WorldWideScience

Sample records for aps topical group

  1. History of the APS Topical Group on Shock Compression of Condensed Matter

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-10-19

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wavehigh pressure sessions at APS general meetings in even numbered years.

  2. The History of the APS Shock Compression of Condensed Matter Topical Group

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, J W

    2001-05-02

    In order to provide broader scientific recognition and to advance the science of shock compressed condensed matter, a group of American Physical Society (APS) members worked within the Society to make this field an active part of the APS. Individual papers were presented at APS meetings starting in the 1940's and shock wave sessions were organized starting with the 1967 Pasadena meeting. Shock wave topical conferences began in 1979 in Pullman, WA. Signatures were obtained on a petition in 1984 from a balanced cross-section of the shock wave community to form an APS Topical Group (TG). The APS Council officially accepted the formation of the Shock Compression of Condensed Matter (SCCM) TG at its October 1984 meeting. This action firmly aligned the shock wave field with a major physical science organization. Most early topical conferences were sanctioned by the APS while those held after 1992 were official APS meetings. The topical group organizes a shock wave topical conference in odd numbered years while participating in shock wave/high pressure sessions at APS general meetings in even numbered years.

  3. Topics in cohomology of groups

    CERN Document Server

    Lang, Serge

    1996-01-01

    The book is a mostly translated reprint of a report on cohomology of groups from the 1950s and 1960s, originally written as background for the Artin-Tate notes on class field theory, following the cohomological approach. This report was first published (in French) by Benjamin. For this new English edition, the author added Tate's local duality, written up from letters which John Tate sent to Lang in 1958 - 1959. Except for this last item, which requires more substantial background in algebraic geometry and especially abelian varieties, the rest of the book is basically elementary, depending only on standard homological algebra at the level of first year graduate students.

  4. Factorizations of groups and related topics

    Institute of Scientific and Technical Information of China (English)

    AMBERG; Bernhard; KAZARIN; Lev

    2009-01-01

    This is a survey of some recent progress in the theory of groups with factorizations. Some of the methods can be used to obtain information about finite groups in general, nilpotent algebras and nearrings.

  5. 77 FR 22622 - AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc...

    Science.gov (United States)

    2012-04-16

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION AP Henderson Group, BPO Management Services, Inc., Capital Mineral Investors, Inc., CardioVascular... concerning the securities of AP Henderson Group because it has not filed any periodic reports since...

  6. On Constructing, Grouping and Using Topical Ontology for Semantic Matching

    Science.gov (United States)

    Tang, Yan; de Baer, Peter; Zhao, Gang; Meersman, Robert

    An ontology topic is used to group concepts from different contexts (or even from different domain ontologies). This paper presents a pattern-driven modeling methodology for constructing and grouping topics in an ontology (PAD-ON methodology), which is used for matching similarities between competences in the human resource management (HRM) domain. The methodology is supported by a tool called PAD-ON. This paper demonstrates our recent achievement in the work from the EC Prolix project. The paper approach is applied to the training processes at British Telecom as the test bed.

  7. Nuclear Forensics: Report of the AAAS/APS Working Group

    Science.gov (United States)

    Tannenbaum, Benn

    2008-04-01

    This report was produced by a Working Group of the American Physical Society's Program on Public Affairs in conjunction with the American Association for the Advancement of Science Center for Science, Technology and Security Policy. The primary purpose of this report is to provide the Congress, U.S. government agencies and other institutions involved in nuclear forensics with a clear unclassified statement of the state of the art of nuclear forensics; an assessment of its potential for preventing and identifying unattributed nuclear attacks; and identification of the policies, resources and human talent to fulfill that potential. In the course of its work, the Working Group observed that nuclear forensics was an essential part of the overall nuclear attribution process, which aims at identifying the origin of unidentified nuclear weapon material and, in the event, an unidentified nuclear explosion. A credible nuclear attribution capability and in particular nuclear forensics capability could deter essential participants in the chain of actors needed to smuggle nuclear weapon material or carry out a nuclear terrorist act and could also encourage states to better secure such materials and weapons. The Working Group also noted that nuclear forensics result would take some time to obtain and that neither internal coordination, nor international arrangements, nor the state of qualified personnel and needed equipment were currently enough to minimize the time needed to reach reliable results in an emergency such as would be caused by a nuclear detonation or the intercept of a weapon-size quantity of material. The Working Group assesses international cooperation to be crucial for forensics to work, since the material would likely come from inadequately documented foreign sources. In addition, international participation, if properly managed, could enhance the credibility of the deterrent effect of attribution. Finally the Working Group notes that the U.S. forensics

  8. Report of the APS Neutrino Study Reactor Working Group

    Energy Technology Data Exchange (ETDEWEB)

    Abouzaid, E.; Anderson, K.; Barenboim, G.; Berger, B.; Blucher, E.; Bolton, T.; Choubey, S.; Conrad, J.; Formaggio, J.; Freedman, S.; Finely, D.; Fisher, P.; Fujikawa, B.; Gai, M.; Goodman, M.; de Goueva, A.; Hadley, N.; Hahn, R.; Horton-Smith, G.; Kadel, R.; Kayser, B.; Heeger, K.; Klein, J.; Learned, J.; Lindner, M.; Link, J.; Luk, K.-B.; McKeown, R.; Mocioiu, I.; Mohapatra, R.; Naples, D.; Peng, J.; Petcov, S.; Pilcher, J.; Rapidis, P.; Reyna, D.; Shaevitz, M.; Shrock, R.; Stanton, N.; Stefanski, R.; Yamamoto, R.; Worcester, M.

    2004-10-28

    The worldwide program to understand neutrino oscillations and determine the neutrino mixing parameters, CP violating effects, and mass hierarchy will require a broad combination of measurements. The group believes that a key element of this future neutrino program is a multi-detector neutrino experiment (with baselines of {approx} 200 m and {approx} 1.5 km) with a sensitivity of sin{sup 2} 2{theta}{sub 13} = 0.01. In addition to oscillation physics, the reactor experiment may provide interesting measurements of sin{sup 2} {theta}{sub W} at Q{sup 2} = 0, neutrino couplings, magnetic moments, and mixing with sterile neutrino states. {theta}{sub 13} is one of the twenty-six parameters of the standard model, the best model of electroweak interactions for energies below 100 GeV and, as such, is worthy of a precision measurement independent of other considerations. A reactor experiment of the proposed sensitivity will allow a measurement of {theta}{sub 13} with no ambiguities and significantly better precision than any other proposed experiment, or will set limits indicating the scale of future experiments required to make progress. Figure 1 shows a comparison of the sensitivity of reactor experiments of different scales with accelerator experiments for setting limits on sin{sup 2} 2{theta}{sub 13} if the mixing angle is very small, or for making a measurement of sin{sup 2} 2{theta}{sub 13} if the angle is observable. A reactor experiment with a 1% precision may also resolve the degeneracy in the {theta}{sub 23} parameter when combined with long-baseline accelerator experiments. In combination with long-baseline measurements, a reactor experiment may give early indications of CP violation and the mass hierarchy. The combination of the T2K and Nova long-baseline experiments will be able to make significant measurements of these effects if sin{sup 2} 2{theta}{sub 13} > 0.05 and with enhanced beam rates can improve their reach to the sin{sup 2} 2{theta}{sub 13} > 0.02 level

  9. Flexible Unicast-Based Group Communication for CoAP-Enabled Devices

    Directory of Open Access Journals (Sweden)

    Isam Ishaq

    2014-06-01

    Full Text Available Smart embedded objects will become an important part of what is called the Internet of Things. Applications often require concurrent interactions with several of these objects and their resources. Existing solutions have several limitations in terms of reliability, flexibility and manageability of such groups of objects. To overcome these limitations we propose an intermediately level of intelligence to easily manipulate a group of resources across multiple smart objects, building upon the Constrained Application Protocol (CoAP. We describe the design of our solution to create and manipulate a group of CoAP resources using a single client request. Furthermore we introduce the concept of profiles for the created groups. The use of profiles allows the client to specify in more detail how the group should behave. We have implemented our solution and demonstrate that it covers the complete group life-cycle, i.e., creation, validation, flexible usage and deletion. Finally, we quantitatively analyze the performance of our solution and compare it against multicast-based CoAP group communication. The results show that our solution improves reliability and flexibility with a trade-off in increased communication overhead.

  10. Flexible Unicast-Based Group Communication for CoAP-Enabled Devices †

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Van den Abeele, Floris; Rossey, Jen; Moerman, Ingrid; Demeester, Piet

    2014-01-01

    Smart embedded objects will become an important part of what is called the Internet of Things. Applications often require concurrent interactions with several of these objects and their resources. Existing solutions have several limitations in terms of reliability, flexibility and manageability of such groups of objects. To overcome these limitations we propose an intermediately level of intelligence to easily manipulate a group of resources across multiple smart objects, building upon the Constrained Application Protocol (CoAP). We describe the design of our solution to create and manipulate a group of CoAP resources using a single client request. Furthermore we introduce the concept of profiles for the created groups. The use of profiles allows the client to specify in more detail how the group should behave. We have implemented our solution and demonstrate that it covers the complete group life-cycle, i.e., creation, validation, flexible usage and deletion. Finally, we quantitatively analyze the performance of our solution and compare it against multicast-based CoAP group communication. The results show that our solution improves reliability and flexibility with a trade-off in increased communication overhead. PMID:24901978

  11. Flexible unicast-based group communication for CoAP-enabled devices.

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Van den Abeele, Floris; Rossey, Jen; Moerman, Ingrid; Demeester, Piet

    2014-01-01

    Smart embedded objects will become an important part of what is called the Internet of Things. Applications often require concurrent interactions with several of these objects and their resources. Existing solutions have several limitations in terms of reliability, flexibility and manageability of such groups of objects. To overcome these limitations we propose an intermediately level of intelligence to easily manipulate a group of resources across multiple smart objects, building upon the Constrained Application Protocol (CoAP). We describe the design of our solution to create and manipulate a group of CoAP resources using a single client request. Furthermore we introduce the concept of profiles for the created groups. The use of profiles allows the client to specify in more detail how the group should behave. We have implemented our solution and demonstrate that it covers the complete group life-cycle, i.e., creation, validation, flexible usage and deletion. Finally, we quantitatively analyze the performance of our solution and compare it against multicast-based CoAP group communication. The results show that our solution improves reliability and flexibility with a trade-off in increased communication overhead. PMID:24901978

  12. Eighth meeting of the ITPA Topical Group on Diagnostics

    International Nuclear Information System (INIS)

    The Eighth Meeting of the ITPA Topical Group (TG) on Diagnostics was held at the Culham Science Centre, UKAEA, from 14-18 March 2005. The meeting was opened by Professor Llewellyn Smith, Director of the Culham Science Centre. Professor Llewellyn Smith stressed the importance of diagnostics in operating and evaluating the performance of tokamak plasmas and highlighted that this will also be the case in ITER. The meeting was combined with a progress meeting on ITER-relevant diagnostic developments on-going in Europe, which was held on 14 March. More than 60 participants attended the meeting and all six ITPA partners were represented. Special sessions were devoted to alpha-particle diagnostics and to the ITER relevance of present and future diagnostic upgrades of JET

  13. Experimental Evaluation of Unicast and Multicast CoAP Group Communication

    Directory of Open Access Journals (Sweden)

    Isam Ishaq

    2016-07-01

    Full Text Available The Internet of Things (IoT is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP, but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP.

