectin. When a second treatment, topical or oral, was given to nonresponders, the cure rates of infestation and pruritus was 100% and 97% among patients treated with topical and oral ivermectin, respectively with no significant difference between the two groups. This study suggests that both topical and oral ivermectin demonstrate high efficacy and tolerability in treatment of pediculosis capitis. However, a single treatment with topical ivermectin provides significantly higher cure of infestation and faster relief of pruritus than oral ivermectin. In addition, whether topical or oral ivermectin is used to treat head lice, a second dose is required in some cases to ensure complete eradication.

  1. Therapeutic Effects of Topical Minoxidil or Rosemary and the Combination of Both on the treatment of Alopecia areata

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Lohrasb

    2015-02-01

    Full Text Available Background & Objectives: Considering the prevalence of Alopecia areata, , failure of treatment, and the unknown pathogenesis of this illness, a comparative study was performed by using topical Minoxidil 2% and topical rosemary solution alone and in combination to treatment this disease. Materials & Methods: This study is a clinical trial performed on 200 patients with Alopecia areata referring to Hamzeh clinic of Fasa during the years 2012 and 2013. They were divided into four groups by random permutation, each group contained 50 patients. Group one received the combination of topical Minoxidil 2% and topical rosemary, group two received only topical Minoxidil 2% solution, group three received only topical rosemary solution and the fourth group, the case-control group, did not receive any medication and were just advised to rub the site of the disease for the same period of time. The patients were under observation for one year. Results: The Results of this investigation showed that the best remissions after treatments were as follow (respectively: combination of topical Minoxidil 2% and topical rosemary (27 patient=54 %, Minoxidil 2% solution (23 patients =46%, rosemary solution (21 patients =42%, and case- control group (9 patients =18%. These results showed that despite better response to the combination of rosemary and Minoxidil solutions in comparison to the two other treated groups, the changes were minimal and statistically insignificant (P-value =0.0411. Conclusion: Using the combination of both rosemary and Minoxidil is more effective than the individual one on treatment of Alopecia areata.

  2. PolyADP-ribose polymerase is a coactivator for AP-2-mediated transcriptional activation.

    OpenAIRE

    Kannan, P; Yu, Y; Wankhade, S; Tainsky, M A

    1999-01-01

    Overexpression of transcription factor AP-2 has been implicated in the tumorigenicity of the human teratocarcinoma cell lines PA-1 that contain an activated ras oncogene. Here we show evidence that overexpression of AP-2 sequesters transcriptional coactivators which results in self-inhibition. We identified AP-2-interacting proteins and determined whether these proteins were coactivators for AP-2-mediated transcription. One such interacting protein is polyADP-ribose polymerase (PARP). PARP su...

  3. Topics in Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. To start with, chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently

  4. Topics on Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. Chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently coordinate the

  5. Topics in Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. To start with, chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently

  6. Topics on Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. Chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently coordinate the

  7. Effects of topical hypothermia on postoperative inflammatory markers in patients undergoing coronary artery bypass surgery

    OpenAIRE

    Kadan, Murat; Erol, Gokhan; Savas Oz, Bilgehan; Arslan, Mehmet

    2014-01-01

    Summary Background We aimed to examine the effects of topical hypothermia on inflammatory markers in patients undergoing coronary artery bypass surgery. Methods Fifty patients undergoing isolated coronary artery bypass surgery were included the study. They were randomised to two groups. Mild hypothermic cardiopulmonary bypass (28–32°C) was performed on both groups using standardised anaesthesiology and surgical techniques. Furthermore, topical cooling with 4°C saline was performed on patients...

  8. Development and validation of the Affect in Play Scale-brief rating version (APS-BR).

    Science.gov (United States)

    Cordiano, Tori J Sacha; Russ, Sandra W; Short, Elizabeth J

    2008-01-01

    The Affect in Play Scale (APS; Russ, 1987, 2004) is one of few reliable, standardized measures of pretend play, yet the fact that it requires videotaping and extensive training to score compromises its clinical utility. In this study, we developed and validated a brief rating version (APS-BR) that does not require videotaping. Construct validity was established by comparing scores from the original APS and the APS-BR using an existing data set of videotaped play (n = 46). We examined associations between scores on the APS-BR and theoretically relevant measures of divergent thinking and emotional memories. Scores on the APS-BR related strongly to those on the APS, and the pattern of correlations for each scale and relevant criterion measures was similar in strength and direction, supporting the APS-BR as an alternate form of the APS. In addition, we completed a pilot study to examine the efficacy of using the APS-BR in its intended in vivo format (n = 28). Results from both studies suggest that the APS-BR is a promising brief measure of children's pretend play that can be substituted for the APS in clinical and research settings. PMID:18444095

  9. NRC confirmatory AP600 safety system phase I testing in the ROSA/AP600 test facility

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, G.S.; Kukita, Yutaka; Schultz, R.R.

    1996-03-01

    The NRC confirmatory phase I testing for the AP600 safety systems has been completed in the modified ROSA (Rig of Safety Assessment) test facility located at the Japan Atomic Energy Research Institute (JAERI) campus in Tokai, Japan. The test matrix included a variety of accident scenarios covering both design and beyond-design basis accidents. The test results indicate the AP600 safety systems as reflected in ROSA appear to perform as designed and there is no danger of core heatup for the accident scenarios investigated. In addition, no detrimental system interactions nor adverse effects of non-safety systems on the safety system functions were identified. However, three phenomena of interest have been identified for further examination to determine whether they are relevant to the AP600 plant. Those three phenomena are: (1) a potential for water hammer caused by rapid condensation which may occur following the actuation of the automatic depressurization system (ADS), (2) a large thermal gradient in the cold leg pipe where cooled water returns from the passive residual heat removal system and forms a thermally stratified layer, and (3) system-wide oscillations initiating following the ADS stage 4 actuation and persisting until the liquid in the pressurizer drains and steam generation in the core becomes insignificant.

  10. Role of the tryptophan residue in the vicinity of the catalytic center of exonuclease III family AP endonucleases: AP site recognition mechanism

    OpenAIRE

    Kaneda, Kohichi; Sekiguchi, Junichi; Shida, Toshio

    2006-01-01

    The mechanisms by which AP endonucleases recognize AP sites have not yet been determined. Based on our previous study with Escherichia coli exonuclease III (ExoIII), the ExoIII family AP endonucleases probably recognize the DNA-pocket formed at an AP site. The indole ring of a conserved tryptophan residue in the vicinity of the catalytic site presumably intercalates into this pocket. To test this hypothesis, we constructed a series of mutants of ExoIII and human APE1. Trp-212 of ExoIII and Tr...

  11. The AP-1 transcription factor homolog Pf-AP-1 activates transcription of multiple biomineral proteins and potentially participates in Pinctada fucata biomineralization

    OpenAIRE

    Xiangnan Zheng; Minzhang Cheng; Liang Xiang; Jian Liang; Liping Xie; Rongqing Zhang

    2015-01-01

    Activator protein-1 (AP-1) is an important bZIP transcription factor that regulates a series of physiological processes by specifically activating transcription of several genes, and one of its well-chartered functions in mammals is participating in bone mineralization. We isolated and cloned the complete cDNA of a Jun/AP-1 homolog from Pinctada fucata and called it Pf-AP-1. Pf-AP-1 had a highly conserved bZIP region and phosphorylation sites compared with those from mammals. A tissue distrib...

  12. Analyses of Research Topics in the Field of Informetrics Based on the Method of Topic Modeling

    OpenAIRE

    Sung-Chien Lin

    2014-01-01

    In this study, we used the approach of topic modeling to uncover the possible structure of research topics in the field of Informetrics, to explore the distribution of the topics over years, and to compare the core journals. In order to infer the structure of the topics in the field, the data of the papers published in the Journal of Informetricsand Scientometrics during 2007 to 2013 are retrieved from the database of the Web of Science as input of the approach of topic modeling. The results ...

  13. Risk assessment of topically applied products

    DEFF Research Database (Denmark)

    Søborg, Tue; Basse, Line Hollesen; Halling-Sørensen, Bent

    2007-01-01

    parameters for estimating the risk. The immediate human risk of BADGE and derivatives in topical dosage forms was found to be low. However, local treatment of broken skin may lead to higher exposure of BADGE and derivatives compared to application to normal skin. 3-BC permeated skin at higher flux than 4-MBC......The human risk of harmful substances in semisolid topical dosage forms applied topically to normal skin and broken skin, respectively, was assessed. Bisphenol A diglycidyl ether (BADGE) and three derivatives of BADGE previously quantified in aqueous cream and the UV filters 3-BC and 4-MBC were used...

  14. Control of pain with topical plant medicines

    Institute of Scientific and Technical Information of China (English)

    James; David; Adams; Jr.; Xiaogang; Wang

    2015-01-01

    Pain is normally treated with oral nonsteroidal anti-inflammatory agents and opioids. These drugs are dangerous and are responsible for many hospitalizations and deaths. It is much safer to use topical preparations made from plants to treat pain, even severe pain. Topical preparations must contain compounds that penetrate the skin, inhibit pain receptors such as transient receptor potential cation channels and cyclooxygenase-2, to relieve pain. Inhibition of pain in the skin disrupts the pain cycle and avoids exposure of internal organs to large amounts of toxic compounds. Use of topical pain relievers has the potential to save many lives, decrease medical costs and improve therapy.

  15. AP Theory III: Cone-like Graded SUSY, Dynamic Dark Energy and the YM Millenium Problem

    CERN Document Server

    Winkelnkemper, H E

    2010-01-01

    Artin Presentation Theory, (AP Theory), is a new, direct infusion, via pure braid theory, of discrete group theory, (i.e., symmetry in its purest form), into the theory of {\\it smooth} 4-manifolds, (i.e.,$(3+1)$-Quantum Gravity in its purest topological form), thus exhibiting the most basic, rigorous, universal, model-free intrinsic {\\it gauge-gravity} duality in a non-infinitesimal, cone-like graded, as holographic as possible, model-independent, non-perturbative, background-independent, parameter-free manner. {\\it In AP Theory even smooth topology change becomes gauge-theoretic, setting the stage for a rigorous smooth topological $(3+1)$-QFT of Dynamic Dark Energy.} In this theory, the rigid $\\infty$ of the dimension of classical Hilbert space is substituted by the dynamic $\\infty$ of the $\\infty$ generation at each stage of a cone-like graded subgroup of topology-changing transitions/interactions. As a corollary, the Cosmological Constant problem and the YM Millenium Mass Gap problem, two of the most perpl...

  16. Ultrasonic Examination of Double-Shell Tank 241-AP-107 Examination Completed February 2008

    Energy Technology Data Exchange (ETDEWEB)

    Pardini, Allan F.; Weier, Dennis R.; Anderson, Kevin K.

    2008-09-29

    AREVA Federal Services LLC (AFS), under a contract from CH2M HILL Hanford Group (CH2M HILL), has performed an ultrasonic examination of selected portions of Double-Shell Tank 241-AP-107. The purpose of this examination was to provide information that could be used to evaluate the integrity of the wall of the primary tank. The requirements for the ultrasonic examination of Tank 241-AP-107 were to detect, characterize (identify, size, and locate), and record measurements made of any wall thinning, pitting, or cracks that might be present in the wall of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plan (ETP), RPP-Plan-34301 (Castleberry 2007) and summarized on page 1 of this document, are to be reported to CH2M HILL and the Pacific Northwest National Laboratory (PNNL) for further evaluation. Under the contract with CH2M HILL, all data is to be recorded on electronic media and paper copies of all measurements are provided to PNNL for third-party evaluation. PNNL is responsible for preparing a report(s) that describes the results of the AFS ultrasonic examinations.

  17. Quantization on nilpotent Lie groups

    CERN Document Server

    Fischer, Veronique

    2016-01-01

    This book presents a consistent development of the Kohn-Nirenberg type global quantization theory in the setting of graded nilpotent Lie groups in terms of their representations. It contains a detailed exposition of related background topics on homogeneous Lie groups, nilpotent Lie groups, and the analysis of Rockland operators on graded Lie groups together with their associated Sobolev spaces. For the specific example of the Heisenberg group the theory is illustrated in detail. In addition, the book features a brief account of the corresponding quantization theory in the setting of compact Lie groups. The monograph is the winner of the 2014 Ferran Sunyer i Balaguer Prize.

  18. Topics in Double Field Theory

    Science.gov (United States)

    Kwak, Seung Ki

    The existence of momentum and winding modes of closed string on a torus leads to a natural idea that the field theoretical approach of string theory should involve winding type coordinates as well as the usual space-time coordinates. Recently developed double field theory is motivated from this idea and it implements T-duality manifestly by doubling the coordinates. In this thesis we will mainly focus on the double field theory formulation of different string theories in its low energy limit: bosonic, heterotic, type II and its massive extensions, and N = 1 supergravity theory. In chapter 2 of the thesis we study the equivalence of different formulations of double field theory. There are three different formulations of double field theory: background field E formulation, generalized metric H formulation, and frame field EAM formulation. Starting from the frame field formalism and choosing an appropriate gauge, the equivalence of the three formulations of bosonic theory are explicitly verified. In chapter 3 we construct the double field theory formulation of heterotic strings. The global symmetry enlarges to O( D, D + n) for heterotic strings and the enlarged generalized metric features this symmetry. The structural form of bosonic theory can directly be applied to the heterotic theory with the enlarged generalized metric. In chapter 4 we develop a unified framework of double field theory for type II theories. The Ramond-Ramond potentials fit into spinor representations of the duality group O( D, D) and the theory displays Spin+( D, D) symmetry with its self-duality relation. For a specific form of RR 1-form the theory reduces to the massive deformation of type IIA theory due to Romans. In chapter 5 we formulate the N = 1 supersymmetric extension of double field theory including the coupling to n abelian vector multiplets. This theory features a local O(1, 9 + n) x O(1, 9) tangent space symmetry under which the fermions transform. (Copies available exclusively from

  19. Environmental Health Topics from A to Z

    Science.gov (United States)

    ... Topics Environmental Agents Acrylamide Air Pollution Allergens & Irritants Aloe Vera Arsenic Bisphenol A (BPA) Cell Phones Climate ... Cigarette Smoke Cockroaches Dust Mites Pets & Animals Pollen Aloe Vera Alternatives to Animal Testing Arsenic Asthma Autism ...

  20. MedlinePlus Health Topic Web Service

    Data.gov (United States)

    U.S. Department of Health & Human Services — A search-based Web service that provides access to disease, condition and wellness information via MedlinePlus health topic data in XML format. The service accepts...

  1. MedlinePlus Health Topic XML Files

    Data.gov (United States)

    U.S. Department of Health & Human Services — XML files containing information resources on diseases, conditions and wellness issues. MedlinePlus produces three types of health topic XML files – MedlinePlus...

  2. Mining Concurrent Topical Activity in Microblog Streams

    CERN Document Server

    Panisson, A; Quaggiotto, M; Cattuto, C

    2014-01-01

    Streams of user-generated content in social media exhibit patterns of collective attention across diverse topics, with temporal structures determined both by exogenous factors and endogenous factors. Teasing apart different topics and resolving their individual, concurrent, activity timelines is a key challenge in extracting knowledge from microblog streams. Facing this challenge requires the use of methods that expose latent signals by using term correlations across posts and over time. Here we focus on content posted to Twitter during the London 2012 Olympics, for which a detailed schedule of events is independently available and can be used for reference. We mine the temporal structure of topical activity by using two methods based on non-negative matrix factorization. We show that for events in the Olympics schedule that can be semantically matched to Twitter topics, the extracted Twitter activity timeline closely matches the known timeline from the schedule. Our results show that, given appropriate techn...

  3. A Survey On Interactivity in Topic Models

    Directory of Open Access Journals (Sweden)

    Patrik Ehrencrona Kjellin

    2016-04-01

    Full Text Available Trying to make sense and gain deeper insight from large sets of data is becoming a task very central to computer science in general. Topic models, capable of uncovering the semantic themes pervading through large collections of documents, have seen a surge in popularity in recent years. However, topic models are high level statistical tools; their output is given in terms of probability distributions, suited neither for simple interpretation nor deep analysis. Interpreting the fitted topic models in an intuitive manner requires visual and interactive tools. Additionally, some measure of human interaction is typically required for refining the output offered by such models. In the research, this area remains relatively unexplored – only recently has this aspect been receiving more attention. In this paper, the literature is surveyed as it pertains to interactivity and visualisation within the context of topic models, with the goal of finding current research trends in this area.

  4. AP4 directly downregulates p16 and p21 to suppress senescence and mediate transformation

    OpenAIRE

    Jackstadt, R; Jung, P.; Hermeking, H

    2013-01-01

    Here we analyzed the function of the c-MYC-inducible basic helix–loop–helix leucine-zipper transcription factor AP4 in AP4-deficient mouse embryo fibroblasts (MEFs). Loss of AP4 resulted in premature senescence and resistance towards immortalization. Senescence was accompanied by induction of the cyclin-dependent kinase inhibitor-encoding genes p16, a known tumor suppressor, and p21, a previously described target for repression by AP4. Notably, AP4 directly repressed p16 expression via conser...

  5. Packaging design criteria, transfer and disposal of 102-AP mixer pump

    International Nuclear Information System (INIS)

    A mixer pump installed in storage tank 241-AP-102 (102-AP) has failed. This pump is referred to as the 102-AP mixer pump (APMP). The APMP will be removed from 102-AP 1 and a new pump will be installed. The main purpose of the Packaging Design Criteria (PDC) is to establish criteria necessary to design and fabricate a shipping container for the transfer and storage of the APMP from 102-AP. The PDC will be used as a guide to develop a Safety Evaluation for Packaging (SEP)

  6. Recent Advances In Topical Therapy In Dermatology

    OpenAIRE

    Mohan Thappa Devinder

    2003-01-01

    With changing times various newer topical agents are introduced in the field of dermatology. Tacrolimus and pimecrolimus are immunisuppressants, which are effective topically and are tried in the management of atopic dermatitis as well as other disorders including allergic contact dermatitis, atrophic lichen planus, pyoderma gangrenosum. Imiquimod, an immune response modifier, is presently in use for genital warts but has potentials as anti- tumour agent and in various other dermatological co...

  7. Topical calcineurin inhibitors in systemic lupus erythematosus

    OpenAIRE

    Lampropoulos, Christos

    2010-01-01

    Christos E Lampropoulos, David P D’CruzLupus Research Unit, Rayne Institute, St. Thomas’ Hospital, London, UKAbstract: Cutaneous lupus erythematosus (CLE) encompasses a variety of lesions that may be refractory to systemic or topical agents. Discoid lupus erythematosus (DLE) and subacute cutaneous lupus erythematosus (SCLE) are the most common lesions in clinical practice. The topical calcineurin inhibitors, tacrolimus and pimecrolimus, have been used to treat resistant cu...

  8. The rational design of topical formulations

    OpenAIRE

    Duszynska-Krupa, A. M.

    2015-01-01

    This thesis addresses the development of topical formulations designed to treat atopic dermatitis (AD) using nicotinamide (NA). A rational approach to the development of topical formulations based on the physical and chemical properties of the drug and vehicle components is studied. This approach is an alternative to the model of formulation development where the drug is added into an existing vehicle without optimisation of the formulation in terms of the active delivery to its site of actio...

  9. Formulation, pharmacokinetics and pharmacodynamics of topical microbicides

    OpenAIRE

    Adams, Jessica L.; Kashuba, Angela D. M.

    2012-01-01

    The development of safe topical microbicides that effectively prevent human immunodeficiency virus (HIV) infection is a major goal in curbing the human immunodeficiency virus pandemic. A number of past failures resulting from mucosal toxicity or lack of efficacy have informed the field. Products that caused toxicity to the female genital tract mucosa, and thereby increased the likelihood of HIV acquisition, included nonoxynol 9, cellulose sulfate, and C31 G vaginal gel Savvy®. Topical product...

  10. Topical and oral therapeutic approach to rosacea.

    Science.gov (United States)

    Helfrich, Yolanda R; Maier, Lisa M

    2016-06-01

    Rosacea is an inflammatory condition of the skin, primarily affecting the central convexities of the face. Various topical and oral therapeutic approaches exist. Most have been developed to treat the papulopustular subtype of rosacea; however, other approaches can be used to treat the erythematotelangiectatic, ocular, and phymatous subtypes. This review provides a summary of available topical and oral approaches for the treatment of rosacea. PMID:27416312

  11. Pharmacogenetics of ophthalmic topical β-blockers

    OpenAIRE

    Sidjanin, Duska J; Catherine A McCarty; Patchett, Richard; Smith, Edward; Wilke, Russell A

    2008-01-01

    Glaucoma is the second leading cause of blindness worldwide. The primary glaucoma risk factor is elevated intraocular pressure. Topical β-blockers are affordable and widely used to lower intraocular pressure. Genetic variability has been postulated to contribute to interpersonal differences in efficacy and safety of topical β-blockers. This review summarizes clinically significant polymorphisms that have been identified in the β-adrenergic receptors (ADRB1, ADRB2 and ADRB3). The implications ...

  12. NF-κB/AP-1-Targeted Inhibition of Macrophage-Mediated Inflammatory Responses by Depigmenting Compound AP736 Derived from Natural 1,3-Diphenylpropane Skeleton

    Directory of Open Access Journals (Sweden)

    Van Thai Ha

    2014-01-01

    Full Text Available AP736 was identified as an antimelanogenic drug that can be used for the prevention of melasma, freckles, and dark spots in skin by acting as a suppressor of melanin synthesis and tyrosinase expression. Since macrophage-mediated inflammatory responses are critical for skin health, here we investigated the potential anti-inflammatory activity of AP736. The effects of AP736 on various inflammatory events such as nitric oxide (NO/prostaglandin (PG E2 production, inflammatory gene expression, phagocytic uptake, and morphological changes were examined in RAW264.7 cells. AP736 was found to strongly inhibit the production of both NO and PGE2 in lipopolysaccharide- (LPS- treated RAW264.7 cells. In addition, AP736 strongly inhibited both LPS-induced morphological changes and FITC-dextran-induced phagocytic uptake. Furthermore, AP736 also downregulated the expression of multiple inflammatory genes, such as inducible NO synthase (iNOS, cyclooxygenase- (COX- 2, and interleukin- (IL- 1β in LPS-treated RAW264.7 cells. Transcription factor analysis, including upstream signalling events, revealed that both NF-κB and AP-1 were targeted by AP736 via inhibition of the IKK/IκBα and IRAK1/TAK1 pathways. Therefore, our results strongly suggest that AP736 is a potential anti-inflammatory drug due to its suppression of NF-κB-IKK/IκBα and AP-1-IRAK1/TAK1 signalling, which may make AP736 useful for the treatment of macrophage-mediated skin inflammation.

  13. Small Group Communication in the 1980's.

    Science.gov (United States)

    Neer, Michael R., Ed.

    1981-01-01

    This special edition of "Communication" brings together the work of nine leading scholars of small group communication. The following topics are discussed: (1) small group communication research in the 1980s; (2) unanswered questions in research on communication in the small group; (3) emerging trends in small group research; (4) structure in…

  14. Origin and nature of the aluminium phosphate-sulfate minerals (APS) associated with uranium mineralization in triassic red-beds (Iberian Range, Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Marfil, R.; Iglesia, A. la; Estupinan, J.