  14. Experimental Evaluation of Unicast and Multicast CoAP Group Communication.

    Science.gov (United States)

    Ishaq, Isam; Hoebeke, Jeroen; Moerman, Ingrid; Demeester, Piet

    2016-01-01

    The Internet of Things (IoT) is expanding rapidly to new domains in which embedded devices play a key role and gradually outnumber traditionally-connected devices. These devices are often constrained in their resources and are thus unable to run standard Internet protocols. The Constrained Application Protocol (CoAP) is a new alternative standard protocol that implements the same principals as the Hypertext Transfer Protocol (HTTP), but is tailored towards constrained devices. In many IoT application domains, devices need to be addressed in groups in addition to being addressable individually. Two main approaches are currently being proposed in the IoT community for CoAP-based group communication. The main difference between the two approaches lies in the underlying communication type: multicast versus unicast. In this article, we experimentally evaluate those two approaches using two wireless sensor testbeds and under different test conditions. We highlight the pros and cons of each of them and propose combining these approaches in a hybrid solution to better suit certain use case requirements. Additionally, we provide a solution for multicast-based group membership management using CoAP. PMID:27455262

  15. Eficácia de hipotensores oculares tópicos após capsulotomia posterior Efficacy of topic ocular hipotensive agents after posterior capsulotomy

    Directory of Open Access Journals (Sweden)

    Antonieta Antunes Pereira Minello

    2008-10-01

    (p=0,001. Quanto à freqüência de hipertensão entre os grupos, não houve diferença significante (p=0,148. CONCLUSÃO: A apraclonidina apresentou o maior efeito hipotensor após a capsulotomia com YAG laser quando comparada aos grupos brimonidina, dorzolamida, latanoprosta, pilocarpina, timolol e grupo controle.PURPOSE: To analyze and compare the effects on intraocular pressure (IOP of several topic hypotensive agents after posterior capsulotomy with Nd:YAG laser in non glaucoma patients. METHODS: 145 pseudophakic eyes underwent to Nd:YAG laser posterior capsulotomy. Before capsulotomy. 21 were treated with apraclonidine, 20 with brimonidine, 23 with dorzolamide, 20 with latanoprost, 20 with pilocarpine, and 20 with timolol. Controls (21 eyes received placebo. IOP measurements (Goldmann applanation tonometry were taken under masked conditions 1 hour before procedure and after 1 and 2 hours. If postoperative PIO was above 20 mmHg its measurements were extended to 4 and 24 hours. Capsulotomy was performed with Abraham lens, under topic anesthetic, using Nd:YAG laser. Ocular hypertension would be considered if the IOP had suffered an increase of 4 mmHg above the initial. Mean total energy used was 2.1 ± 1 mJ. RESULTS: The preoperative IOP did not differ statistically among groups. Mean IOPs of treated eyes 1h (11.9 ± 3.8 and 2h (11.5 ± 3.0 were statistically lower than IOP compared with control group (12,6 ± 2,8 (p=0.001. There were no statistically significant differences for the other measurements. Control and pilocarpine had a percentual IOP increase after 2 hours of 8.7 ± 19.1% (13.5 ± 3.2 mmHg and 1.2 ± 26.3% (12.5 ± 3.6 mmHg respectively. Mean percentual postoperative IOP reduction was detected in the apraclonidine group -24.7 ± 15.5% (9.8 ± 2.6 mmHg, in the brimonidine group -8.9 ± 15.5% (10.1 ± 1.7 mmHg, in the dorzolamide group -6.9 ± 20.3% (12.1 ± 2.8 mmHg, in the latanoprost group -0.4 ± 25.9% (12.1 ± 2.9 mmHg and in timolol group -16.2

  16. Transcription of ColE1Ap mbeC induced by conjugative plasmids from twelve different incompatibility groups.

    OpenAIRE

    Selvaratnam, S; Gealt, M A

    1993-01-01

    Although nonconjugative mobilizable plasmids require helping functions of conjugative plasmids in order to be mobilized into recipients, at least some genes from the nonconjugative plasmids may be induced to assist in the DNA transfer process. Conjugative plasmids from 12 different incompatibility groups mobilized the nonconjugative plasmid ColE1Ap between Escherichia coli strains. Introduction of any of the conjugative plasmids into the ColE1Ap-containing strain resulted in an induction of m...

  17. LDA-Based Unified Topic Modeling for Similar TV User Grouping and TV Program Recommendation.

    Science.gov (United States)

    Pyo, Shinjee; Kim, Eunhui; Kim, Munchurl

    2015-08-01

    Social TV is a social media service via TV and social networks through which TV users exchange their experiences about TV programs that they are viewing. For social TV service, two technical aspects are envisioned: grouping of similar TV users to create social TV communities and recommending TV programs based on group and personal interests for personalizing TV. In this paper, we propose a unified topic model based on grouping of similar TV users and recommending TV programs as a social TV service. The proposed unified topic model employs two latent Dirichlet allocation (LDA) models. One is a topic model of TV users, and the other is a topic model of the description words for viewed TV programs. The two LDA models are then integrated via a topic proportion parameter for TV programs, which enforces the grouping of similar TV users and associated description words for watched TV programs at the same time in a unified topic modeling framework. The unified model identifies the semantic relation between TV user groups and TV program description word groups so that more meaningful TV program recommendations can be made. The unified topic model also overcomes an item ramp-up problem such that new TV programs can be reliably recommended to TV users. Furthermore, from the topic model of TV users, TV users with similar tastes can be grouped as topics, which can then be recommended as social TV communities. To verify our proposed method of unified topic-modeling-based TV user grouping and TV program recommendation for social TV services, in our experiments, we used real TV viewing history data and electronic program guide data from a seven-month period collected by a TV poll agency. The experimental results show that the proposed unified topic model yields an average 81.4% precision for 50 topics in TV program recommendation and its performance is an average of 6.5% higher than that of the topic model of TV users only. For TV user prediction with new TV programs, the average

  18. Discovering associations among diagnosis groups using topic modeling.

    Science.gov (United States)

    Li, Ding Cheng; Thermeau, Terry; Chute, Christopher; Liu, Hongfang

    2014-01-01

    With the rapid growth of electronic medical records (EMR), there is an increasing need of automatically extract patterns or rules from EMR data with machine learning and data mining technqiues. In this work, we applied unsupervised statistical model, latent Dirichlet allocations (LDA), to cluster patient diagnoics groups from Rochester Epidemiology Projects (REP). The initial results show that LDA holds the potential for broad application in epidemiogloy as well as other biomedical studies due to its unsupervised nature and great interpretive power. PMID:25954576

  19. Leucodermia punctata após tratamento com Puvasol tópico Leukoderma punctata following topical PUVAsol treatment

    OpenAIRE

    Nurimar Conceição Fernandes; Juliana Carnevale Pina

    2010-01-01

    Duas adolescentes e uma menina com vitiligo clinicamente diagnosticado foram tratadas com 8-metoxipsoraleno a 0,2% em creme Lanette com subsequente exposição solar. Um ano após, apresentaram máculas acrômicas na área do vitiligo. A biópsia de pele em um dos casos revelou melanócitos com escassa pigmentação melânica. Os achados clínicos e histológicos sugerem o diagnóstico de leucodermia punctata.Two adolescent females and a girl, all with clinically diagnosed vitiligo, were treated with 0.2% ...

  20. Leucodermia punctata após tratamento com Puvasol tópico Leukoderma punctata following topical PUVAsol treatment

    Directory of Open Access Journals (Sweden)

    Nurimar Conceição Fernandes

    2010-08-01

    Full Text Available Duas adolescentes e uma menina com vitiligo clinicamente diagnosticado foram tratadas com 8-metoxipsoraleno a 0,2% em creme Lanette com subsequente exposição solar. Um ano após, apresentaram máculas acrômicas na área do vitiligo. A biópsia de pele em um dos casos revelou melanócitos com escassa pigmentação melânica. Os achados clínicos e histológicos sugerem o diagnóstico de leucodermia punctata.Two adolescent females and a girl, all with clinically diagnosed vitiligo, were treated with 0.2% 8-methoxypsoralen cream followed by exposure to solar ultraviolet light. One year later, they developed hypopigmented and achromic spots on the areas affected by the vitiligo. Biopsy of skin tissue taken from one of these cases showed a marked reduction in melanin. Clinical and histological findings point to a diagnosis of leukoderma punctata.

  1. Temporal Variation of Different Categories Sunspot Groups since 1996: Their Relation with Geomagnetic Ap and Dst Indices

    Science.gov (United States)

    Kilcik, Ali; Ozguc, Atila; Rozelot, Jean Pierre; Donmez, Burcin; Yurchyshyn, Vasyl

    2016-07-01

    We studied the temporal variation of the number of sunspot groups and sunspot counts in these groups in four categories as small (A, B), medium (C), large (D, E, F) and final (H modified Zurich classes) since 1996. Then we compared these data sets with geomagnetic Ap and Dst indices. In results of our analysis we found followings: 1) different categories sunspot groups and sunspot counts in these groups behave differently during a solar cycle. ii) Response of geomagnetic indices to these data sets are also different.

  2. AP Trends: Tests Soar, Scores Slip--Gaps between Groups Spur Equity Concerns

    Science.gov (United States)

    Cech, Scott J.

    2008-01-01

    More students are taking Advanced Placement tests, but the proportion of tests receiving what is deemed a passing score has dipped, and the mean score is down for the fourth year in a row. Data released here this week by the New York City-based nonprofit organization that owns the AP brand shows that a greater-than-ever proportion of students…

  3. Tomorrow's Journalists: In-Groups, Out-Groups, and News Topic Preference

    Science.gov (United States)

    Netzley, Sara Baker; Banning, Stephen A.

    2011-01-01

    This study explored whether student journalists believed they shared news topic preferences with the public. Previous research suggests journalists are very different from the audiences they serve, which may influence their perceptions of audience story preferences because of the social identity theory and the social distance corollary. A national…

  4. Topical-steroid-induced iatrogenic Cushing syndrome in the pediatric age group: A rare case report

    Directory of Open Access Journals (Sweden)

    Ashish Tiwari

    2013-01-01

    Full Text Available Cushing syndrome, a systemic disorder, is the result of abnormally high blood level of cortisol or other glucocorticoids. The most common cause of Cushing syndrome is prolonged exogenous administration of glucocorticoid hormones. Prolonged use of topical corticosteroids, particularly in children, may cause Cushing syndrome and suppression of the hypothalamopituitory-adrenal axis, which is less common than that of oral or parenteral route. However, iatrogenic Cushing syndrome in the infantile age group due to topical steroid is very rare and only a few patients have been reported to date in the literature. Here we report a case of iatrogenic Cushing syndrome due to topical steroid application in a 5-month-old female child admitted to the hospital for repeated episodes of fever and cough.

  5. A Topic Space Oriented User Group Discovering Scheme in Social Network: A Trust Chain Based Interest Measuring Perspective

    Directory of Open Access Journals (Sweden)

    Wang Dong

    2016-01-01

    Full Text Available Currently, user group has become an effective platform for information sharing and communicating among users in social network sites. In present work, we propose a single topic user group discovering scheme, which includes three phases: topic impact evaluation, interest degree measurement, and trust chain based discovering, to enable selecting influential topic and discovering users into a topic oriented group. Our main works include (1 an overview of proposed scheme and its related definitions; (2 topic space construction method based on topic relatedness clustering and its impact (influence degree and popularity degree evaluation; (3 a trust chain model to take user relation network topological information into account with a strength classification perspective; (4 an interest degree (user explicit and implicit interest degree evaluation method based on trust chain among users; and (5 a topic space oriented user group discovering method to group core users according to their explicit interest degrees and to predict ordinary users under implicit interest and user trust chain. Finally, experimental results are given to explain effectiveness and feasibility of our scheme.