    2013-10-01

    This study focuses on the mineralogical and chemical study of an Aluminium-phosphate-sulphate (APS) mineralization that occurs in a classic sequence from the Triassic (Buntsandstein) of the Iberian Range. The deposit is constituted by sandstones, mud stones, and conglomerates with arenaceous matrix, which were deposited in fluvial to shallow-marine environments. In addition to APS minerals, the following diagenetic minerals are present in the classic sequence: quartz, K-feldspar, kaolinite group minerals, illite, Fe-oxides-hydroxides, carbonate-sulphate cement-replacements and secondary uraniferous minerals. APS minerals were identified and characterized by optical microscopy, X-ray diffraction, scanning electron microscopy, and electron microprobe. Microcrystalline APS crystals occur replacing uraniferous minerals, associated with kaolinite, mica and filling pores, in distal fluvial-to-tidal arkoses-subarkoses. Given their Ca, Sr, and Ba contents, the APS minerals can be defined as a solid solution of crandallite- goyacite-gorceixite (0.53 Ca, 0.46 Sr and 0.01 Ba). The chemical composition, low LREE concentration and Sr > S suggest that the APS mineral were originated during the supergene alteration of the Buntsandstein sandstones due to the presence of the mineralizing fluids which causes the development of Ubearing sandstones in a distal alteration area precipitating from partially dissolved and altered detrital minerals. Besides, the occurrence of dickite associated with APS minerals indicates they were precipitated at diagenetic temperatures (higher than 80 degree centigrade), related to the uplifting occurred during the late Cretaceous post-rift thermal stage.(Author)

  15. Topical calcineurin inhibitors in systemic lupus erythematosus

    Directory of Open Access Journals (Sweden)

    Christos E Lampropoulos

    2010-04-01

    Full Text Available Christos E Lampropoulos, David P D’CruzLupus Research Unit, Rayne Institute, St. Thomas’ Hospital, London, UKAbstract: Cutaneous lupus erythematosus (CLE encompasses a variety of lesions that may be refractory to systemic or topical agents. Discoid lupus erythematosus (DLE and subacute cutaneous lupus erythematosus (SCLE are the most common lesions in clinical practice. The topical calcineurin inhibitors, tacrolimus and pimecrolimus, have been used to treat resistant cutaneous lupus since 2002 and inhibit the proliferation and activation of T-cells and suppress immune-mediated cutaneous inflammation. This article reviews the mechanism of action, efficacy, adverse effects, and the recent concern about their possible carcinogenic effect. Although the total number of patients is small and there is only one relevant randomized controlled study, the data are encouraging. Many patients, previously resistant to systemic agents or topical steroids, improved after four weeks of treatment. DLE and SCLE lesions were less responsive, reflecting the chronicity of the lesions, although more than 50% of patients still showed improvement. Topical calcineurin inhibitors may be a safe and effective alternative to topical steroids for CLE although the only approved indication is for atopic dermatitis.Keywords: tacrolimus, pimecrolimus, cutaneous lupus erythematosus, topical calcineurin inhibitors

  16. Generic effluent monitoring system certification for AP-40 exhauster stack

    Energy Technology Data Exchange (ETDEWEB)

    Glissmeyer, J.A.; Davis, W.E.; Bussell, J.H.; Maughan, A.D.

    1997-09-01

    Tests were conducted to verify that the Generic Effluent Monitoring System (GEMS), as applied to the AP-40 exhauster stack, meets all applicable regulatory performance criteria for air sampling systems at nuclear facilities. These performance criteria address both the suitability of the air sampling probe location and the transport of the sample to the collection devices. The criteria covering air sampling probe location ensure that the contaminants in the stack are well mixed with the airflow at the probe location such that the extracted sample represents the whole. The sample transport criteria ensure that the sampled contaminants are quantitatively delivered to the collection device. The specific performance criteria are described in detail in the report. The tests demonstrated that the GEMS/AP-40 system meets all applicable performance criteria. The contaminant mixing tests were conducted by Pacific Northwest National Laboratory (PNNL) at the wind tunnel facility, 331-H Building, using a mockup of the actual stack. The particle sample transport tests were conducted by PNNL at the Numatec Hanford Company`s 305 Building. The AP-40 stack is typical of several 10-in. diameter stacks that discharge the filtered ventilation air from tank farms at the U.S. Department of Energy`s Hanford Site in Richland, Washington. The GEMS design features a probe with a single shrouded sampling nozzle, a sample delivery line, and sample collection system. The collection system includes a filter holder to collect the sample of record and an in-line detector head and filter for monitoring beta radiation-emitting particles. Unrelated to the performance criteria, it was found that the record sample filter holder exhibited symptoms of sample bypass around the particle collection filter. This filter holder should either be modified or replaced with a different type. 10 refs., 8 figs., 6 tabs.

  17. Westinghouse Passive Plants - AP600 and S PWR

    International Nuclear Information System (INIS)

    The original thought behind the AP600 passive design was that if the U. S. nuclear industry was to be revitalized, it would require a new, advanced technology with clearly proven benefits in safety. Response from the international arena indicates that, regardless of local domestic consideration, a revitalization of the U. S. industry is seen as very important, even essential, worldwide. And the potential for scale up of these passive safety features has been clearly established, allowing the benefits of the passive technology to be realized in countries that, for whatever reason, are interested in larger plant sizes only. Government projections indicate that U. S. energy demands in the 1990s will grow steadily, creating the need for approximately 117,000 to 322,000 MW of new generating capacity by the year 2010. Although this growth in electricity demand continues to be strong, orders for new nuclear power plants have not kept pace, in part due to licensing delays, prohibitive construction costs, and public uncertainty about safety. However, with the increased concerns about the environmental and economic security risks involved with an excessive dependence on fossil fuels, there is a growing realization that nuclear power must play a major role in our energy future. Looking to the future, Westinghouse is developing the AP600, a simplified two-loop PWR featuring passive safety systems. Drawing on the results of the AP600 development and testing programs, Westinghouse is also developing the larger S PWR, a passive, three-loop power plant with an output in the 900 to 1000 MW range

  18. Activities of the ESARDA Working Group on Integrated Safeguards

    International Nuclear Information System (INIS)

    Full text: ESARDA, the European Safeguards Research and Development Association, pursues as a main objective to assist the European safeguards community with advancing progress in safeguards and enhancing the efficiency of systems and measures. Key bodies of ESARDA are standing Working Groups dealing with various technical subjects. The ESARDA Working Group on Integrated Safeguards was created in 2000 with the objective to provide the Safeguards Community with expert advice on methodologies and approaches to integrate INFCIRC/153 and INFCIRC/540 measures and to present a forum for the exchange of information, views and experiences in that regard. Its members represent inspectorates, national authorities, operators and research centres active in the field of safeguards. The Working Group very soon realized that a first milestone on the road to Integrated Safeguards is the successful and functional implementation of the Additional Protocol. Discussions and activities concentrated on actions necessary to reach this end thereby taking into account the specific situation in European States. Among the topics discussed were issues of: - how to establish a functional site definition for different types of installations, ranging from small locations with very small amounts of nuclear material to complex installations with a complex history; - how to deal with different and even conflicting requirements in the context of unannounced inspections; and - how to interpret and handle the requirements for R and D declarations considering the needs and interests of all parties involved; etc. The IAEA participated in most of the meetings as an observer and provided the group with valuable background information on Additional Protocol questions and received in turn a deep insight into our considerations, motivations and concerns. This procedure contributed much to a better mutual understanding that is not least reflected in the revised draft of the AP implementation guidelines

  19. Molecular Basis for Enhancement of the Meiotic DMCI Recombinase by RAD51AP1

    Energy Technology Data Exchange (ETDEWEB)

    Dray, Eloise; Dunlop, Myun Hwa; Kauppi, Liisa; San Filippo, Joseph San; Wiese, Claudia; Tsai, Miaw-Sheue; Begovic, Sead; Schild, David; Jasin, Maria; Keeney, Scott; Sung, Patrick

    2010-11-05

    Homologous recombination is needed for meiotic chromosome segregation, genome maintenance, and tumor suppression. RAD51AP1 (RAD51 Associated Protein 1) has been shown to interact with and enhance the recombinase activity of RAD51. Accordingly, genetic ablation of RAD51AP1 leads to enhanced sensitivity to and also chromosome aberrations upon DNA damage, demonstrating a role for RAD51AP1 in mitotic homologous recombination. Here we show physical association of RAD51AP1 with the meiosis-specific recombinase DMC1 and a stimulatory effect of RAD51AP1 on the DMC1-mediated D-loop reaction. Mechanistic studies have revealed that RAD51AP1 enhances the ability of the DMC1 presynaptic filament to capture the duplex DNA partner and to assemble the synaptic complex, in which the recombining DNA strands are homologously aligned. We also provide evidence that functional co-operation is dependent on complex formation between DMC1 and RAD51AP1, and that distinct epitopes in RAD51AP1 mediate interactions with RAD51 and DMC1. Finally, we show that RAD51AP1 is expressed in mouse testes, and that RAD51AP1 foci co-localize with a subset of DMC1 foci in spermatocytes. These results suggest that RAD51AP1 also serves an important role in meiotic homologous recombination.

  20. Multiplicity among chemically peculiar stars II. Cool magnetic Ap stars

    OpenAIRE

    Carrier, F.; North, P.; Udry, S.; Babel, J.

    2002-01-01

    We present new orbits for sixteen Ap spectroscopic binaries, four of which might in fact be Am stars, and give their orbital elements. Four of them are SB2 systems: HD 5550, HD 22128, HD 56495 and HD 98088. The twelve other stars are : HD 9996, HD 12288, HD 40711, HD 54908, HD 65339, HD 73709, HD 105680, HD 138426, HD 184471, HD 188854, HD 200405 and HD 216533. Rough estimates of the individual masses of the components of HD 65339 (53 Cam) are given, combining our radial velocities with the r...

  1. Santiago Apóstol en la intimidad del santiaguero

    OpenAIRE

    Portuondo Zúñiga, Olga

    2010-01-01

    La relación entre el apóstol Santiago (el Mayor) y Santiago de Cuba remonta hasta el ya casi milenio de su fundación; y en el día de hoy, la ciudad está orgullosa de su nombre y de su patronazgo. La tradición engarza las cuentas de una historia común, sin que implique una plena identificación espiritual inicial, ni la inexistencia de escollos a salvar para que la comunidad asumiera como honra y nobleza su cualidad santiaguera.

  2. Initial diagnostics commissioning results for the APS injector subsystems

    Science.gov (United States)

    Lumpkin, A.; Chung, Y.; Kahana, E.; Patterson, D.; Sellyey, W.; Smith, T.; Wang, X.

    1995-05-01

    In recent months the first beams have been introduced into the various injector subsystems of the Advanced Photon Source (APS). An overview will be given of the diagnostics results on beam profiling, beam position monitors (BPMs), loss rate monitors (LRMs), current monitors (CMs), and photon monitors on the low energy transport lines, positron accumulator ring (PAR), and injector synchrotron (IS). Initial measurements have been done with electron beams at energies from 250 to 450 MeV and 50 to 400 pC per macrobunch. Operations in single turn and stored beam conditions were diagnosed in the PAR and IS.

  3. Operation of the APS photoinjector drive laser system.

    Energy Technology Data Exchange (ETDEWEB)

    Li, Y.; Accelerator Systems Division (APS)

    2008-08-04

    The APS photoinjector drive laser system has been in operation since 1999 and is achieving a performance level exceeding the requirement of stable operation of the LEUTL FEL system. One remarkable number is the UV energy stability of better than 2% rms, sometimes less than 1% rms. This report summarizes the operation experience of the laser system and the improvements made along the way. We also outline the route of upgrade of the system and some frontier laser research and development opportunities in ultrabright electron beam generation.

  4. Euphorbesulins A-P, Structurally Diverse Diterpenoids from Euphorbia esula.

    Science.gov (United States)

    Zhou, Bin; Wu, Yan; Dalal, Seema; Cassera, Maria B; Yue, Jian-Min

    2016-08-26

    Aqueous ethanol extracts of powdered twigs of Euphorbia esula afforded 16 new diterpenoids, named euphorbesulins A-P. These euphorbesulins included presegetane (1-3), jatrophane (4-14), paraliane (15), and isopimarane (16) diterpenoids as well as six known analogues. Compounds 1-3 represent a rare type of presegetane diterpenoid. Their structures were determined by analysis of the spectroscopic data, and the absolute configuration of 1 was established by X-ray crystallography. Diterpenoid 7 showed low nanomolar antimalarial activity, while the remaining compounds showed only moderate or no antimalarial activity. PMID:27447736

  5. Working group report: Astroparticle and neutrino physics

    Indian Academy of Sciences (India)

    Raj Gandhi; Subhendra Mohanty; Tarun Souradeep; S Agarwalla; K Bhattacharya; B Brahmachari; R Crittenden; S Goswami; P Ghoshal; M Lindner; H S Mani; S Mitra; S Pascoli; S Panda; R Rangarajan; S Ray; T Roy Choudhury; R Saha; S Sarkar; A Srivastava; R Sheth; S Uma Sankar; U Yajnik

    2006-10-01

    The working group on astroparticle and neutrino physics at WHEPP-9 covered a wide range of topics. The main topics were neutrino physics at INO, neutrino astronomy and recent constraints on dark energy coming from cosmological observations of large scale structure and CMB anisotropy.

  6. A Topic Model Approach to Representing and Classifying Football Plays

    KAUST Repository

    Varadarajan, Jagannadan

    2013-09-09

    We address the problem of modeling and classifying American Football offense teams’ plays in video, a challenging example of group activity analysis. Automatic play classification will allow coaches to infer patterns and tendencies of opponents more ef- ficiently, resulting in better strategy planning in a game. We define a football play as a unique combination of player trajectories. To this end, we develop a framework that uses player trajectories as inputs to MedLDA, a supervised topic model. The joint maximiza- tion of both likelihood and inter-class margins of MedLDA in learning the topics allows us to learn semantically meaningful play type templates, as well as, classify different play types with 70% average accuracy. Furthermore, this method is extended to analyze individual player roles in classifying each play type. We validate our method on a large dataset comprising 271 play clips from real-world football games, which will be made publicly available for future comparisons.

  7. Doing focus group research

    DEFF Research Database (Denmark)

    Lindegaard, Laura Bang

    2014-01-01

    interview data can be of some use if the distinction between natural and contrived data is given up and replaced with a distinction between interview data as topic or as resource. In greater detail, such scholars argue that interview data are perfectly adequate if the researcher wants to study the topic of......Scholars of ethnomethodologically informed discourse studies are often sceptical of the use of interview data such as focus group data. Some scholars quite simply reject interview data with reference to a general preference for so-called naturally occurring data. Other scholars acknowledge that...... interview interaction, but inadequate as data for studying phenomena that go beyond the phenomenon of interview interaction. Neither of these more and less sceptical positions are, on the face of it, surprising due to the ethnomethodological commitment to study social order as accomplished in situ, not as...

  8. TOPIC SENTENCE”: GETTING THE IDEA ACROSS ABOUT GETTING IDEAS ACROSS

    Institute of Scientific and Technical Information of China (English)

    NiuRuiying

    2004-01-01

    This paper reports on an experimental study of the acquisition of topic sentence by Chinese learners of English. In the preliminary experiment, on the basis of formal instruction theory and noticing theory, we isolated two types of teaching practice: formal instruction and pushed output. Then we carried out different teaching practices on two groups of subjects respectively, taking the third group of subjects as the control group. However, contrary to our expectation, the results indicated that the acquisition of topic sentence does not have much to do with different teaching practices, but depends on learners'cof using topic sentence, as was corroborated in the following further experiment. In the further experiment, the subjects were required to write two compositions. For composition 1, the use of topic sentence was not required ; for composition 2, the use of topic sentence was clearly demanded. The results showed a considerable increase in topic sentences in composition 2, implying that the acquisition of topic sentence is closely related with learners' consciousness of use, and teachers' clear instruction can raise learners'consciousness.

  9. Origin and nature of the aluminium phosphate-sulfate minerals (APS associated with uranium mineralization in triassic red-beds (Iberian Range, Spain

    Directory of Open Access Journals (Sweden)

    Marfil, R.

    2013-06-01

    Full Text Available This study focuses on the mineralogical and chemical study of an Aluminium–phosphate–sulphate (APS mineralization that occurs in a clastic sequence from the Triassic (Buntsandstein of the Iberian Range. The deposit is constituted by sandstones, mudstones, and conglomerates with arenaceous matrix, which were deposited in fluvial to shallow-marine environments. In addition to APS minerals, the following diagenetic minerals are present in the clastic sequence: quartz, K-feldspar, kaolinite group minerals, illite, Fe-oxides-hidroxides, carbonate-sulphate cement-replacements and secondary uraniferous minerals. APS minerals were identified and characterized by optical microscopy, X-ray diffraction, scanning electron microscopy, and electron microprobe. Microcrystalline APS crystals occur replacing uraniferous minerals, associated with kaolinite, mica and filling pores, in distal fluvial-to-tidal arkoses-subarkoses. Given their Ca, Sr, and Ba contents, the APS minerals can be defined as a solid solution of crandallite-goyacite-gorceixite (0.53 Ca, 0.46 Sr and 0.01 Ba. The chemical composition, low LREE concentration and Sr > S suggest that the APS mineral were originated during the supergene alteration of the Buntsandstein sandstones due to the presence of the mineralizing fluids which causes the development of U-bearing sandstones in a distal alteration area precipitating from partially dissolved and altered detrital minerals. Besides, the occurrence of dickite associated with APS minerals indicates they were precipitated at diagenetic temperatures (higher than 80ºC, related to the uplifting occurred during the late Cretaceous post-rift thermal stage.Este trabajo se centra en el estudio de los minerales fosfato-sulfato alumínicos (APS que se producenen una secuencia clástica del Triásico (Buntsandstein de la Cordillera Ibérica. El depósito está constituido por areniscas, lutitas y conglomerados con matriz arenosa, que fueron depositados en

  10. Constitutive Expression of Sense & Antisense PtAP3, an AP3 Homologue Gene of Populus tomentosa, Affects Growth and Flowering Time in Transgenic Tobacco

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    To analyze the function of PtAP3, an APETALA3 (AP3) homologue gene isolated from Populus tomentosa Carr., the full length sequence (1 797 bp) and a fragment (870 bp) of PtAP3 were fused to a CaMV 35S promoter of pBI121 to generate the sense and antisense constructs of PtAP3. These constructs were transformed into tobacco by Agrobacterium infection of leaf disks and selection on kanamycin medium. Some sense and antisense transgenic tobacco plants were obtained by PCR and Southern blot analysis. Great phenotypic differences in transgenic tobacco plants were observed. Almost all of sense PtAP3 to transgenic tobaccos showed a higher growth rate than those of antisense transformants and a few developed pregnancy earlier than wild type seedlings and antisense transformants under the same conditions.

  11. A Survey of Topic Modeling in Text Mining

    Directory of Open Access Journals (Sweden)

    Rubayyi Alghamdi

    2015-01-01

    Full Text Available Topic models provide a convenient way to analyze large of unclassified text. A topic contains a cluster of words that frequently occur together. A topic modeling can connect words with similar meanings and distinguish between uses of words with multiple meanings. This paper provides two categories that can be under the field of topic modeling. First one discusses the area of methods of topic modeling, which has four methods that can be considerable under this category. These methods are Latent semantic analysis (LSA, Probabilistic latent semantic analysis (PLSA, Latent Dirichlet allocation (LDA, and Correlated topic model (CTM. The second category is called topic evolution models, which model topics by considering an important factor time. In the second category, different models are discussed, such as topic over time (TOT, dynamic topic models (DTM, multiscale topic tomography, dynamic topic correlation detection, detecting topic evolution in scientific literature, etc.

  12. Circuit description of unipolar DC-to-DC converters for APS storage ring quadrupoles and sextupoles

    International Nuclear Information System (INIS)

    This paper describes the control, interlock, and power circuits for 680 unipolar switch mode DC-to-DC converters used to regulate the Advanced Photon Sources (APS's) storage ring quadrupole and sextupole magnet currents. Quadrupole current stability is ± 6x10-5 and the sextupole current stability is ±3x10-4. The stability is obtained with pulse width modulation, operating at a switching frequency of 20kHz with full current switching. The converters are housed in 200 cabinets located on top of the storage ring tunnel. Raw DC power is distributed from 80 AC-to-DC power supplies, four at each of 20 locations around the storage ring. Voltages, currents, and temperatures are computer monitored and logged for the converters and magnets. All converters and magnets are water cooled with the flow and pressure monitored at the inlet and outlet of groups. Water is interlocked with the raw power supplies and not the individual converters

  13. Osmium (VI) complexes of the 3', 5'-dinucleoside monophosphates, ApU and UpA.

    Science.gov (United States)

    Daniel, F B; Behrman, E J

    1976-02-10

    The dinucleoside monophosphates, ApU and UpA, react with potassium osmate (VI) and 2,2'-bipyridyl to form the corresponding oxo-osmium (VI) bipyridyl sugar ester in which the osmate group is bonded to the terminal 2',3'-glycol. Osmium (VIII) tetroxide and 2,2'-bipyridyl react with the dinucleosides to form the corresponding oxo-osmium (VI) bipyridyl heterocyclic esters which result from addition of the tetroxide to the 5,6-double bond of the uracil residue. Although capable of transesterification reactions, these heterocyclic esters are exceptionally stable toward exchange reactions in solution. No apparent exchange was observed after 1 month. This reaction thus seems promising for single-site osmium labeling in polynucleotides.

  14. The new AP Physics exams: Integrating qualitative and quantitative reasoning

    Science.gov (United States)

    Elby, Andrew

    2015-04-01

    When physics instructors and education researchers emphasize the importance of integrating qualitative and quantitative reasoning in problem solving, they usually mean using those types of reasoning serially and separately: first students should analyze the physical situation qualitatively/conceptually to figure out the relevant equations, then they should process those equations quantitatively to generate a solution, and finally they should use qualitative reasoning to check that answer for plausibility (Heller, Keith, & Anderson, 1992). The new AP Physics 1 and 2 exams will, of course, reward this approach to problem solving. But one kind of free response question will demand and reward a further integration of qualitative and quantitative reasoning, namely mathematical modeling and sense-making--inventing new equations to capture a physical situation and focusing on proportionalities, inverse proportionalities, and other functional relations to infer what the equation ``says'' about the physical world. In this talk, I discuss examples of these qualitative-quantitative translation questions, highlighting how they differ from both standard quantitative and standard qualitative questions. I then discuss the kinds of modeling activities that can help AP and college students develop these skills and habits of mind.

  15. Containment integrity analysis for the (W) advanced AP900

    International Nuclear Information System (INIS)

    The consequences of accidents that occurred at Three Mile Island and Chernobyl and the lack of interest from utilities in committing to high powered, high maintenance light water reactor designs of the past have motivated the nuclear industry to develop smaller, lower powered, simplified designs. Simplified designs must employ more passive systems that require very low maintenance and rely on the basic laws of nature. These designs must not be limited only to the reactor, but must also include the containment building. The purpose of this paper is to discuss the design concepts and to verify the feasibility of the Westinghouse Passive Containment Cooling System (PCCS) design for a 900 MWe advanced passive reactor design (AP900) by presenting its response to a design basis large break Loss of Coolant Accident (LOCA). The mass and energy releases emanating from the design basis break were developed and a representative containment model was constructed. The COMPACT computer code, which is a multi-node program that solves the complete set of mass, energy and momentum equations, was used to determine the AP900 containment response. The PCCS design concept, the computer model, the analysis inputs, and the results of the study are discussed within this paper. (author). 2 refs., 9 figs

  16. Abnormal lithium abundance in several Ap-Bp stars

    CERN Document Server

    Shavrina, A; Drake, N A; Kudryavtsev, D O; Gopka, V F; Yushchenko, V A; Yushchenko, A V

    2013-01-01

    Using observations of rapidly rotating roAp star HD 12098, obtained with 6m telescope of SAO RAS in 2005-2008 in nine rotational phases (0.001-0.817), and code V. Tsymbal ROTATE we identified 3 lithium spots on the surface of star, one of them coincided with the position of one magnetic pole and two others are located near the other pole, symmetrically with respect to it. Perhaps magnetic field of the star has a more complex structure than the dipole (Shavrina 2008). Lithium abundance in the spots is greater than cosmic one. It can be explained by diffusion of lithium in the presence of a magnetic field or by production of lithium in the reactions of "spallation" on the surface of star near the magnetic poles (see, for example, Goriely 2007). Enhanced lithium abundances was also determined for other two slowly rotating Ap stars HR 465 and HD 965. The analysis is performed using a synthetic spectrum method taking into account magnetic splitting of lines by the SYNTHM code of Khan (2004).