  6. Third party access to LNG terminals. GIIGNL - Commercial Study Group Topic 8

    International Nuclear Information System (INIS)

    This report has been elaborated in the context of the GIIGNL Commercial Study Group (CSG) activities, which include as one of its topics the 'Third Party Access to LNG terminals' (Topic 8), led by Enagas. The 2010 edition is the third update to the report presented during the meeting of the GIIGNL Commercial Study Group in Tokyo, Japan, in September 2007. - Section 1 includes a review of the regulatory TPA regimes of LNG terminals in operation in Europe. The existing regime in each country, or for each terminal, is reviewed following a number of subsections. Each subsection follows the same structure in order to better understand the different arrangements and facilitate comparisons. - Section 2 shows data on effective usage and TPA access to each LNG terminal since 2000. Three main data are shown where available: number of cargoes delivered, volumes unloaded / sent-out, and the part of these cargoes/volumes that correspond to third parties. - Section 3 includes a tariff comparison for TPA to LNG terminals in Europe, taking into account the terms and conditions in force as of July 2010. - A description of the regulatory situation in the US in Sections 4. Access conditions to the three terminals under regulated TPA have been included for the first time: Lake Charles, Cove Point and Elba Island. An overview of Mexico and Canada is also reported. - An overview of the regulatory situation in Japan is provided in Section 5. The information required for the elaboration of this report has been collected from official web sites (LNG operators, regulatory authorities and industry associations), public reports and industry and statistical data Enagas deems to be reliable. For the adoption of certain hypothesis in Section 3 Enagas has also relied in information directly provided by operators

  7. Climate change on Twitter: topics, communities and conversations about the 2013 IPCC Working Group 1 report.

    Science.gov (United States)

    Pearce, Warren; Holmberg, Kim; Hellsten, Iina; Nerlich, Brigitte

    2014-01-01

    In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report. PMID:24718388

  8. Climate change on Twitter: topics, communities and conversations about the 2013 IPCC Working Group 1 report.

    Directory of Open Access Journals (Sweden)

    Warren Pearce

    Full Text Available In September 2013 the Intergovernmental Panel on Climate Change published its Working Group 1 report, the first comprehensive assessment of physical climate science in six years, constituting a critical event in the societal debate about climate change. This paper analyses the nature of this debate in one public forum: Twitter. Using statistical methods, tweets were analyzed to discover the hashtags used when people tweeted about the IPCC report, and how Twitter users formed communities around their conversational connections. In short, the paper presents the topics and tweeters at this particular moment in the climate debate. The most used hashtags related to themes of science, geographical location and social issues connected to climate change. Particularly noteworthy were tweets connected to Australian politics, US politics, geoengineering and fracking. Three communities of Twitter users were identified. Researcher coding of Twitter users showed how these varied according to geographical location and whether users were supportive, unsupportive or neutral in their tweets about the IPCC. Overall, users were most likely to converse with users holding similar views. However, qualitative analysis suggested the emergence of a community of Twitter users, predominantly based in the UK, where greater interaction between contrasting views took place. This analysis also illustrated the presence of a campaign by the non-governmental organization Avaaz, aimed at increasing media coverage of the IPCC report.

  9. Draft Genome Sequence of the Plant-Pathogenic Soil Fungus Rhizoctonia solani Anastomosis Group 3 Strain Rhs1AP

    OpenAIRE

    Cubeta, Marc A.; Thomas, Elizabeth; Dean, Ralph A.; Jabaji, Suha; Neate, Stephen M.; Tavantzis, Stellos; Toda, Takeshi; Vilgalys, Rytas; Bharathan, Narayanaswamy; Fedorova-Abrams, Natalie; Pakala, Suman B.; Pakala, Suchitra M.; Zafar, Nikhat; Joardar, Vinita; Losada, Liliana

    2014-01-01

    The soil fungus Rhizoctonia solani is a pathogen of agricultural crops. Here, we report on the 51,705,945 bp draft consensus genome sequence of R. solani strain Rhs1AP. A comprehensive understanding of the heterokaryotic genome complexity and organization of R. solani may provide insight into the plant disease ecology and adaptive behavior of the fungus.

  10. Draft Genome Sequence of the Plant-Pathogenic Soil Fungus Rhizoctonia solani Anastomosis Group 3 Strain Rhs1AP.

    Science.gov (United States)

    Cubeta, Marc A; Thomas, Elizabeth; Dean, Ralph A; Jabaji, Suha; Neate, Stephen M; Tavantzis, Stellos; Toda, Takeshi; Vilgalys, Rytas; Bharathan, Narayanaswamy; Fedorova-Abrams, Natalie; Pakala, Suman B; Pakala, Suchitra M; Zafar, Nikhat; Joardar, Vinita; Losada, Liliana; Nierman, William C

    2014-01-01

    The soil fungus Rhizoctonia solani is a pathogen of agricultural crops. Here, we report on the 51,705,945 bp draft consensus genome sequence of R. solani strain Rhs1AP. A comprehensive understanding of the heterokaryotic genome complexity and organization of R. solani may provide insight into the plant disease ecology and adaptive behavior of the fungus. PMID:25359908

  11. Draft Genome Sequence of the Plant-Pathogenic Soil Fungus Rhizoctonia solani Anastomosis Group 3 Strain Rhs1AP

    Science.gov (United States)

    Cubeta, Marc A.; Dean, Ralph A.; Jabaji, Suha; Neate, Stephen M.; Tavantzis, Stellos; Toda, Takeshi; Vilgalys, Rytas; Bharathan, Narayanaswamy; Fedorova-Abrams, Natalie; Pakala, Suman B.; Pakala, Suchitra M.; Zafar, Nikhat; Joardar, Vinita; Losada, Liliana; Nierman, William C.

    2014-01-01

    The soil fungus Rhizoctonia solani is a pathogen of agricultural crops. Here, we report on the 51,705,945 bp draft consensus genome sequence of R. solani strain Rhs1AP. A comprehensive understanding of the heterokaryotic genome complexity and organization of R. solani may provide insight into the plant disease ecology and adaptive behavior of the fungus. PMID:25359908

  12. Distinguishing Topical and Social Groups Based on Common Identity and Bond Theory

    OpenAIRE

    Grabowicz P.A.; Aiello L.M.; Eguiluz V.M.; Jaimes A.

    2013-01-01

    Social groups play a crucial role in social media platforms because they form the basis for user participation and engagement. Groups are created explicitly by members of the community, but also form organically as members interact. Due to their importance, they have been studied widely (e.g., community detection, evolution, activity, etc.). One of the key questions for understanding how such groups evolve is whether there are different types of groups and how they differ. In Sociology, theor...

  13. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  14. Topics in mode conversion theory and the group theoretical foundations of path integrals

    Science.gov (United States)

    Richardson, Andrew Stephen

    This dissertation reports research about the phase space perspective for solving wave problems, with particular emphasis on the phenomenon of mode conversion in multicomponent wave systems, and the mathematics which underlie the phase space perspective. Part I of this dissertation gives a review of the phase space theory of resonant mode conversion. We describe how the WKB approximation is related to geometrical structures in phase space, and how in particular ray-tracing algorithms can be used to construct the WKB solution. We further review how to analyze the phenomena of mode conversion from the phase space perspective. By making an expansion of the dispersion matrix about the mode conversion point in phase space, a local coupled wave equation is obtained. The solution of this local problem then provides a way to asymptotically match the WKB solutions on either side of the mode conversion region. We describe this theory in the context of a pedagogical example; that of a pair of coupled harmonic oscillators undergoing resonant conversion. Lastly, we present new higher order corrections to the local solution for the mode conversion problem which allow better asymptotic matching to the WKB solutions. The phase space tools used in Part I rely on the Weyl symbol calculus, which gives a way to relate operators to functions on phase space. In Part II of this dissertation, we explore the mathematical foundations of the theory of symbols. We first review the theory of representations of groups, and the concept of a group Fourier transform. The Fourier transform for commutative groups gives the ordinary transform, while the Fourier transform for non-commutative groups relates operators to functions on the group. We go on to present the group theoretical formulation of symbols, as developed recently by Zobin. This defines the symbol of an operator in terms of a double Fourier transform on a non-commutative group. We give examples of this new type of symbol, using the

  15. Selected source term topics. Report to CSNI by an OECD/NEA Group of experts

    International Nuclear Information System (INIS)

    CSNI Report 136 summarizes the results of the work performed by the Group of Experts on the Source Term and Environmental Consequences (PWG4) during the period extending from 1983 and 1986. This report is complementary to Part 1, 'Technical Status of the Source Term' of CSNI Report 135, 'Report to CSNI on Source Term Assessment, Containment atmosphere control systems, and accident consequences'; it considers in detail a number of very specific issues thought to be important in the source term area. It consists of: an executive summary (prepared by the Chairman of the Group), a section on conclusions and recommendations, and five technical chapters (fission product chemistry in the primary circuit of a LWR during severe accidents; resuspension/re-entrainment of aerosols in LWRs following a meltdown accident; iodine chemistry under severe accident conditions; effects of combustion, steam explosions and pressurized melt ejection on fission product behaviour; radionuclide removal by pool scrubbing), a technical annex and two appendices

  16. Winfrith Nuclear Data Group notes on topics in nuclear data evaluation, 1964-8

    International Nuclear Information System (INIS)

    This memorandum collects together a selection of brief notes written, during the course of the past few years, by the members of the Nuclear Data Group at the A.E.E., Winfrith. Many of the notes were tentative in nature and of ephemeral interest only, but it is felt that those presented here may have a wider interest to the fraternity of evaluators. (author)

  17. Topic In Elliptic Curves Over Finite Fields: The Groups of Points

    CERN Document Server

    Carella, N A

    2011-01-01

    This article is a short introduction to the theory of the groups of points of elliptic curves over finite fields. This note is concerned with the elementary theory and practice of elliptic curves cryptography, the new generation of public key systems. The material and coverage are focused on the groups of points of elliptic curves and algebraic curves, but not exclusively. The level of detail ranges from the very simple to the very difficult and open problems. The detailed proofs of many simple results are included or discussed. However, the long and difficult proofs of difficult results are not included, but relevant references are given. The reader should consult the literature for further elaboration on difficult concepts and ideas. Now and again, a concept is stated without explanation, but references to the literature are provided. An elementary background in finite fields analysis and number theory at the level of [MC87], [LN97], [ST92], [WN03] etc, should be sufficient to read the material and will be ...