  17. "Draw My Topics": Find Desired Topics fast from large scale of Corpus

    OpenAIRE

    Dou, Jason; Sun, Ni; Zou, Xiaojun

    2016-01-01

    We develop the "Draw My Topics" toolkit, which provides a fast way to incorporate social scientists' interest into standard topic modelling. Instead of using raw corpus with primitive processing as input, an algorithm based on Vector Space Model and Conditional Entropy are used to connect social scientists' willingness and unsupervised topic models' output. Space for users' adjustment on specific corpus of their interest is also accommodated. We demonstrate the toolkit's use on the Diachronic...

  18. Prevalence and Risk Factors of Hypertension in Adults in an Urban Slum, Tirupati, A.P.

    Directory of Open Access Journals (Sweden)

    Reddy S

    2005-01-01

    Full Text Available Research question : What is the prevalence of hypertension and its risk factors among adults aged 20-60 years residing years residing in an urban slum area of Tirupati town, A.P.? Objective : To study the prevalence of hypertension and its risk factors as well as its extent of diagnosis and management among adults aged 20-60 years residing in an urban slum area of Tirupati. Study design : Cross sectional. Study setting : Channa Reddy Colony (Urban slum area in Tirupati town, A.P. Study subjects : 1000 adults in the age group of 20-60 years (Males-500; Females-500 residing in an urban slum area of Tirupati town, A.P. Study variables : Age, sex, occupation, family history of hypertension, history of cerebrovascular/cardiovascular events, diabetes mellitus, saturated fat intake, intake of excess salt, smoking, alcohol intake and regular physical exercise. Outcome Variables : Number of hypertensives and mean blood pressure level estimations. Statistical analysis : Proportions, Chi--square tests, ′F′ ratios, ′t′ tests, Odds ratios and 95% confidence intervals. Results : The overall prevalence of hypertension was found to be 8.6%. Out of the 86 hypertensives, 72 (83.7% were aware of their hypertension; all of those aware were under treatment; among the treated, only 30 (41.7% had satisfactory control of their hypertension. Higher prevalence of hypertension was found with history of cerbrovascular/cardiovascular events (50.0%, diabetes mellitus (33.3%, family history of hypertension (23.3%, smoking (22.4%, age more than 50 years (22.2%, alcohol intake (20.0%, lack of physical exercise (15.8%, B.M.I.>25 (14.9%, male sex (9.6, non-vegetarian diet (8.8% and saturated fat intake (8.8%. The mean systolic as well as diastolic blood pressures were found to be higher among men, higher age groups, and in business occupation of the respondents. Conclusions : Despite treatment, most of the hypertensives had not achieved satisfactory control of blood

  19. Progresses on plant AP2/ERF transcription factors%植物AP2/ERF 类转录因子研究进展

    Institute of Scientific and Technical Information of China (English)

    张计育; 王庆菊; 郭忠仁

    2012-01-01

    植物AP2/ERF 是一个庞大的转录因子基因家族,含有由60~70 个氨基酸组成的AP2/ERF 结构域而得名,存在于所有的植物中.AP2/ERF 转录因子参与多种生物学过程,包括植物生长、花发育、果实发育、种子发育、损伤、病菌防御、高盐、干旱等环境胁迫响应等.AP2/ERF 类转录因子参与水杨酸、茉莉酸、乙烯、脱落酸等多种信号转导途径,而且是逆境信号交叉途径中的连接因子.文章对国内外近年来有关植物AP2/ERF 类转录因子的分类、生物学功能、基因调控等方面的研究进行了综述.%Plant AP2/ERF transcription factor with AP2/ERF domain containing 60-70 amino acids is a huge gene family present in all plant. AP2/ERF transcriptional factors are involved in various biological functions such as plant development, flower development, fruit and seed maturation, wounding, pathogen defense, high salty, drought, and so on. AP2/ERF transcription factor are involved in salicylic acid, jasmonic acid, ethylene, abscisic acid signal transduction pathways and among them. The transcription factors are cross-talk factor in stress signal pathway. This paper summarizes the most advanced researches on types, biological functions, and gene regulations of plant AP2/ERF transcription factors.

  20. RAD51AP2, a novel vertebrate- and meiotic-specific protein, sharesa conserved RAD51-interacting C-terminal domain with RAD51AP1/PIR51

    Energy Technology Data Exchange (ETDEWEB)

    Kovalenko, Oleg V.; Wiese, Claudia; Schild, David

    2006-07-25

    Many interacting proteins regulate and/or assist the activities of RAD51, a recombinase which plays a critical role in both DNA repair and meiotic recombination. Yeast two-hybrid screening of a human testis cDNA library revealed a new protein, RAD51AP2 (RAD51 Associated Protein 2), that interacts strongly with RAD51. A full-length cDNA clone predicts a novel vertebrate specific protein of 1159 residues, and the RAD51AP2 transcript was observed only in meiotic tissue (i.e. adult testis and fetal ovary), suggesting a meiotic-specific function for RAD51AP2. In HEK293 cells the interaction of RAD51 with an ectopically-expressed recombinant large fragment of RAD51AP2 requires the C-terminal 57 residues of RAD51AP2. This RAD51-binding region shows 81% homology to the C-terminus of RAD51AP1/PIR51, an otherwise totally unrelated RAD51-binding partner that is ubiquitously expressed. Analyses using truncations and point mutations in both RAD51AP1 and RAD51AP2 demonstrate that these proteins use the same structural motif for RAD51 binding. RAD54 shares some homology with this RAD51-binding motif, but this homologous region plays only an accessory role to the adjacent main RAD51-interacting region, which has been narrowed here to 40 amino acids. A novel protein, RAD51AP2, has been discovered that interacts with RAD51 through a C-terminal motif also present in RAD51AP1.

  1. UVB exposure enhanced benzanthrone-induced inflammatory responses in SKH-1 mouse skin by activating the expression of COX-2 and iNOS through MAP kinases/NF-κB/AP-1 signalling pathways.

    Science.gov (United States)

    Abbas, Sabiya; Alam, Shamshad; Pal, Anu; Kumar, Mahadeo; Singh, Dhirendra; Ansari, Kausar Mahmood

    2016-10-01

    This study was conducted to explore the role of UVB on benzanthrone (BA)-induced skin inflammation and its mechanism/s. SKH-1 hairless mice were topically exposed with BA (25 and 50 mg/kg b.wt) either alone or along with UVB (50 mJ/cm(2)) for 24 h and estimation of ROS, histopathological analysis, myeloperoxidase (MPO) activity, mast cell staining, immunohistochemistry for COX-2 and iNOS as well as western blotting for MAPKs, p-NF-κB, c-jun, c-fos COX-2 and iNOS were carried out. Enhanced ROS generation, increased epidermal thickness, mast cell number, MPO activity, enhanced expression of COX-2 and iNOS, MAPKs, c-jun, c-fos, NF-κB were found in BA either alone or when followed by UVB treatment, compared to the control groups. Expression of COX-2, iNOS and phosphorylation of ERK1/2 were found to be more enhanced in BA and UVB- exposed group compared to BA and UVB only group, while phosphorylation of JNK1/2, p38, NF-κB and expression of c-jun and c-fos were comparable with BA and UVB only groups. In summary, we suggest that UVB exposure enhanced BA-induced SKH-1 skin inflammation possibly via oxidative stress-mediated activation of MAPKs-NF-κB/AP-1 signalling, which subsequently increased the expression of COX-2 and iNOS and led to inflammation in SKH-1 mouse skin.

  2. Analyses of Research Topics in the Field of Informetrics Based on the Method of Topic Modeling

    Directory of Open Access Journals (Sweden)

    Sung-Chien Lin

    2014-07-01

    Full Text Available In this study, we used the approach of topic modeling to uncover the possible structure of research topics in the field of Informetrics, to explore the distribution of the topics over years, and to compare the core journals. In order to infer the structure of the topics in the field, the data of the papers published in the Journal of Informetricsand Scientometrics during 2007 to 2013 are retrieved from the database of the Web of Science as input of the approach of topic modeling. The results of this study show that when the number of topics was set to 10, the topic model has the smallest perplexity. Although data scopes and analysis methodsare different to previous studies, the generating topics of this study are consistent with those results produced by analyses of experts. Empirical case studies and measurements of bibliometric indicators were concerned important in every year during the whole analytic period, and the field was increasing stability. Both the two core journals broadly paid more attention to all of the topics in the field of Informetrics. The Journal of Informetricsput particular emphasis on construction and applications ofbibliometric indicators and Scientometrics focused on the evaluation and the factors of productivity of countries, institutions, domains, and journals.

  3. Nanoparticles - A paradigm for topical drug delivery

    Directory of Open Access Journals (Sweden)

    Yogesh S Chaudhari

    2012-01-01

    Full Text Available Topical drug delivery is still a challenge due to the difficulties in controlling the active pharmaceutical ingredient (API fate within the skin. Due to the safety of the component material and controlled release abilities, nanoparticles offer an excellent opportunity for the rational delivery of drugs to the desired target site and hence these carrier systems are effectively used for topical delivery of variety of active principles for both pharmaceutical as well as cosmetic purposes. Recently, solid lipid nanoparticles (SLNs have shown a great potential as carriers for topical administration of active substances, principally owing to the possible targeting effect and controlled release in different skin strata. Also, nanostructured lipid carriers (NLCs are a new type of topical delivery system offering improved performance in terms of drug loading and long-term stability with the ability to form highly concentrated dispersions. Another invention in the field of topical drug delivery is the use of micellar nanoparticles (MNPs that offer a potentially fast and inexpensive pharmaceutical development model by using drugs already proven safe and effective to create new proprietary formulations. These novel drug delivery systems have gained much interest as they combine both the technology of lipid sciences and nanosciences, and hence may be better alternative carriers.

  4. Treatment of phimosis with topical steroids and foreskin anatomy

    Directory of Open Access Journals (Sweden)

    Tatiana C. Marques

    2005-08-01

    Full Text Available OBJECTIVES: To correlate topical steroidal treatment of stenosed foreskin with the different degrees of glans exposure and the length of time the ointment is applied. MATERIALS AND METHODS: We studied 95 patients with phimosis, divided according to the degree of foreskin retraction. Group A presented no foreskin retraction, group B presented exposure of only the urethral meatus, group C presented exposure of half of the glans, and group D presented exposure of the glans, which was incomplete because of preputial adherences to the coronal sulcus. Patients were submitted to application of 0.05% betamethasone ointment on the distal aspect of the prepuce twice daily for a minimum of 30 days and a maximum of 4 months. RESULTS: Of 95 patients, 10 (10.52% abandoned the treatment and 15 patients in groups C and D were excluded from the study. Among the remaining 70 patients, only 4 patients (5.7% in group A did not obtain adequate glans exposure after treatment. In group A (38 patients, fully retractable foreskins were obtained in 19 patients (50% after 1 month of treatment. In group B (28 patients, fully retractable foreskins were obtained in 18 patients (64.2% after 1 month. CONCLUSIONS: Treatment was successful in 94.2% of patients, irrespective of the type of foreskin anatomy. The improvement may require several months of treatment. Patients with impossibility of urethral meatus exposure present around 10% treatment failure.

  5. Induction of neural crest in Xenopus by transcription factor AP2alpha.

    Science.gov (United States)

    Luo, Ting; Lee, Young-Hoon; Saint-Jeannet, Jean-Pierre; Sargent, Thomas D

    2003-01-21

    We report experiments with Xenopus laevis, using both intact embryos and ectodermal explants, showing that the transcription factor AP2alpha is positively regulated by bone morphogenetic protein (BMP) and Wnt signaling, and that this activation is an essential step in the induction of neural crest (NC). Ectopic expression of AP2alpha is sufficient to activate high-level expression of NC-specific genes such as Slug and Sox9, which can occur as isolated domains within the neural plate as well as by expansion of endogenous NC territories. AP2alpha also has the property of inducing NC in isolated ectoderm in which Wnt signaling is provided but BMP signaling is minimized by overexpression of chordin. Like other NC regulatory factors, activation of AP2alpha requires some attenuation of endogenous BMP signaling; however, this process occurs at a lower threshold for AP2alpha. Furthermore, AP2alpha expression domains are larger than for other NC factors. Loss-of-function experiments with antisense AP2alpha morpholino oligonucleotides result in severe reduction in the NC territory. These results support a central role for AP2alpha in NC induction. We propose a model in which AP2alpha expression, along with inactivation of NC inhibitory factors such as Dlx3, establish a feedback loop comprising AP2alpha, Sox9, and Slug, leading to and maintaining NC specification. PMID:12511599

  6. Risk Analysis Group annual progress report 1984

    International Nuclear Information System (INIS)

    The activities of the Risk Analysis Group at Risoe during 1984 are presented. These include descriptions in some detail of work on general development topics and risk analysis performed as contractor. (author)

  7. Lecture Notes on Topics in Accelerator Physics

    International Nuclear Information System (INIS)

    These are lecture notes that cover a selection of topics, some of them under current research, in accelerator physics. I try to derive the results from first principles, although the students are assumed to have an introductory knowledge of the basics. The topics covered are: (1) Panofsky-Wenzel and Planar Wake Theorems; (2) Echo Effect; (3) Crystalline Beam; (4) Fast Ion Instability; (5) Lawson-Woodward Theorem and Laser Acceleration in Free Space; (6) Spin Dynamics and Siberian Snakes; (7) Symplectic Approximation of Maps; (8) Truncated Power Series Algebra; and (9) Lie Algebra Technique for nonlinear Dynamics. The purpose of these lectures is not to elaborate, but to prepare the students so that they can do their own research. Each topic can be read independently of the others

  8. Getting Started with Topic Modeling and MALLET

    Directory of Open Access Journals (Sweden)

    Shawn Graham

    2016-05-01

    Full Text Available In this lesson you will first learn what topic modeling is and why you might want to employ it in your research. You will then learn how to install and work with the MALLET natural language processing toolkit to do so. MALLET involves modifying an environment variable (essentially, setting up a short-cut so that your computer always knows where to find the MALLET program and working with the command line (ie, by typing in commands manually, rather than clicking on icons or menus. We will run the topic modeller on some example files, and look at the kinds of outputs that MALLET installed. This will give us a good idea of how it can be used on a corpus of texts to identify topics found in the documents without reading them individually.

  9. Learning Topic Models by Belief Propagation

    CERN Document Server

    Zeng, Jia; Liu, Jiming

    2011-01-01

    Latent Dirichlet allocation (LDA) is an important class of hierarchical Bayesian models for probabilistic topic modeling, which attracts worldwide interests and touches many important applications in text mining, computer vision and computational biology. This paper proposes a novel tree-structured factor graph representation for LDA within the Markov random field (MRF) framework, which enables the classic belief propagation (BP) algorithm for exact inference and parameter estimation. Although two commonly-used approximation inference methods, such as variational Bayes (VB) and collapsed Gibbs sampling (GS), have gained great successes in learning LDA, the proposed BP is competitive in both speed and accuracy validated by encouraging experimental results on four large-scale document data sets. Furthermore, the BP algorithm has the potential to become a generic learning scheme for variants of LDA-based topic models. To this end, we show how to learn two typical variants of LDA-based topic models, such as autho...

  10. Lecture Notes on Topics in Accelerator Physics

    CERN Document Server

    Chao, A W

    2002-01-01

    These are lecture notes that cover a selection of topics, some of them under current research, in accelerator physics. I try to derive the results from first principles, although the students are assumed to have an introductory knowledge of the basics. The topics covered are: (1) Panofsky-Wenzel and Planar Wake Theorems; (2) Echo Effect; (3) Crystalline Beam; (4) Fast Ion Instability; (5) Lawson-Woodward Theorem and Laser Acceleration in Free Space; (6) Spin Dynamics and Siberian Snakes; (7) Symplectic Approximation of Maps; (8) Truncated Power Series Algebra; and (9) Lie Algebra Technique for nonlinear Dynamics. The purpose of these lectures is not to elaborate, but to prepare the students so that they can do their own research. Each topic can be read independently of the others.

  11. Instructions to working groups

    Science.gov (United States)

    Foushee, H. Clayton

    1987-01-01

    The key to the success of this workshop is your active participation in the working group process. The goals of this workshop are to address four major questions regarding Cockpit Resource Management (CRM) Training. To some extent the working group topic areas parallel these issues, but in some cases they do not. However, it is important for all of the working groups to keep these general questions in mind during their deliberations: (1) What are the essential elements of an optimal CRM Training program; (2) What are the strengths and weaknesses of current approaches to CRM Training; (3) How can CRM Training best be implemented, and what barriers exist; and (4) Is CRM Training effective, do we know, and if not, how can we find out.

  12. Topical and peripheral ketamine as an analgesic.

    Science.gov (United States)

    Sawynok, Jana

    2014-07-01

    Ketamine, in subanesthetic doses, produces systemic analgesia in chronic pain settings, an action largely attributed to block of N-methyl-D-aspartate receptors in the spinal cord and inhibition of central sensitization processes. N-methyl-D-aspartate receptors also are located peripherally on sensory afferent nerve endings, and this provided the initial impetus for exploring peripheral applications of ketamine. Ketamine also produces several other pharmacological actions (block of ion channels and receptors, modulation of transporters, anti-inflammatory effects), and while these may require higher concentrations, after topical (e.g., as gels, creams) and peripheral application (e.g., localized injections), local tissue concentrations are higher than those after systemic administration and can engage lower affinity mechanisms. Peripheral administration of ketamine by localized injection produced some alterations in sensory thresholds in experimental trials in volunteers and in complex regional pain syndrome subjects in experimental settings, but many variables were unaltered. There are several case reports of analgesia after topical application of ketamine given alone in neuropathic pain, but controlled trials have not confirmed such effects. A combination of topical ketamine with several other agents produced pain relief in case, and case series, reports with response rates of 40% to 75% in retrospective analyses. In controlled trials of neuropathic pain with topical ketamine combinations, there were improvements in some outcomes, but optimal dosing and drug combinations were not clear. Given orally (as a gargle, throat swab, localized peritonsillar injections), ketamine produced significant oral/throat analgesia in controlled trials in postoperative settings. Topical analgesics are likely more effective in particular conditions (patient factors, disease factors), and future trials of topical ketamine should include a consideration of factors that could predispose

  13. Group X

    Energy Technology Data Exchange (ETDEWEB)

    Fields, Susannah

    2007-08-16

    This project is currently under contract for research through the Department of Homeland Security until 2011. The group I was responsible for studying has to remain confidential so as not to affect the current project. All dates, reference links and authors, and other distinguishing characteristics of the original group have been removed from this report. All references to the name of this group or the individual splinter groups has been changed to 'Group X'. I have been collecting texts from a variety of sources intended for the use of recruiting and radicalizing members for Group X splinter groups for the purpose of researching the motivation and intent of leaders of those groups and their influence over the likelihood of group radicalization. This work included visiting many Group X websites to find information on splinter group leaders and finding their statements to new and old members. This proved difficult because the splinter groups of Group X are united in beliefs, but differ in public opinion. They are eager to tear each other down, prove their superiority, and yet remain anonymous. After a few weeks of intense searching, a list of eight recruiting texts and eight radicalizing texts from a variety of Group X leaders were compiled.

  14. Off-highway vehicle technology roadmap.; TOPICAL

    International Nuclear Information System (INIS)

    The off-highway sector is under increasing pressure to reduce operating costs (including fuel costs) and to reduce emissions. Recognizing this, the Society of Automotive Engineers and the U.S. Department of Energy (DOE) convened a workshop in April 2001 (ANL 2001) to (1) determine the interest of the off-highway sector (consisting of agriculture, construction, surface mining, inland marine) in crafting a shared vision of off-highway, heavy machines of the future and (2) identify critical research and development (R and D) needs for minimizing off-highway vehicle emissions while cost-effectively maintaining or enhancing system performance. The workshop also enabled government and industry participants to exchange information. During the workshop, it became clear that the challenges facing the heavy, surface-based off-highway sector can be addressed in three major machine categories: (1) engine/aftertreatment and fuels/lubes, (2) machine systems, and (3) thermal management. Working groups convened to address these topical areas. The status of off-highway technologies was determined, critical technical barriers to achieving future emission standards were identified, and strategies and technologies for reducing fuel consumption were discussed. Priority areas for R and D were identified. Given the apparent success of the discussions at the workshop, several participants from industry agreed to help in the formation of a joint industry/government ''roadmap'' team. The U.S. Department of Energy's Office of Heavy Vehicle Technologies has an extensive role in researching ways to make heavy-duty trucks and trains more efficient, with respect to both fuel usage and air emissions. The workshop participants felt that a joint industry/government research program that addresses the unique needs of the off-highway sector would complement the current research program for highway vehicles. With industry expertise, in-kind contributions, and federal government funding (coupled with

  15. Effect of topical application of terbinafine on fungal keratitis

    Institute of Scientific and Technical Information of China (English)

    LIANG Qing-feng; JIN Xiu-ying; WANG Xiang-lan; SUN Xu-guang

    2009-01-01

    Background Fungal keratitis is a rare but serious corneal disease that may result in loss of vision.The poor prognosis might be due to limited treatment option.This study aimed to evaluate the clinical efficacy of 0.25% terbinafine eye drops comparing with 5% natamycin suspension on fungal keratitis.Methods A retrospective clinical trial was performed on 90 patients presenting with direct smear and/or culture positive fungal keratitis at Beijing Tongren Hospital,Beijing,China from January 2006 to May 2008.Corneal ulcers were categorized as mild or severe.Forty-five patients were treated with topical terbinafine and the next 45 cases received topical natamycin hourly.Results Filamentous fungi were found in corneal scrapings among all 90 cases.Fungal cultures were positive in 64 patients (71%).Species of Fusarium and Aspergillus were the principal isolates.Forty (89%) patients showed favorable response to terbinafine,while forty-two (93%) patients exhibited favorable response to natamycin (P >0.05).The mean course of treatment was significantly showed in the terbinafine treatment group than natamycin group ((26.5±11.2) days versus (19.3±6.4) days;P <0.05).In terbinafine group,twenty patients with ulcers smaller than 4 mm had favorable outcome,while 20 of 25 patients with ulcers more than 4 mm in diameter had favorable response (P <0.05).Twenty-seven patients with depth of infiltration less than half of stroma thickness had favorable response to terbinafine,while 13 of 18 patients with depth of infiltration more than half of stroma responded to terbinafine.This difference was statistically significant (P<0.05).Conclusions Our findings suggest that topical terbinafine is an effective antifungal drug for the management of filamentous mycotic keratitis,particularly in cases with smaller and shallower ulcers.Its mean duration of treatment was longer than natamycin.