  18. Matters of Gravity, The Newsletter of the Topical Group on Gravitation of the American Physical Society, Volume 46, December 2015

    CERN Document Server

    Garfinkle, David

    2015-01-01

    GGR News: Remembering Jacob Bekenstein we hear that ... 100 years ago GGR program at the APS meeting in Salt Lake City Conference reports: Hawking Radiation Quantum Information in Quantum Gravity Gravity-new perspectives from strings and higher dimensions

  19. Matters of Gravity, The Newsletter of the Topical Group in Gravitation of the American Physical Society, Volume 31, Winter 2008

    OpenAIRE

    Garfinkle, David; Comer, Greg

    2008-01-01

    GGR News: GGR program at the APS meeting in St. Louis we hear that... by David Garfinkle 100 years ago, by David Garfinkle Research Briefs: The Torsion Pendulum's Contribution to Dark Energy, by Bill Hamilton Conference Reports: 10th Capra Meeting on Radiation Reaction, by Carlos Sopuerta Quantum Gravity in the Southern Cone IV, by Rafael A. Porto

  20. Synthesis and evaluation structure/extracting and complexing properties of new bi-topic ligands for group actinides extraction

    International Nuclear Information System (INIS)

    The aim of this project is to design and study new extractants for spent nuclear fuel reprocessing. To decrease the long-term radiotoxicity of the waste, the GANEX process is an option to homogeneously recycle actinides. All actinides (U, Np, Pu, Am, Cm) would be extracted together from a highly acidic media and separated from fission products (especially from lanthanides). In this context, fourteen new bi-topic ligands constituted of a nitrogen poly-aromatic unit from the dipyridyl-phenanthroline and dipyridyl-1,3,5-triazine families and functionalized by amid groups were synthesized. Extraction studies performed with some of these ligands confirmed their interest to selectively separate actinides at different oxidation states from an aqueous solution 3M HNO3. To determine the influence of ligands structure on cation complexation, a study in a homogenous media (MeOH/H2O) has been carried out. Electro-spray ionization mass spectrometry have been used to characterize the complexes stoichiometries formed with several cations (Eu3+, Nd3+, Am3+, Pu4+ and NpO2+). Stability constants, evaluated by UV-Visible spectrophotometry, confirm the selectivity of these ligands toward actinides. Lanthanides and actinides complexes have also been characterized in the solid state by infra-red spectroscopy and X-Ray diffraction. Associated to nuclear magnetic resonance experiments and DFT calculations (Density Functional Theory), a better knowledge of their coordination mode was achieved. (author)

  1. Exploring Perspectives of Individuals with Intellectual Disabilities and Histories of Challenging Behaviors about Family Relationships: An Emergent Topic in a Grounded Theory Focus Group Study

    Science.gov (United States)

    Brown, Julie F.; Hamilton-Mason, Johnnie; Maramaldi, Peter; Barnhill, L. Jarrett

    2016-01-01

    The perspectives of individuals with intellectual disabilities (ID) about family relationships are underrepresented in the literature. The topic of family relationships emerged in a grounded theory exploratory focus group study that involved thirty dually diagnosed participants with moderate or mild intellectual disabilities and histories of…

  2. A note on weighted Ap(G)-modules

    OpenAIRE

    ÖZTOP, Serap

    2011-01-01

    Let G be a locally compact abelian group and w be a weight function on G. In this paper, we show that the space Ap,w(G) is a Banach module over the Figà-Talamanca Herz algebra Ap(G) and study the multiplier space from Ap(G) to Ap,w(G).

  3. AP1000 status overview

    International Nuclear Information System (INIS)

    The AP1000 is a two-loop, 1000 MWe pressurized water reactor (PWR) with passive safety features and extensive plant simplifications to enhance the construction, operation, and maintenance. The AP1000 design is derived directly from the AP600, a two-loop, 600 MWe PWR. The AP600 uses proven technology, which builds on the over 30 years of operating PWR experience. The AP600 design received Final Design Approval from the U.S. NRC in September 1998 and Design Certification in December 1999. The AP600 meets all of the U.S. electric utility requirements including their cost goals. Although the AP600 is the most cost-effective plant ready for deployment, it is still more expensive than the $1000/kw needed to compete in the United States today In order to develop a cost competitive nuclear power plant Westinghouse has completed design studies which demonstrate that it is feasible to increase the power output of the AP600 to at least 1000 MWe, maintaining its current design configuration, use of proven components and licensing basis. In order to achieve these objectives the AP1000 has been designed within the space constraints of the AP600, while retaining the credibility of proven components and substantial safety margins. This paper describes the changes made to up-rate the AP600 and gives an overview of the plant design. It also summarizes the basis for the AP600 testing program and computer codes being sufficient for the AP1000. (authors)

  4. Alkali-soluble fluoride deposition on enamel after professional application of topical fluoride in vitro Formação de flúor fracamente ligado ao esmalte após a aplicação tópica profissional de flúor in vitro

    Directory of Open Access Journals (Sweden)

    Mitsue Fujimaki Hayacibara

    2004-03-01

    Full Text Available Since the efficacy of topical fluoride products is related to the fluoride (F availability and its reactivity with enamel, this study was conducted. The F concentration of the following materials was verified: I- acidulated phosphate fluoride (APF gel (1.23% F, II- APF foam (1.23% F and III- Varnish (2.26% F. Forty blocks of bovine enamel were divided into 4 groups and treated according to the materials described, being one of them used as control. Loosely bound fluoride (''CaF2'' was determined on enamel after extraction with 1.0M KOH and analyzed by ion-selective electrode. Total F concentration found in gel was 12,642, in foam 12,755 and in varnish 23,183 mg F/g. All products formed statistically higher amounts of ''CaF2'' on enamel compared to the control group (p 0.05. Thus, ''CaF2'' formation was not proportional to the total F content in the products, suggesting that the pH and the vehicle used are more important.Considerando que a eficácia dos produtos para aplicação tópica profissional de flúor (géis, espumas e vernizes está relacionada com a reatividade do flúor (F com o esmalte e sendo esta dependente da disponibilidade do F em cada produto, este estudo foi conduzido. A concentração de F nos seguintes produtos foi estudada: I - Flúor Fosfato Acidulado (FFA gel (1,23% F, II - FFA espuma (1,23% F e III- Verniz fluoretado (2,26% F. Foram confeccionados 40 blocos de esmalte bovino, tratados de acordo com os grupos descritos, sendo um deles utilizado como controle. O F fracamente ligado (''CaF2'' ao esmalte foi determinado após a extração com 1.0 M KOH e analisado em eletrodo específico. A concentração de F encontrada no gel foi de 12.642, na espuma 12.755 e no verniz 23.183 mg F/g. Todos os produtos formaram uma quantidade significantemente maior de ''CaF2'' na superfície do esmalte, comparado ao grupo controle (p 0,05. Assim, a formação de ''CaF2'' na superfície do esmalte não foi proporcional ao conteúdo de F nos

  5. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    International Nuclear Information System (INIS)

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  6. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    Energy Technology Data Exchange (ETDEWEB)

    Demetri, K. J.; Leipner, C. I.; Marshall, M. L., E-mail: demetrkj@westinghouse.com [Westinghouse Electric Company, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2015-09-15

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  7. International topical meeting. Research Reactor Fuel Management (RRFM) and meeting of the International Group on Reactor Research (IGORR)

    International Nuclear Information System (INIS)

    Nuclear research and test reactors have been in operation for over 60 years, over 270 research reactors are currently operating in more than 50 countries. This meeting is dedicated to different aspects of research reactor fuels: new fuels for new reactors, the conversion to low enriched uranium fuels, spent fuel management and computational tools for core simulation. About 80 contributions are reported in this document, they are organized into 7 sessions: 1) international topics and overview on new projects and fuel, 2) new projects and upgrades, 3) fuel development, 4) optimisation and research reactor utilisation, 5) innovative methods in research reactors physics, 6) safety, operation and research reactor conversion, 7) fuel back-end management, and a poster session. Experience from Australian, Romanian, Libyan, Syrian, Vietnamese, South-African and Ghana research reactors are reported among other things. The Russian program for research reactor spent fuel management is described and the status of the American-driven program for the conversion to low enriched uranium fuels is presented. (A.C.)

  8. The Demographic Wave: Rethinking Hispanic AP Trends

    Science.gov (United States)

    Edwards, Kelcey; Sawtell, Ellen

    2013-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  9. Comparative study in swines' vocal cords healing after excision of fragment with CO2 laser with mitomycin and 5-fluorouracil postoperative topical application Estudo comparado da cicatrização da prega vocal de suínos após exérese de fragmento com laser de CO2 e aplicação tópica pós-operatória de mitomicina e 5-fluorouracil

    Directory of Open Access Journals (Sweden)

    Eduardo Baptistella

    2009-02-01

    Full Text Available PURPOSE: To evaluate the deposition of collagen fibers at pig's vocal folds after topical use of mitomycin or 5-fluorouracil, when partial exeresis of mucosa layer had been promoted by CO2 laser. METHODS: There were used 18 Larger white pigs which were anesthetized and submitted to mucosa fragment's exeresis, bilaterally, at its free border. The animals were divided into 3 groups, each one with 6 animals: control group, without topical drug application; mitomycin group; and 5-fluorouracil group. After 30 days, the animals were subjected to euthanasia, and samples of the vocal folds were collected and stained by picrosirius red technique with polarization for quantification of total collagen deposition. RESULTS: In control group, the mean rate of right vocal fold's collagen deposition at submucosa consisted in a 3428.66 micrometers area. There was found an area whose size had, in average, 2196.36 micrometers, in mitomycin group, and 2269.19 micrometers, in 5-fluorouracil group. CONCLUSION: Mitomycin and 5-fluorouracil had promoted beneficial change in vocal fold's cicatrization with less collagen deposition, but there was no significant statistically difference when they were compared between themselves.OBJETIVO: Avaliar a deposição das fibras de colágeno total em pregas vocais suínas após o uso tópico de mitomicina ou 5-fluorouracil nas exéreses parciais de mucosa com laser de CO2. MÉTODOS: Foram utilizados 18 porcos da raça Larger white anestesiados e submetidos à exérese de fragmento de mucosa de borda livre da prega vocal direita e prega vocal esquerda. Os animais foram divididos em 3 grupos com 6 animais cada: grupo controle, sem aplicação de medicação tópica; grupo mitomicina, com uso tópico dessa substância; grupo 5-fluorouracil, uso tópico. Após 30 dias do experimento os animais foram submetidos à eutanásia, coletadas amostras das pregas vocais e coradas pela técnica do picrosirius red com polarização para a

  10. The AP1000 reactor

    International Nuclear Information System (INIS)

    The design of the AP1000 reactor began 20 years ago when Westinghouse launched the AP600 reactor project. In fact by re-assessing AP600's safety margins Westinghouse realized that the its power output could be raised without putting at risk its safety standard. The AP1000 was born, it yields 1100 MWe. The main AP1000's design features is its passive safety (particularly after the Fukushima accident) and its modularity. The passive safety of the AP1000 implies: -) no humane intervention needed for 72 hours at least after the incident; -) no necessity for redundant complex safety systems. The modularity means that the plant, the reactor and other buildings are constructed from a choice of 300 modular units. These units can be built off-site and fit together on site. The modularity allows more construction activities to be led simultaneously and more chances to cope with the construction schedule. The NRC has approved the operation license for 30 years of the first AP1000 being built in the Usa (Vogtle plant in Georgia). 4 AP1000 are being built in China (Sanmen and Haiyang sites) and 6 others are planned in the Usa. Westinghouse is convinced that the AP1000's passive safety makes it more attractive. Let us not forget that Westinghouse was at the origin of the concept of pressurized water reactors, an idea adopted for half the nuclear power stations in the world and for all the plants now active in France. (A.C.)

  11. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  12. Do scientists trace hot topics?