  16. Illustrative EDOF topics in Fourier optics

    Science.gov (United States)

    George, Nicholas; Chen, Xi; Chi, Wanli

    2011-10-01

    In this talk we present a series of illustrative topics in Fourier Optics that are proving valuable in the design of EDOF camera systems. They are at the level of final examination problems that have been made solvable by a student or professoi having studied from one of Joseph W. Goodman's books---our tribute for his 75fr year. As time permits, four illustrative topics are l) Electromagnetic waves and Fourier optics;2) The perfect lens; 3) Connection between phase delay and radially varying focal length in an asphere and 4) tailored EDOF designs.

  17. Selected topics on Hadrons in Nuclei

    CERN Document Server

    Oset, E; Hernandez, E; Ramos, A; Magas, V K; Yamagata-Sekihara, J; Hirenzaki, S; Gamermann, D; Molina, R; Tolos, L; Roca, L

    2011-01-01

    In this talk we report on selected topics on hadrons in nuclei. The first topic is the renormalization of the width of the $\\Lambda(1520)$ in a nuclear medium. This is followed by a short update of the situation of the $\\omega$ in the medium. The investigation of the properties of $\\bar{K}$ in the nuclear medium from the study of the $(K_{flight},p)$ reaction is also addressed, as well as properties of X,Y,Z charmed and hidden charm resonances in a nuclear medium. Finally we address the novel issue of multimeson states.

  18. Topics in current aerosol research (part2)

    CERN Document Server

    Hidy, G M

    1972-01-01

    Topics in Current Aerosol Research, Part 2 contains some selected articles in the field of aerosol study. The chosen topics deal extensively with the theory of diffusiophoresis and thermophoresis. Also covered in the book is the mathematical treatment of integrodifferential equations originating from the theory of aerosol coagulation. The book is the third volume of the series entitled International Reviews in Aerosol Physics and Chemistry. The text offers significant understanding of the methods employed to develop a theory for thermophoretic and diffusiophoretic forces acting on spheres in t

  19. Applied atomic and collision physics special topics

    CERN Document Server

    Massey, H S W; Bederson, Benjamin

    1982-01-01

    Applied Atomic Collision Physics, Volume 5: Special Topics deals with topics on applications of atomic collisions that were not covered in the first four volumes of the treatise. The book opens with a chapter on ultrasensitive chemical detectors. This is followed by separate chapters on lighting, magnetohydrodynamic electrical power generation, gas breakdown and high voltage insulating gases, thermionic energy converters, and charged particle detectors. Subsequent chapters deal with the operation of multiwire drift and proportional chambers and streamer chambers and their use in high energy p

  20. Advanced topics in the arithmetic of elliptic curves

    CERN Document Server

    Silverman, Joseph H

    1994-01-01

    In the introduction to the first volume of The Arithmetic of Elliptic Curves (Springer-Verlag, 1986), I observed that "the theory of elliptic curves is rich, varied, and amazingly vast," and as a consequence, "many important topics had to be omitted." I included a brief introduction to ten additional topics as an appendix to the first volume, with the tacit understanding that eventually there might be a second volume containing the details. You are now holding that second volume. it turned out that even those ten topics would not fit Unfortunately, into a single book, so I was forced to make some choices. The following material is covered in this book: I. Elliptic and modular functions for the full modular group. II. Elliptic curves with complex multiplication. III. Elliptic surfaces and specialization theorems. IV. Neron models, Kodaira-Neron classification of special fibers, Tate's algorithm, and Ogg's conductor-discriminant formula. V. Tate's theory of q-curves over p-adic fields. VI. Neron's theory of can...

  1. Characteristics of shigellosis outbreaks in the AP of Vojvodina

    Directory of Open Access Journals (Sweden)

    Đurić Predrag

    2009-01-01

    Full Text Available Introduction. Shigellosis causes around 165 million infections and around 1 million deaths in the world every year. Two thirds of both infections and deaths are among children younger than 10. Shigellosis mainly spreads by direct or indirect contact, but water- and food-borne outbreaks are not rare. Material and methods. A descriptive epidemiological method was used to analyse characteristics of shigellosis outbreaks in the AP of Vojvodina in the period 1979-2005. Results. During this period 9.083 shigellosis infections were registered, 51,9% of them in 202 shigellosis outbreaks. The leading way of transmission was contact, but water- and food-borne outbreaks were also detected. The average number of infections in contact outbreaks of shigellosis was small - 6.3 infections. The highest average is in water-borne outbreaks - 55.1. Most of the outbreaks were those occurring in families (47.5% and most of them were registered in august. Discussion. Shigellosis has been mandatory reported in the AP of Vojvodina since 1945 and results of outbreak investigation of this disease were analyzed since 1979. In the first half of this period water was the most common way of agent transmission in shigellosis outbreaks, but in recent 15 years the contact became the leading one. In the last 5 years there was no water-borne shigellosis outbreaks. Almost one third of all outbreaks were imported from Montenegro and Croatia by tourists coming back from those countries. Most of the outbreaks are small outbreaks occurring in families, primarily transmitted by contact. Outbreaks in facilities for care of disabled children and elders are also important. Sh. sonnei and Sh. flexneri are the two serotypes identified, the former in 57.4% and the latter in 40.1% outbreaks. Conclusion. Shigellosis is a disease occurring in the AP of Vojvodina primarily in small outbreaks inside families, transmitted by contact, most often in August and more often caused by Sh. sonnei. Health

  2. The flame structure of AP/HTPB sandwiches

    Science.gov (United States)

    Chorpening, Benjamin Todd

    2000-10-01

    Ultraviolet emission imaging experiments have been used to study the combustion of sandwiches of ammonium perchlorate (AP) and hydroxyl-terminated polybutadiene (HTPB) in nitrogen at pressures up to 32 atm, with binder layers from 50 to 450 mum in thickness. An ICCD camera system has been used to image the flame emission near 310 nm, and a backlighting technique has been developed that allows determination of the corresponding surface shape during combustion. The results indicate the AP/HTPB interface regression rate of IPDI cured samples undergoing low power (100W) laser-assisted deflagration is nearly independent of the binder thickness for binders thicker than 100 mum. The pressure exponent of the regression rate is 0.31 up to 15 atm, increasing with pressure from 15 to 32 atm. Two primary regimes of flame behavior have been identified: a split flame base regime which occurs with high Peclet and Damkohler numbers, and a merged flame base regime which occurs with low Peclet and Damkohler numbers. A secondary regime, exhibiting a "lifted" flame, occurs with low Damkohler numbers and high Peclet numbers. The ultraviolet flame emissions observed in the experiments show a correspondence with the fuel-rich region of the flame, as determined with a Schvab-Zeldovich model. This is reasonable since the primary sources of ultraviolet emission in the 305--315 nm region, electronically excited OH and the CO + O reaction, are dependent on fuel related species. The growth of the fuel-rich region with increasing Peclet number, predicted by the model, is qualitatively matched by the experimental results. The predicted shrinkage of the fuel-rich region when the binder layer is diluted with fine AP is also qualitatively matched by the experiments. Comparison of the experimental results with a single-reaction model with finite rate kinetics shows a weak qualitative agreement on the influence of Damkohler number. A large increase in Damkohler number (factor of 20) leads to a strong

  3. EvoRiver: Visual Analysis of Topic Coopetition on Social Media.

    Science.gov (United States)

    Sun, Guodao; Wu, Yingcai; Liu, Shixia; Peng, Tai-Quan; Zhu, Jonathan J H; Liang, Ronghua

    2014-12-01

    Cooperation and competition (jointly called "coopetition") are two modes of interactions among a set of concurrent topics on social media. How do topics cooperate or compete with each other to gain public attention? Which topics tend to cooperate or compete with one another? Who plays the key role in coopetition-related interactions? We answer these intricate questions by proposing a visual analytics system that facilitates the in-depth analysis of topic coopetition on social media. We model the complex interactions among topics as a combination of carry-over, coopetition recruitment, and coopetition distraction effects. This model provides a close functional approximation of the coopetition process by depicting how different groups of influential users (i.e., "topic leaders") affect coopetition. We also design EvoRiver, a time-based visualization, that allows users to explore coopetition-related interactions and to detect dynamically evolving patterns, as well as their major causes. We test our model and demonstrate the usefulness of our system based on two Twitter data sets (social topics data and business topics data). PMID:26356889

  4. Topical anaesthesia in children: reducing the need for specialty referral.

    LENUS (Irish Health Repository)

    O'Connor, Gabrielle

    2012-01-31

    OBJECTIVE: The management of wounds in children is stressful, not only for the child, but also for parents and staff. In our Emergency Department (ED), we currently do not have a paediatric sedation policy, and thus children requiring suturing, not amenable to distraction and infiltrative anaesthesia, are referred to specialty teams for general anaesthesia. We proposed that the introduction of a topical anaesthetic gel (lidocaine, adrenaline, tetracaine - LAT) might help to reduce the number of referrals, by allowing the ED staff to perform the procedures, in combination with nonpharmacological approaches. METHODS: We carried out a retrospective review of ED records of all children aged 14 years or less attending with wounds, over an 8-month period, from 01 May 2007 to 31 January 2008. RESULTS: Two hundred and one (50.6%) patients presented before the introduction of LAT gel, whereas 196 (49.3%) patients presented afterwards. A total of 39 (19.4%) patients were referred for specialty review pre-LAT, whereas only 19 (9.7%) patients were referred in the LAT group. Of these, 31 (15.4%) pre-LAT and 15 (7.7%) LAT group required general anaesthesia. There is a significant difference between these two groups, using Fischer\\'s exact test, P=0.018. CONCLUSION: We have found that the introduction of topical anaesthetic gel in ED has significantly reduced the number of children with wounds referred to specialty teams for general anaesthesia. This has important implications for patient safety and hospital resources.

  5. Recent Progress in Some Active Topics on Complex Networks

    Science.gov (United States)

    Gu, J.; Zhu, Y.; Guo, L.; Jiang, J.; Chi, L.; Li, W.; Wang, Q. A.; Cai, X.

    2015-04-01

    Complex networks have been extensively studied across many fields, especially in interdisciplinary areas. It has since long been recognized that topological structures and dynamics are important aspects for capturing the essence of complex networks. The recent years have also witnessed the emergence of several new elements which play important roles in network study. By combining the results of different research orientations in our group, we provide here a review of the recent advances in regards to spectral graph theory, opinion dynamics, interdependent networks, graph energy theory and temporal networks. We hope this will be helpful for the newcomers of those fields to discover new intriguing topics.

  6. Social group utility maximization

    CERN Document Server

    Gong, Xiaowen; Yang, Lei; Zhang, Junshan

    2014-01-01

    This SpringerBrief explains how to leverage mobile users' social relationships to improve the interactions of mobile devices in mobile networks. It develops a social group utility maximization (SGUM) framework that captures diverse social ties of mobile users and diverse physical coupling of mobile devices. Key topics include random access control, power control, spectrum access, and location privacy.This brief also investigates SGUM-based power control game and random access control game, for which it establishes the socially-aware Nash equilibrium (SNE). It then examines the critical SGUM-b

  7. Towards a Pattern-Driven Topical Ontology Modeling Methodology in Elderly Care Homes

    Science.gov (United States)

    Tang, Yan; de Baer, Peter; Zhao, Gang; Meersman, Robert; Pudkey, Kevin

    This paper presents a pattern-driven ontology modeling methodology, which is used to create topical ontologies in the human resource management (HRM) domain. An ontology topic is used to group concepts from different contexts (or even from different domain ontologies). We use the Organization for Economic Co-operation and Development (OECD) and the National Vocational Qualification (NVQ) as the resource to create the topical ontologies in this paper. The methodology is implemented in a tool called PAD-ON suit. The paper approach is illustrated with a use case from elderly care homes in UK.