    OpenAIRE

    Tian Wei; Menghui Li; Chensheng Wu; Xiao-Yong Yan; Ying Fan; Zengru Di; Jinshan Wu

    2013-01-01

    Do scientists follow hot topics in their scientific investigations? In this paper, by performing analysis to papers published in the American Physical Society (APS) Physical Review journals, it is found that papers are more likely to be attracted by hot fields, where the hotness of a field is measured by the number of papers belonging to the field. This indicates that scientists generally do follow hot topics. However, there are qualitative differences among scientists from various countries,...

  13. Fluorouracil Topical

    Science.gov (United States)

    ... topical solution are used to treat actinic or solar keratoses (scaly or crusted lesions [skin areas] caused by years of too much exposure to sunlight). Fluorouracil cream and topical solution are also used to treat ...

  14. Testosterone Topical

    Science.gov (United States)

    ... in which the body does not produce enough natural testosterone). Testosterone is used only for men with ... topical may control your symptoms but will not cure your condition. Continue to use testosterone topical even ...

  15. Bexarotene Topical

    Science.gov (United States)

    ... condition may improve as soon as 4 weeks after you begin to use topical bexarotene, or it may ... notice any improvement. Continue to use topical bexarotene after you notice improvement; your condition may continue to improve. ...

  16. Ectopic expression of FaesAP3, a Fagopyrum esculentum (Polygonaceae) AP3 orthologous gene rescues stamen development in an Arabidopsis ap3 mutant.

    Science.gov (United States)

    Fang, Zheng-wu; Qi, Rui; Li, Xiao-fang; Liu, Zhi-xiong

    2014-10-25

    Arabidopsis thaliana APETALA3 (AP3) and Antirrhinum majus DEFICIENS (DEF) MADS box genes are required to specify petal and stamen identity. AP3 and DEF are members of the euAP3 lineage, which arose by gene duplication coincident with radiation of the core eudicots. In order to investigate the molecular mechanisms underlying organ development in early diverging clades of core eudicots, we isolated and identified an AP3 homolog, FaesAP3, from Fagopyrum esculentum (buckwheat, Polygonaceae), a multi-food-use pseudocereal with healing benefits. Protein sequence alignment and phylogenetic analyses revealed that FaesAP3 grouped into the euAP3 lineage. Expression analysis showed that FaesAP3 was transcribed only in developing stamens, and differed from AP3 and DEF, which expressed in developing petals and stamens. Moreover, ectopic expression of FaesAP3 rescued stamen development without complementation of petal development in an Arabidopsis ap3 mutant. Our results suggest that FaesAP3 is involved in the development of stamens in buckwheat. These results also suggest that FaesAP3 holds some potential for biotechnical engineering to create a male sterile line of F. esculentum. PMID:25149019

  17. Syntactic Topic Models

    CERN Document Server

    Boyd-Graber, Jordan

    2010-01-01

    The syntactic topic model (STM) is a Bayesian nonparametric model of language that discovers latent distributions of words (topics) that are both semantically and syntactically coherent. The STM models dependency parsed corpora where sentences are grouped into documents. It assumes that each word is drawn from a latent topic chosen by combining document-level features and the local syntactic context. Each document has a distribution over latent topics, as in topic models, which provides the semantic consistency. Each element in the dependency parse tree also has a distribution over the topics of its children, as in latent-state syntax models, which provides the syntactic consistency. These distributions are convolved so that the topic of each word is likely under both its document and syntactic context. We derive a fast posterior inference algorithm based on variational methods. We report qualitative and quantitative studies on both synthetic data and hand-parsed documents. We show that the STM is a more pred...

  18. Online Focus Group Discussion is a Valid and Feasible Mode When Investigating Sensitive Topics Among Young Persons With a Cancer Experience

    Science.gov (United States)

    Eriksson, Lars E; Nilsson, Jenny; Jervaeus, Anna; Lampic, Claudia

    2016-01-01

    Background Clinical research often lacks participants of young age. Adding to the small amount of scientific studies that focus on the population entering adulthood, there are also difficulties to recruit them. To overcome this, there is a need to develop and scientifically evaluate modes for data collection that are suitable for adolescents and young adults. With this in mind we performed 39 online focus group discussions among young survivors of childhood cancer to explore thoughts and experiences around dating, being intimate with someone, and having children. Objective The aim of the study was to evaluate online focus group discussions as a mode for data collection on sensitive issues among young persons with a cancer experience. Methods One hundred thirty-three young persons (16-25 years) previously diagnosed with cancer, participated in 39 synchronous online focus group discussions (response rate 134/369, 36%). The mode of administration was evaluated by analyzing participant characteristics and interactions during discussions, as well as group members’ evaluations of the discussions. Results Persons diagnosed with central nervous tumors (n=30, 27%) participated to a lower extent than those with other cancer types (n=103, 39%; χ 2= 4.89, P=.03). The participants described various health impairments that correspond to what would be expected among cancer survivors including neuropsychiatric conditions and writing disabilities. Even though participants were interested in others’ experiences, sexual issues needed more probing by the moderators than did fertility-related issues. Group evaluations revealed that participants appreciated communicating on the suggested topics and thought that it was easier to discuss sex when it was possible to be anonymous toward other group members. Conclusions Online focus group discussions, with anonymous participation, are suggested to be a feasible and valid mode for collecting sensitive data among young persons with a

  19. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  20. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  1. AI Topics

    OpenAIRE

    Buchanan, Bruce G; Glick, Jonathan

    2002-01-01

    The debut of the AI in the News column elsewhere in this issue of AI Magazine created a good opportunity to introduce the professional community to the AI Topics web site, home of the AI in the news virtual page. Although AI Topics is designed for the lay public, it serves a much larger audience.

  2. APS Science 2009

    International Nuclear Information System (INIS)

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report), the challenge

  3. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  4. Estradiol Topical

    Science.gov (United States)

    ... a medication that is applied topically to the vagina. Estradiol is in a class of medications called ... swelling, redness, burning, irritation, or itching of the vagina vaginal discharge Some side effects can be serious. ...

  5. Angiogenesis, fibrinogenesis and presence of synechiae after exeresis of a swine vocal fold mucosal microflap and use of topical mitomycin-C Estudo da angiogênese, fibrogênese e presença de sinéquias após exérese de fragmento de mucosa de pregas vocais de suínos utilizando instrumental frio e mitomicina-C tópica

    Directory of Open Access Journals (Sweden)

    Vinicius Ribas de Carvalho Duarte Fonseca

    2010-02-01

    Full Text Available PURPOSE: To evaluate swine vocal fold healing in a period of 30 days after topical mitomycin-C application. METHODS: Twelve swine underwent exeresis of mucosal flaps from the free edge of the anterior third of both vocal folds with a cold instrument (laryngeal scissors. The animals were divided into two groups: EG (Experimental Group, consisting of 6 animals undergoing topical MMC application (4 mg/dL on the operated area for 4 minutes; CG (Control Group, 6 animals undergoing topical saline solution application on the operated area for 4 minutes. After 30 days, the animals were sacrificed and the larynges were collected and examined for the presence of synechiae as well as a histological immunohistochemical assessment of immature and mature collagen deposition, number of blood vessels and myofibroblasts. RESULTS: Mature collagen deposition in the EG was 452.12 μm² and 1332.31μm² in the CG; immature collagen deposition was 1511.73μm² in the EG and 1020.61μm² in the CG. The number of myofibroblasts was 1.556 in the EG and 3.583 in the CG. The number of blood vessels was 2.565 in EG and 6.917 in the CG. There were no synechiae in the two studied groups. CONCLUSIONS: There was an increase in immature collagen deposition in the experimental group when compared with the control group. There was a decrease in mature collagen deposition in the experimental group when compared with the control group. There was a decrease in the number of myofibroblasts in the experimental group when compared with the control group. A decrease in blood vessels was observed in the experimental group when compared with the control group. There was no synechia formation in either studied group.OBJETIVO: Avaliar a cicatrização de pregas vocais de suínos utilizando mitomicina-C tópica, em 30 dias. MÉTODOS: Doze suínos foram submetidos à exérese de mucosa do bordo livre do terço anterior de ambas as pregas vocais com instrumental frio (tesoura curva e divididos

  6. Spotlight Topics

    Science.gov (United States)

    A Spotlight Topic consists of a set of two or more review articles focused on a specific subject in surface science. The topics are recommended by the Board of Editors. A topic may be chosen because it is particularly new or fast-breaking, thus deserving introduction to the general readership. Or, it may be because a topic is especially controversial or confusing, requiring clarification by experts. Each review will give a critical assessment rather than an encyclopedic report. While our editors always will insist on fairness and accuracy, any review which forwards an opinion is bound to be somewhat subjective. Therefore, it is the editors' wish that the set of reviews written by different authors on the same subject matter will provide a broad and balanced viewpoint. It is often the case that an author who is an expert in a technique or method may be especially enthusiastic or critical about this technique or method. A companion review in the set may provide a different viewpoint. We are hopeful that the reader, after studying these reviews and checking some of the key references, will obtain an informed opinion of the subject. We think the set of reviews in a spotlight area will considerably shorten the ``learning time'' that a nonexpert would otherwise need to become knowledgeable about a subject. In this issue, we feature a spotlight topic on oxide surfaces. The set contains an overview article by Jacques Jupille, and four articles written by G. Pacchioni, F. Cosandey and T. E. Madey, B. G. Daniels, R. Lindsay and G. Thornton, and C. Noguera respectively. Of these, the article by Pacchioni has already appeared in SRL 7, 277 (2000). The other three articles appear in this issue. A reader who wishes to suggest a spotlight topic or recommend authors to write such reviews should contact the Editor-in-Chief. We would like to hear from you.

  7. Ciclopirox Topical

    Science.gov (United States)

    ... Use the applicator brush attached to the bottle cap to apply ciclopirox topical solution evenly to all affected nails. Also apply the ... the bottle cap and neck and replace the cap tightly on the bottle. Let the solution dry for about 30 seconds before you put ...

  8. Thermodynamics of Damaged DNA Binding and Catalysis by Human AP Endonuclease 1.

    Science.gov (United States)

    Miroshnikova, A D; Kuznetsova, A A; Kuznetsov, N A; Fedorova, O S

    2016-01-01

    Apurinic/apyrimidinic (AP) endonucleases play an important role in DNA repair and initiation of AP site elimination. One of the most topical problems in the field of DNA repair is to understand the mechanism of the enzymatic process involving the human enzyme APE1 that provides recognition of AP sites and efficient cleavage of the 5'-phosphodiester bond. In this study, a thermodynamic analysis of the interaction between APE1 and a DNA substrate containing a stable AP site analog lacking the C1' hydroxyl group (F site) was performed. Based on stopped-flow kinetic data at different temperatures, the steps of DNA binding, catalysis, and DNA product release were characterized. The changes in the standard Gibbs energy, enthalpy, and entropy of sequential specific steps of the repair process were determined. The thermodynamic analysis of the data suggests that the initial step of the DNA substrate binding includes formation of non-specific contacts between the enzyme binding surface and DNA, as well as insertion of the amino acid residues Arg177 and Met270 into the duplex, which results in the removal of "crystalline" water molecules from DNA grooves. The second binding step involves the F site flipping-out process and formation of specific contacts between the enzyme active site and the everted 5'-phosphate-2'-deoxyribose residue. It was shown that non-specific interactions between the binding surfaces of the enzyme and DNA provide the main contribution into the thermodynamic parameters of the DNA product release step. PMID:27099790

  9. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  10. APS Science 2007

    International Nuclear Information System (INIS)

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience

  11. Learning about Antiphospholipid Syndrome (APS)

    Science.gov (United States)

    ... and links from the National Institutes of Health. Learning About Antiphospholipid Syndrome (APS) What is antiphospholipid syndrome ( ... with APS include : Systemic Vascular Thrombosis While the deep veins of the legs are the most frequent ...

  12. Alkali-soluble fluoride deposition on enamel after professional application of topical fluoride in vitro Formação de flúor fracamente ligado ao esmalte após a aplicação tópica profissional de flúor in vitro

    OpenAIRE

    Mitsue Fujimaki Hayacibara; Adriana Franco Paes Leme; Ynara Bosco de Oliveira Lima; Nilza Cristina Lopez Afonso Valor Gonçalves; Celso Silva Queiroz; Maria José Gomes; Fábio Carlos Kozlowski

    2004-01-01

    Since the efficacy of topical fluoride products is related to the fluoride (F) availability and its reactivity with enamel, this study was conducted. The F concentration of the following materials was verified: I- acidulated phosphate fluoride (APF) gel (1.23% F), II- APF foam (1.23% F) and III- Varnish (2.26% F). Forty blocks of bovine enamel were divided into 4 groups and treated according to the materials described, being one of them used as control. Loosely bound fluoride (''CaF2'') was d...

  13. Preface: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik; Buttler, William; Furlanetto, Michael; Evans, William

    2014-05-01

    The 18th Biennial International Conference of the APS Topical Group on Shock Compression of Condensed Matter in conjunction with the 24th Biennial International Conference of the International Association for the Advancement of High Pressure Science & Technology (AIRAPT) was held at the Westin Hotel in Seattle, Washington from 7-12 July, 2013. This is only the second time that these two organizations have held a Joint Conference — the first was 20 years previous (1993) in Colorado Springs, Colorado. Seattle was chosen for this joint conference because of its central location for the world-wide attendees as well as its metropolitan vibrancy. The scientific program consisted of 858 scheduled presentations organized into 23 topical areas and included contributed (537), invited (95), and plenary (6) lectures, as well as two poster sessions with 110 posters each. The scientific focus of the Joint Conference was on fundamental and applied research topics related to the static or dynamic compression of condensed matter. This multidisciplinary field of research encompasses areas of physics, chemistry, materials science, mechanics, geophysics and planetary physics, and applied mathematics. Experimental, computational and theoretical studies all play important roles. The organizers endeavored to intertwine static and dynamic experimental alongside computational and theoretical studies of similar materials in the organization of the sessions. This goal was aided by the addition of three special focus sessions on deep carbon budget, high energy density materials, and dynamic response of materials. 722 scientists and engineers from 25 countries registered at the conference, including 132 students from 12 countries. The attendee countries represented included: Argentina (2), Australia (2), Brazil (3), Canada (25), China (22), Czech Republic (2), France (35), Germany (19), India (6), Israel (21), Italy (10), Japan (49), Netherlands (1), Poland (1), Portugal (2), Russia (26

  14. Two Successful Approaches to Teaching AP Government

    Science.gov (United States)

    Ladd, Brian; Stepp, Heidi

    2013-01-01

    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  15. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine

    2013-01-01

    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  16. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  17. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  18. Westinghouse AP1000 containment design

    International Nuclear Information System (INIS)

    The Westinghouse AP1000 Program is aimed at making available a nuclear power plant that is economical in the U.S deregulated electrical power industry in the near-term. The AP1000 is two-loop 1000 MWe pressurizer water reactor (PWR). It is an up rated version of the AP600. The AP1000 uses passive safety systems to provide significant and measurable improvements in plant simplification, safety, reliability, investment protection and plant costs. The AP1000 uses proven technology, which builds on 50 years of operating PWR experience. The AP1000 received Final Design Approval by the Nuclear Regulatory Commission in September 2004. The AP1000 is provided with a high integrity containment using a substantial steel pressure vessel. The steel surface is used to remove decay heat during design basis accidents. One of the other advantages of the AP1000 containment design over evolutionary PWRs, is improved containment isolation. This has been accomplished by reducing the number of penetrations by ∼50% and improving the isolation valves. As a result, the AP1000 will have fewer difficulties during containment leak testing. The AP1000 containment design meets the Advanced Light Water Reactor Utility Requirements Document (URD) requirements and has been reviewed and approved by the NRC, as was the AP600 containment design. Furthermore, the containment design has also been recognized as meeting the EUR containment requirements by the European utilities. This paper reviews the AP1000 containment vessel design, construction, post accident behavior, and severe accident performance. In addition, the radiation release models, assumptions and both short and long-term performance are also discussed. (authors)

  19. AP physics B crash course

    CERN Document Server

    Howell, Rebecca

    2012-01-01

    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  20. 胡萝卜AP2/ERF-B1亚族两个转录因子基因的克隆及其非生物胁迫响应分析%Isolation and Analysis of Expression Proifles under Abiotic Stress Treatments of Two AP2/ERF-B1 Group Transcription Factor Genes fromDaucus carota

    Institute of Scientific and Technical Information of China (English)

    黄蔚; 王枫; 谭国飞; 徐志胜; 李梦瑶; 熊爱生

    2014-01-01

    AP2/ERF是植物中普遍存在的一类重要转录因子,参与植物整个生命周期的生长发育和逆境信号转导。本研究以胡萝卜(Daucus carota)‘黑田五寸’为试验材料,基于其转录组和基因组数据,检索和拼接获得胡萝卜AP2/ERF家族2个转录因子基因序列g39811和g47170。采用RT-PCR方法,分别从‘黑田五寸’中克隆DcERF-B1-1(g39811)和DcERF-B1-2(g47170)转录因子基因。序列分析显示,胡萝卜DcERF-B1-1和DcERF-B1-2转录因子基因分别含有630个和594个开放阅读框,分别编码209和197个氨基酸;均含有相对保守的AP2结合域,具有典型的植物AP2/ERF类转录因子特征。从氨基酸组成成分、理化性质、亲水性/疏水性和三级结构上分析显示,胡萝卜DcERF-B1-1和DcERF-B1-2转录因子亲水性大于疏水性,其氨基酸序列可能属于亲水性蛋白。空间结构分析显示,它们都具有1个α螺旋和3个β折叠。进化树分析显示,二者均属于AP2/ERF家族转录因子中ERF亚族的B1组。实时定量荧光PCR显示,在低温、干旱、盐胁迫的条件下, DcERF-B1-2转录因子比DcERF-B1-1转录因子对逆境的响应更大;在高温的条件下, DcERF-B1-1转录因子比DcERF-B1-2转录因子对逆境的响应更大。%AP2/ERF is an important family of transcription factors in higher plant, which encoded proteins in-volved in the development and signal transduction of abiotic/biotic resistance in higher plant. Theg39811 and g47170 gene sequences, which encoding two AP2/ERF transcription factors, were isolated based on transcrip-tome and genome sequence data of carrot (Daucus carota). TheDcERF-B1-1 (g39811) andDcERF-B1-2 (g47170) genes were cloned by RT-PCR method using cDNA as template from carrot cultivar ‘Heitianwucun’. Then, nucleic acid and deduced amino acid sequence, phylogenetic tree, and molecular modeling were predicted and analyzed. Sequence analysis indicated that the length of

  1. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  2. [Topical contraceptives].

    Science.gov (United States)

    Alipov, V I; Korkhov, V V

    1982-02-01

    Recently there has been little interest in topical contraceptives. The most popular are the cervical cap and the diaphragm. Other types of mechanical contraceptive devices are being investigated. Standley and Kessler have developed a device for introduction into the cervical canal with a reservoir of spermatocide, it does not block the flow of blood during menstruation. New models of vaginal rings are also being developed which are simple enough for self-insertion and also contain a reservoir of spermatocide. Work is being done on spermatocide-containing sponges in many countries. Another project being investigated is the possibility of using natural proteins, collagens, and other substances which absorb spermatozoids. The ancients used various vaginal suppositories to kill spermatozoids; in the late 19th century quinine sulfate was used for this, and a variety of substances have been used recently. These spermicidal creams also have the advantage of acting as anti-infectious agents in many cases. But they do have some negative effects. They are about 85% effective, are local irritants, and some cause discomfort during intercourse. And it is possible that some are resorbed by the body and act on the liver and other organs. Vaginal globules and suppositories are also popular. The "Kontraceptin-T" brand contains quinosol, boric acid, and tannin. There are also foaming tablets which are mixed with water and then introduced. New locally-active chemical substances are being developed in Japan, West Germany, and the USSR. Kontraceptin-E contains paranonyl-phenoxypolyethylene glycol and sodium dioctylsulfosuccinate. The "Norforks" and other preparations contain mercurial compounds which may turn out to be harmful. The future promises the development of products which will act to prevent fertilization by acting on the hyaluronidase and the acrosine of the spermatozoid, thus preventing it from penetrating the ovum. It would be best to find enzyme inhibitors which are

  3. Linguistic Extensions of Topic Models

    Science.gov (United States)

    Boyd-Graber, Jordan

    2010-01-01

    Topic models like latent Dirichlet allocation (LDA) provide a framework for analyzing large datasets where observations are collected into groups. Although topic modeling has been fruitfully applied to problems social science, biology, and computer vision, it has been most widely used to model datasets where documents are modeled as exchangeable…

  4. AP-42 REVISION: COKE OVENS

    Science.gov (United States)

    The document "Compilation of Air Pollutant Emission Factors" (AP-42) has been published by the U. S. Environmental Protection Agency (EPA) since 1972. Supplements to AP-42 have been routinely published to add new emission source categories and to update existing emission factor...

  5. AP1000. The PWR revisited

    International Nuclear Information System (INIS)

    The distinguishing features of Westinghouse's AP1000 advanced passive pressurized water reactor are highlighted. In particular, the AP1000's passive safety features are described as well as their implications for simplifying the design, construction, and operation of this design compared to currently operating plants, and significantly increasing safety margins over current plants as well. The AP1000 design specifically incorporates the knowledge acquired from the substantial accumulation of power reactor operating experience and benefits from the application of the Probabilistic Risk Assessment in the design process itself. The AP1000 design has been certified by the US Nuclear Regulatory Commission under its new rules for licensing new nuclear plants, 10 CFR Part 52, and is the subject of six combined Construction and Operating License applications now being developed. Currently the AP1000 design is being assessed against the EUR Rev C requirements for new nuclear power plants in Europe. (author)

  6. AP600 Shield building

    International Nuclear Information System (INIS)

    In order to minimize capital costs and save time in the global construction time schedule for the AP600 Nuclear Power Plant, planned in 36 months from excavation up to the fuel charging, ANSALDO has developed an innovative Shield Building Conical Roof design having the following basic characteristics: i) can be erected approximately in less than two months; ii) allows the functionality of the Passive Containment Cooling System (PCSS) located in the PCCS tank and in the Valve Room anchored directly to the conical roof itself; iii) satisfies the structural loads design as Safe Shutdown Earthquake, or the Aircraft Crash and both integrated with the sloshing analysis for the tank located at the top of the conical roof. The most important aspects of this new roof are: a) use of prefabricated precast panels; b) address the erection of the formworks using temporary structures having the capability of becoming final elements; c) develop a modular rebars sizing and design in order to perform the most important portion of the job in the workshop; d) second pouring construction sequence assuring full integration with the formwork function; e) modular construction of the PCSS tank at the top of the conical roof. An interesting evaluation has been also performed in calculating sloshing phenomenon in the PCSS tank by comparing detailed 3D Finite Element Model approach and simplified qualified formulas dedicated to this phenomenon. (author). 2 figs

  7. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    International Nuclear Information System (INIS)

    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP

  8. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-03-04

    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP.