  8. Analysis of the Status of Foreign Underground Research Laboratories and In-situ Research Topics

    International Nuclear Information System (INIS)

    The status of 11 foreign underground research laboratories (URLs) for the study on high-level waste disposal in the 8 countries including USA has been investigated. The research topics of in-situ study which have been conducted and are planed to do in the URLs have been investigated and analyzed based on the Korean situation. Using the results, the essential in-situ research topics that should be carried out in KURT(KAERI Underground Research Tunnel) are suggested. These topics are classified into two groups, namely the field on engineered barriers and the field on natural barriers

  9. 75 FR 26647 - Ophthalmic and Topical Dosage Form New Animal Drugs; Ivermectin Topical Solution

    Science.gov (United States)

    2010-05-12

    ... parasites that were approved for the pioneer product with 3 years of marketing exclusivity (69 FR 501... HUMAN SERVICES Food and Drug Administration 21 CFR Part 524 Ophthalmic and Topical Dosage Form New... part 524 is amended as follows: PART 524--OPHTHALMIC AND TOPICAL DOSAGE FORM NEW ANIMAL DRUGS 0 1....

  10. Differential recognition of a dileucine-based sorting signal by AP-1 and AP-3 reveals a requirement for both BLOC-1 and AP-3 in delivery of OCA2 to melanosomes

    OpenAIRE

    Sitaram, Anand; Dennis, Megan K.; Chaudhuri, Rittik; De Jesus-Rojas, Wilfredo; Tenza, Danièle; Setty, Subba Rao Gangi; Wood, Christopher S.; Sviderskaya, Elena V.; Bennett, Dorothy C.; Raposo, Graça; Bonifacino, Juan S.; Marks, Michael S.

    2012-01-01

    Cell types that generate unique lysosome-related organelles (LROs), such as melanosomes in melanocytes, populate nascent LROs with cargoes that are diverted from endosomes. Cargo sorting toward melanosomes correlates with binding via cytoplasmically exposed sorting signals to either heterotetrameric adaptor AP-1 or AP-3. Some cargoes bind both adaptors, but the relative contribution of each adaptor to cargo recognition and their functional interactions with other effectors during transport to...

  11. Comparative study of oral and topical ketoconazole therapy in pityriasis versicolor

    Directory of Open Access Journals (Sweden)

    Nagpal V

    2003-07-01

    Full Text Available Introduction: Both topical and systemic ketoconazole are reported to be effective against pityriasis versicolor. Material and Methods: Forty patients suffering from pityriasis versicolor were treated either with oral ketoconazole 200 mg per day or 2% ketoconazole cream topically once daily for 2 weeks. Results: On global assessment, after 2 weeks of start of therapy, 18 (90% out of 20 patients treated with oral ketoconazole were cured while 2 patients had considerable residual disease. In the ketoconazole cream group, 16 (80% out of 20 patients were cured and 4 patients had considerable residual disease. Conclusion: No significant difference was observed in the response rates in the two groups. Relapse occurred in two patients of the systemic ketoconazole group and six patients of the topical ketoconazole group during the follow-up period of three months.

  12. The interaction between the adaptor protein APS and Enigma is involved in actin organisation

    DEFF Research Database (Denmark)

    Barres, Romain; Gonzalez, Teresa; Le Marchand-Brustel, Yannick;

    2005-01-01

    and APS were partially co-localised with F-actin in small ruffling structures. Insulin increased the complex formation between APS and Enigma and their co-localisation in large F-actin containing ruffles. While in NIH-3T3 and HeLa cells the co-expression of both Enigma and APS did not modify the actin...... cytoskeleton organisation, expression of Enigma alone led to the formation of F-actin clusters. Similar alteration in actin cytoskeleton organisation was observed in cells expressing both Enigma and APS with a mutation in the NPTY motif. These results identify Enigma as a novel APS-binding protein and suggest...... that the APS/Enigma complex plays a critical role in actin cytoskeleton organisation....

  13. In touch with psoriasis: topical treatments and current guidelines.

    LENUS (Irish Health Repository)

    Murphy, G

    2011-06-01

    This article describes topical therapies and treatment guidelines for psoriasis and is based on a presentation given by the authors at a satellite symposium held during the 19th Congress of the European Academy of Dermatology and Venereology, 6-10 October, 2010, in Gothenburg, Sweden. The highly variable nature of psoriasis and its individual presentation in patients can make it difficult to choose the most appropriate treatment. There are many treatment options, from topical treatment with emollients for very mild psoriasis, to systemic therapy with fumaric acid esters, methotrexate or biologics for severe disease. For the treatment of mild-to-moderate psoriasis, topical therapy is generally the most appropriate and a variety of options, both historical and recent, are available. Newer therapies offer greater convenience and fewer side-effects. Of the more recently available therapies, vitamin D analogues and topical corticosteroids are the two with the greatest proven efficacy in randomized clinical trials. A recent Cochrane review showed the highest efficacy overall with the fixed combination vitamin D analogue (calcipotriol) and corticosteroid (betamethasone dipropionate). Indeed, clinical trials have shown that two-compound calcipotriol\\/betamethasone dipropionate ointment has higher efficacy than calcipotriol or betamethasone dipropionate alone. With regard to safety, two-compound calcipotriol\\/betamethasone dipropionate was shown to be suitable for intermittent long-term treatment of mild-to-moderate psoriasis. The findings of the Cochrane review are reflected in the current treatment guidelines from the USA and Germany regarding the treatment of mild-to-moderate psoriasis. In both these guidelines, which will be discussed in this article, the recommended treatments for this patient group are vitamin D analogues and corticosteroids, particularly when used in combination.

  14. In touch with psoriasis: topical treatments and current guidelines.

    LENUS (Irish Health Repository)

    Murphy, G

    2012-02-01

    This article describes topical therapies and treatment guidelines for psoriasis and is based on a presentation given by the authors at a satellite symposium held during the 19th Congress of the European Academy of Dermatology and Venereology, 6-10 October, 2010, in Gothenburg, Sweden. The highly variable nature of psoriasis and its individual presentation in patients can make it difficult to choose the most appropriate treatment. There are many treatment options, from topical treatment with emollients for very mild psoriasis, to systemic therapy with fumaric acid esters, methotrexate or biologics for severe disease. For the treatment of mild-to-moderate psoriasis, topical therapy is generally the most appropriate and a variety of options, both historical and recent, are available. Newer therapies offer greater convenience and fewer side-effects. Of the more recently available therapies, vitamin D analogues and topical corticosteroids are the two with the greatest proven efficacy in randomized clinical trials. A recent Cochrane review showed the highest efficacy overall with the fixed combination vitamin D analogue (calcipotriol) and corticosteroid (betamethasone dipropionate). Indeed, clinical trials have shown that two-compound calcipotriol\\/betamethasone dipropionate ointment has higher efficacy than calcipotriol or betamethasone dipropionate alone. With regard to safety, two-compound calcipotriol\\/betamethasone dipropionate was shown to be suitable for intermittent long-term treatment of mild-to-moderate psoriasis. The findings of the Cochrane review are reflected in the current treatment guidelines from the USA and Germany regarding the treatment of mild-to-moderate psoriasis. In both these guidelines, which will be discussed in this article, the recommended treatments for this patient group are vitamin D analogues and corticosteroids, particularly when used in combination.

  15. Counting statistics and loss corrections for the APS

    International Nuclear Information System (INIS)

    It has been suggested that for timing experiments, it might be advantageous to arrange the bunches in the storage ring in an asymmetrical mode. In this paper, we determine the counting losses from pulsed x-ray sources from basic probabilistic arguments and from Poisson statistics. In particular the impact on single photon counting losses of a variety of possible filling modes for the Advanced Photon Source (APS) is examined. For bunches of equal current, a loss of 10% occurs whenever the count rate exceeds 21% of the bunch repetition rate. This changes slightly when bunches containing unequal numbers of particles are considered. The results are applied to several common detector/electronics systems

  16. An ancillary pumping system for the APS vacuum system

    Energy Technology Data Exchange (ETDEWEB)

    Walters, D.; Noonan, J.; Gagliano, J. [and others

    1997-06-01

    An ancillary pumping system has been designed and installed in the Advanced Photon Source (APS) storage ring. This vacuum system has the ability to pump sectors of the storage ring down from room pressure to ultra-high vacuum (UHV). The ancillary system is a {open_quotes}dry{close_quotes} system that uses a combination of turbomolecular pumps and oil-free roughing pumps. The benefits of this system are the reduction of equipment needed for in-tunnel maintenance, essential for the operation of a UHV storage ring; rapid response to vacuum emergencies and a guard to accidental exposures to hydrocarbon contamination. The operational logic and the pump interlock and controls are described.

  17. Autonomous star tracker based on active pixel sensors (APS)

    Science.gov (United States)

    Schmidt, U.

    2004-06-01

    Star trackers are opto-electronic sensors used onboard of satellites for the autonomous inertial attitude determination. During the last years, star trackers became more and more important in the field of the attitude and orbit control system (AOCS) sensors. High performance star trackers are based up today on charge coupled device (CCD) optical camera heads. The Jena-Optronik GmbH is active in the field of opto-electronic sensors like star trackers since the early 80-ties. Today, with the product family ASTRO5, ASTRO10 and ASTRO15, all marked segments like earth observation, scientific applications and geo-telecom are supplied to European and Overseas customers. A new generation of star trackers can be designed based on the APS detector technical features. The measurement performance of the current CCD based star trackers can be maintained, the star tracker functionality, reliability and robustness can be increased while the unit costs are saved.

  18. Towards a theory of rapidly oscillating Ap stars

    CERN Document Server

    Gough, Douglas

    2011-01-01

    Peculiar A stars are so named because they exhibit abundance peculiarities in their atmospheres. It is believed that these arise as a result of differentiation of chemical species in large magnetic spots in which convective mixing is inhibited: there might be just two antipodal spots, whose axis is inclined to the axis of rotation. Many of the Ap stars that are rotating slowly also pulsate, with periods substantially shorter than the period of the fundamental radial mode. The pulsations appear to be nonradial, but axisymmetric, with their common axis usually aligned with the axis of the spots. In this lecture I shall first discuss the magnetic suppression of convection in the spots, and then I shall try to explain the pulsation phenomenon, reviewing some of the suggestions that have been made to explain the alignment and the excitation mechanism, and finally raising some issues that need to be addressed.

  19. Fabrication and Testing of Deflecting Cavities for APS

    Energy Technology Data Exchange (ETDEWEB)

    Mammosser, John; Wang, Haipeng; Rimmer, Robert; Jim, Henry; Katherine, Wilson; Dhakal, Pashupati; Ali, Nassiri; Jim, Kerby; Jeremiah, Holzbauer; Genfa, Wu; Joel, Fuerst; Yawei, Yang; Zenghai, Li

    2013-09-01

    Jefferson Lab (Newport News, Virginia) in collaboration with Argonne National Laboratory (Argonne, IL) has fabricated and tested four first article, 2.8 GHz, deflecting SRF cavities, for Argonne's Short-Pulse X-ray (SPX) project. These cavities are unique in many ways including the fabrication techniques in which the cavity cell and waveguides were fabricated. These cavity subcomponents were milled from bulk large grain niobium ingot material directly from 3D CAD files. No forming of sub components was used with the exception of the beam-pipes. The challenging cavity and helium vessel design and fabrication results from the stringent RF performance requirements required by the project and operation in the APS ring. Production challenges and fabrication techniques as well as testing results will be discussed in this paper.

  20. Progress on the development of APS beam position monitoring system

    International Nuclear Information System (INIS)

    This paper describes the development status of the beam position monitoring system for the Advanced Photon Source (APS), a third-generation light source now under construction at Argonne National Laboratory. The accelerator complex will consist of an electron linac, a positron linac, a positron accumulator ring (PAR), an injector synchrotron and a storage ring. For beam position measurement, striplines will be used on the linacs, while button-type pickups will be used on the injector synchrotron and the storage ring. A test stand with a prototype injector synchrotron beam position monitor (BPM) unit has been built, and we present the results of position calibration measurements using a wire. Comparison of the results with theoretical calculations will be presented. The current effort on similar storage ring BPM system measurements will also be discussed. 4 refs., 5 figs., 2 tabs