  9. Enfrentamento da violência doméstica por um grupo de mulheres após a denúncia A group of women coping with domestic violence after the denouncements

    Directory of Open Access Journals (Sweden)

    Eriza de Oliveira Parente

    2009-08-01

    Full Text Available Este estudo analisa as formas de enfrentamento encontradas por mulheres vítimas da violência doméstica, no decorrer e após a denúncia, em Fortaleza, Ceará, Brasil. Com abordagem qualitativa e caracterizando-se como pesquisa participante, nove mulheres, que se denominaram vítimas de violência doméstica e romperam com o silêncio fazendo a denúncia, participaram do estudo, de agosto a outubro de 2007, no Centro Estadual de Referência e Apoio à Mulher (CERAM. Grupo focal, anotações no diário de campo e observações foram as técnicas de coleta de dados, e estes foram submetidos à análise categorial e discutidos com suporte no Modelo de Crenças em Saúde. O medo, a falta de apoio, a dependência financeira, a vergonha, a maternidade e a cultura emergiram do estudo como percepção da suscetibilidade e das barreiras identificadas; o risco de morte foi percebido como severidade; o apoio da família e de amigos, a lei, os setores de proteção e Deus foram os benefícios relatados, configurando-se como formas de enfrentamento. Para elas, a violência ultrapassou os limites da natureza física, pois envolveu sofrimento psicológico, emocional, econômico e social. Desse modo, essas mulheres romperam o silêncio presente nas relações violentas e procuraram estratégias para minimizar o sofrimento.This paper provides an analysis of confrontation ways that female victims of domestic violence found during and after denunciation in Fortaleza, Ceará, Brazil. Nine women self-denominated victims of violence who broke silence and denunciated their aggressors participated in this qualitative and participative research from August to October 2007, in the State Center of Reference for Women Support (CERAM. The data collectors used the focal group, the reports in the field diary and observation, and the data were submitted to categorical analysis, and discussed based on Health Belief Model. Fear, lack of support, financial dependence, shame

  10. On-line Hot Topic Recommendation Using Tolerance Rough Set Based Topic Clustering

    OpenAIRE

    Yonghui Wu; Yuxin Ding; Xiaolong Wang; Jun Xu

    2010-01-01

    In this paper we present our research of online hot topic detection and label extraction method for our hot topic recommendation system. Using a new topical feature selection method, the feature space is compressed suitable for an online system. The tolerance rough set model is used to enriching the small set of topical feature words to a topical approximation space. According to the distance defined on the topical approximation space, the web pages are clustered into groups which will be mer...

  11. Randomized, parallel-group, double-blind, controlled study to evaluate the efficacy and safety of carbohydrate-derived fulvic acid in topical treatment of eczema

    Directory of Open Access Journals (Sweden)

    Gandy JJ

    2011-09-01

    Full Text Available Justin J Gandy, Jacques R Snyman, Constance EJ van RensburgDepartment of Pharmacology, Faculty of Health Sciences, University of Pretoria, Pretoria, South AfricaBackground: The purpose of this study was to evaluate the efficacy and safety of carbohydrate-derived fulvic acid (CHD-FA in the treatment of eczema in patients two years and older.Methods: In this single-center, double-blind, placebo-controlled, parallel-group comparative study, 36 volunteers with predetermined eczema were randomly assigned to receive either the study drug or placebo twice daily for four weeks.Results: All safety parameters remained within normal limits, with no significant differences in either group. Significant differences were observed for both severity and erythema in the placebo and CHD-FA treated groups, and a significant difference was observed for scaling in the placebo-treated group. With regard to the investigator assessment of global response to treatment, a significant improvement was observed in the CHD-FA group when compared with the placebo group. A statistically significant decrease in visual analog scale score was observed in both groups, when comparing the baseline with the final results.Conclusion: CHD-FA was well tolerated, with no difference in reported side effects other than a short-lived burning sensation on application. CHD-FA significantly improved some aspects of eczema. Investigator assessment of global response to treatment with CHD-FA was significantly better than that with emollient therapy alone. The results of this small exploratory study suggest that CHD-FA warrants further investigation in the treatment of eczema.Keywords: fulvic acid, eczema, anti-inflammatory, efficacy, safety

  12. Westinghouse AP 1000 program status

    International Nuclear Information System (INIS)

    The project 1000 is presented and features are discussed in the paper. Design maturity is characterized by 1300 man-year / $400 million design and testing effort, more than 12 000 design documents completed; 3D computer model developed. It includes structures, equipment, small / large pipe, cable trays, ducts etc. Licensing Maturity is determined by a very thorough and complete NRC review of AP600; 110 man-year effort (NRC) over 6 years, $30 million; independent, confirmatory plant analysis; independent, confirmatory plant testing (ROSA, OSU); over 7400 questions answered, no open items; over 380 meeting with NRC, 43 meetings with ACRS. NRC Design Certification is issued in December 1999. Reasons for developing AP 1000 and design changes are presented. Economic analysis shows an expectation for payback within 20 years. AP1000 provides 75% power uprate for 15% increment in capital cost. AP1000 meets new plant economic targets in the near term

  13. Meet the APS Journal Editors

    Science.gov (United States)

    2016-05-01

    The Editors of the APS journals invite you to join them for conversation. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  14. On-line Hot Topic Recommendation Using Tolerance Rough Set Based Topic Clustering

    Directory of Open Access Journals (Sweden)

    Yonghui Wu

    2010-04-01

    Full Text Available In this paper we present our research of online hot topic detection and label extraction method for our hot topic recommendation system. Using a new topical feature selection method, the feature space is compressed suitable for an online system. The tolerance rough set model is used to enriching the small set of topical feature words to a topical approximation space. According to the distance defined on the topical approximation space, the web pages are clustered into groups which will be merged with document overlap. The topic labels are extracted based on the approximation topical space enriched with the useful but high frequency topical words dropped by the clustering process. The experiments show that our method could generate more information abundant classes and more topical class labels, alleviate the topical drift caused by the non-topical and noise words.

  15. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  16. Foreword: 18th Aps-Sccm and 24th Airapt

    Science.gov (United States)

    Collins, Gilbert; Moore, David S.; Yoo, Choong-Shik

    2014-05-01

    This second joint conference between the APS Topical Group on Shock Compression of Condensed Matter and the International Association for the Advancement of High Pressure Science and Technology (AIRAPT) demonstrates that static and dynamic compression of condensed matter continues to be a vibrant field of science and engineering. It is also by its nature an interdisciplinary field, incorporating chemistry, materials science, solid mechanics, plasma physics, and condensed matter physics, and utilizes theoretical, computational, and experimental tools. Recent years have brought about many advances in loading platforms, diagnostics, and computations that are leading to the emergence of many new avenues of research. These advances are also breathing new life into traditional topics such as equations of state, phase transformations, and chemistry at extreme conditions. The plenary lectures by Gennady Kanel, Karl Syassen, David Ceperley, Jon Eggert, Duck Young Kim, and Richard Kraus spanned the disciplines of static and dynamic high pressure physics and illustrated the breadth of the field. They also showed that interesting and important problems remain for researchers of the future to solve. The main guiding principal in the organization of this conference was to intertwine static and dynamical experimental alongside computational and theoretical studies of similar materials. To achieve this goal, we arranged the conference to include static, dynamic, and computational components in the same sessions, quite often taking presenters out of their comfort zone. The three special sessions on Deep Carbon Budget (organized by Giulia Galli and Rus Hemley), High Energy Density Materials (organized by Raymond Jeanloz and Jon Eggert), and Dynamic Response of Materials (organized by Yogendra Gupta and John Sarrao) furthered this guiding principal. We also endeavored to represent the breadth of static and dynamic high pressure science and technology, notably beyond that done at

  17. Pirt/scaling assessment for AP1000

    International Nuclear Information System (INIS)

    The AP1000 is an up-rated version of the AP600 passive plant design that recently received final design certification from the US NRC. Like AP600, the AP1000 is a two-loop, pressurized water reactor featuring passive core cooling and passive containment safety systems. As the AP1000 design is essentially a scaled-up version of the AP600, it is expected that the AP600 Phenomena Identification and Ranking Tables (PIRTs) and much of the AP600 test database should be applicable in applying for design certification for the AP1000. In an effort to confirm this for pursuit of a license, the PIRTs and test facility scaling are re-assessed in view of AP1000. (author)

  18. Topics on continua

    CERN Document Server

    Macias, Sergio

    2005-01-01

    Specialized as it might be, continuum theory is one of the most intriguing areas in mathematics. However, despite being popular journal fare, few books have thoroughly explored this interesting aspect of topology. In Topics on Continua, Sergio Macías, one of the field's leading scholars, presents four of his favorite continuum topics: inverse limits, Jones's set function T, homogenous continua, and n-fold hyperspaces, and in doing so, presents the most complete set of theorems and proofs ever contained in a single topology volume. Many of the results presented have previously appeared only in research papers, and some appear here for the first time. After building the requisite background and exploring the inverse limits of continua, the discussions focus on Professor Jones''s set function T and continua for which T is continuous. An introduction to topological groups and group actions lead to a proof of Effros''s Theorem, followed by a presentation of two decomposition theorems. The author then offers an...

  19. Environmental Sensitivity in Nuclear Emergencies in Rural and Semi-natural Environments. Report of Working Group 8, Environmental Sensitivity of EMRAS II Topical Heading Approaches for Assessing Emergency Situations. Environmental Modelling for RAdiation Safety (EMRAS II) Programme

    International Nuclear Information System (INIS)

    Environmental assessment models are used for evaluating the radiological impact of actual and potential releases of radionuclides to the environment. They are essential tools for use in the regulatory control of routine discharges to the environment and also in planning measures to be taken in the event of accidental releases. They are also used for predicting the impact of releases which may occur far into the future, for example, from underground radioactive waste repositories. It is important to verify, to the extent possible, the reliability of the predictions of such models by comparison with measured values in the environment or by comparing them with the predictions of other models. The IAEA has been organizing programmes of international model testing since the 1980s. The programmes have contributed to a general improvement in models, in transfer data and in the capabilities of modellers in Member States. IAEA publications on this subject over the past three decades demonstrate the comprehensive nature of the programmes and record the associated advances which have been made. From 2009 to 2011, the IAEA organized a programme entitled Environmental Modelling for RAdiation Safety (EMRAS II), which concentrated on the improvement of environmental transfer models and the development of reference approaches to estimate the radiological impacts on humans, as well as on flora and fauna, arising from radionuclides in the environment. The following topics were addressed in nine working groups: Reference Approaches for Human Dose Assessment - Working Group 1: Reference Methodologies for Controlling Discharges of Routine Releases; - Working Group 2: Reference Approaches to Modelling for Management and Remediation at NORM and Legacy Sites; - Working Group 3: Reference Models for Waste Disposal Reference Approaches for Biota Dose Assessment; - Working Group 4: Biota Modelling; - Working Group 5: Wildlife Transfer Coefficient Handbook; - Working Group 6: Biota Dose

  20. Scaling of the AP600 containment large scale test facility

    International Nuclear Information System (INIS)

    The Large Scale Test (LST) Facility is an integral effects test facility which provides experimental data for validation of heat and mass transfer correlations used in WGOTHIC, the analysis code for the AP600 containment atmosphere. The LST tests consist of a series of pressurization transients in a 1/8th scale containment vessel with simulated internal heat sinks and passive containment cooling system (PCCS). These pressurization transients provide a range of transient as well as steady state data. To establish the applicability of the LST data as an integral effects facility to the AP600 containment; top-down, system-level scaling and bottom-up scaling similar to that described by Zuber (Hierarchical, Two-Tiered Scaling Methodology, 1991) were used to license the AP600 containment. Top-down, system-level scaling applied to the AP600 containment and the LST facility is the focus of this paper. Since pressure is the parameter of primary importance for the AP600 containment, the top-down, system-level scaling effort focuses on physical phenomena or processes such as heat and mass transfer. A detailed order of magnitude analysis by Spencer et al. (1997) has shown break mass-energy release, convection heat transfer, and mass transfer (condensation and evaporation) to be the dominant phenomena associated with the AP600 passive containment. To capture the aggregate influence (on pressure) of these dominant phenomena inside the AP600 containment, a simplified Rate of Pressure Change (RPC) equation is used. Variables in this equation are normalized using reference values associated with containment. The resulting coefficients in the non-dimensional RPC equation represent scaling groups which are numerically evaluated for AP600 and the LST. By comparing the magnitude of the ratios of the scaling groups for AP600 and LST, the applicability of LST data to AP600 is quantitatively assessed to judge whether the test facility is adequately scaled. Scaling ratios within the

  1. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  2. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  3. The AP-2 family of transcription factors

    OpenAIRE

    Eckert, Dawid; Buhl, Sandra; Weber, Susanne; Jäger, Richard; Schorle, Hubert

    2005-01-01

    The AP-2 family of transcription factors consists of five different proteins in humans and mice: AP-2α, AP-2β, AP-2γ, AP-2δ and AP-2ε. Frogs and fish have known orthologs of some but not all of these proteins, and homologs of the family are also found in protochordates, insects and nematodes. The proteins have a characteristic helix-span-helix motif at the carboxyl terminus, which, together with a central basic region, mediates dimerization and DNA binding. The amino terminus contains the tra...

  4. Panel Discussion : Report of the APS Ad-Hoc Committee on LGBT Issues

    Science.gov (United States)

    Atherton, Tim; Barthelemy, Ramon; Garmon, Savannah; Reeves, Kyle; APS Ad-Hoc Committee on LGBT Issues Team

    Following the presentation of the findings and recommendations of the APS Ad-Hoc Committee on LGBT Issues (C-LGBT) by Committee Chair Michael Falk, a panel discussion will be held featuring several members of the committee. The discussion will focus on how APS can best ensure the recommendations of the committee are carried out in a timely fashion and other ideas on future APS efforts toward LGBT inclusion in physics. Discussion topics will also include the research and other input that shaped the committee's findings and recommendations.

  5. Doppler Imaging of Ap Stars

    OpenAIRE

    Kuschnig, R.

    1998-01-01

    Doppler imaging, a technique which inverts spectral line profile variations of an Ap star into a two-dimensional abundance maps, provides new observational constraints on diffusion mechanism in the presence of a global magnetic field. A programme is presented here with the aim to obtain abundance distributions of at least five elements on each star, in order to study how different diffusion processes act under influence of a stellar magnetic field. The importance of this multi-element approac...

  6. The APS control system network

    International Nuclear Information System (INIS)

    The APS accelerator control system is a distributed system consisting of operator interfaces, a network, and computer-controlled interfaces to hardware. This implementation of a control system has come to be called the open-quotes Standard Model.close quotes The operator interface is a UNDC-based workstation with an X-windows graphical user interface. The workstation may be located at any point on the facility network and maintain full functionality. The function of the network is to provide a generalized communication path between the host computers, operator workstations, input/output crates, and other hardware that comprise the control system. The crate or input/output controller (IOC) provides direct control and input/output interfaces for each accelerator subsystem. The network is an integral part of all modem control systems and network performance will determine many characteristics of a control system. This paper will describe the overall APS network and examine the APS control system network in detail. Metrics are provided on the performance of the system under various conditions

  7. Preparing Students for the AP Psychology Exam

    Science.gov (United States)

    Whitlock, Kristin

    2013-01-01

    The Advanced Placement Psychology exam is one of the fastest growing exams offered by the College Board. The average percent of change in the number of students taking this exam over the past five years is 12.4%. With 238,962 students taking the exam in 2013, the AP Psychology exam is the sixth largest exam, surpassing AP Biology and AP World…

  8. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  9. Topic and Textual Coherence

    Institute of Scientific and Technical Information of China (English)

    何明烈; 戢焕奇

    2008-01-01

    Based on the investigation of the origin and definition of topic as well as the classification of textual coherence, this paper ana-lyzes the function of topic to non-coherence, imphcit coherence and explicit coherence, and concludes that topic relevance is the primary cri-terion for textual coherence.

  10. Freshman Health Topics

    Science.gov (United States)

    Hovde, Karen

    2011-01-01

    This article examines a cluster of health topics that are frequently selected by students in lower division classes. Topics address issues relating to addictive substances, including alcohol and tobacco, eating disorders, obesity, and dieting. Analysis of the topics examines their interrelationships and organization in the reference literature.…

  11. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  12. Credibility improves topical blog post retrieval

    OpenAIRE

    Weerkamp, W.; Rijke, de, M.

    2008-01-01

    Topical blog post retrieval is the task of ranking blog posts with respect to their relevance for a given topic. To improve topical blog post retrieval we incorporate textual credibility indicators in the retrieval process. We consider two groups of indicators: post level (determined using information about individual blog posts only) and blog level (determined using information from the underlying blogs). We describe how to estimate these indicators and how to integrate them into a retrieval...

  13. An evaluation of the B&W Owners Group BAW-10182 topical report: Justification for increasing the engineered safety features actuation system on-line test intervals. Technical evaluation report

    Energy Technology Data Exchange (ETDEWEB)

    Smith, C.L.; Hansen, J.L.

    1993-09-01

    This Technical Evaluation Report provides an evaluation of the Babcock and Wilcox Owners Group (B&WOG) Technical Specifications Committee Topical Report BAW-10182, entitled, ``Justification for Increasing Engineered Safety Features Actuation System (ESFAS) On-Line Test Intervals.`` This evaluation was performed by the Idaho National Engineering Laboratory in support of the Nuclear Regulatory Commission. The BAW-10182 report presents justification for the extension of on-line test intervals from the existing one-month interval to a three-month interval for the ESFAS system. In the BAW-10182 report, the B&WOG stated that ``{hor_ellipsis}the B&WOG proposes to increase the ESFAS test interval from one to three months and concludes that the effect on plant risk is insignificant.`` The proposed extension was based upon risk-based [i.e., probabilistic risk assessment (PRA)] methods such as reliability block diagrams, uncertainty analyses, and time-dependent system availability analyses. This use of PRA methods requires a detailed evaluation to determine whether the chosen methods and their application are valid in the context of the proposed test interval extension. The results of the evaluation agreed that the effect on plant risk is small if the ESFAS test interval is extended to three months for the ESFAS designs that were evaluated.

  14. APS high heat load monochromator

    Energy Technology Data Exchange (ETDEWEB)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach.

  15. APS high heat load monochromator

    International Nuclear Information System (INIS)

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  16. Topical report review status

    International Nuclear Information System (INIS)

    A Topical Report Review Status is scheduled to be published semi-annually. The primary purpose of this document is to provide periodic progress reports of on-going topical report reviews, to identify those topical reports for which the Nuclear Regulatory Commission (NRC) staff review has been completed and, to the extent practicable, to provide NRC management with sufficient information regarding the conduct of the topical report program to permit taking whatever actions deemed necessary or appropriate. This document is also intended to be a source of information to NRC Licensing Project Managers and other NRC personnel regarding the status of topical reports which may be referenced in applications for which they have responsibility. This status report is published primarily for internal NRC use in managing the topical report program, but is also used by NRC to advise the industry of report review status

  17. Topical treatment of melasma

    OpenAIRE

    Bandyopadhyay Debabrata

    2009-01-01

    Melasma is a common hypermelanotic disorder affecting the face that is associated with considerable psychological impacts. The management of melasma is challenging and requires a long-term treatment plan. In addition to avoidance of aggravating factors like oral pills and ultraviolet exposure, topical therapy has remained the mainstay of treatment. Multiple options for topical treatment are available, of which hydroquinone (HQ) is the most commonly prescribed agent. Besides HQ, other topical ...

  18. Current topics in radiation measurements

    International Nuclear Information System (INIS)

    Current research topics in radiation measurements will be shown in this presentation. Applications of radiation measurements have grown with the development of radiation sources and new measurement techniques. Recent new developments in this field are briefly introduced. Optical techniques such as lasers and fiber optics, which are widely used in an optical communication field, are successfully applied to radiation measurements. Micro-fabrication techniques and the photolithography technique are indispensable for semiconductor or even gas detectors. Complicated analog signal processing is being simplified by the use of fast computation techniques available in digital chips. Cryogenic X-ray detectors are making a great progress in the energy resolution. Some of the current research topics found in the recent journals and international symposiums are as follows: the development of room temperature semiconductor radiation detectors like CdZnTe and SiC, new signal processing methods such as coplanar grid unipolar charge sensing, medical γ-ray imaging, the development of cryogenic X-ray detectors such as STJs (Superconducting Tunnel Junction) and TES (Transition Edge Sensor) microcalorimeters, micromachined gas proportional counters like MSGC/MGC/GEM, new detection system which requires both the energy and spatial resolutions, the search of longer wavelength scintillators, development of new fast scintillators such as LSO/YAP/LuAP, new digital waveform processing based on fast digitizing technique, etc. Current developments are especially focused on the increase of the information derived from the detector and the improvement in the resolution. One of the other directions of the development is toward the microscopic visualization of the radiation. Such an approach must solve many technological difficulties both in fabrication of the detectors and even in the detection scheme, however, we might proceed to open a new phase of radiation measurements soon. (author)

  19. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document

  20. APS: Lighting up the future

    International Nuclear Information System (INIS)

    Work on the Advanced Photon Source (APS) at Argonne National Laboratory (ANL) involves the construction and supporting research and development for a national user facility for synchrotron radiation research in the x-ray region. The facility, when operational in 1997, will provide super-intense x-ray beams for many areas of basic research and will serve the entire US x-ray research community of several thousand users. This paper describes the pertinent features of the design, construction and planned operation of the facility; and the impact quality has had in these areas. In addition, the introduction of several quality management techniques such as total quality management, reliability/availability planning, and user interface are discussed concerning their status and success

  1. Syntacticized topics in Kurmuk

    DEFF Research Database (Denmark)

    Andersen, Torben

    2015-01-01

    This article argues that Kurmuk, a little-described Western Nilotic language, is characterized by a syntacticized topic whose grammatical relation is variable. In this language, declarative clauses have as topic an obligatory preverbal NP which is either a subject, an object or an adjunct. The gr...

  2. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin

    2012-01-01

    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  3. Topics in Social Psychology: Further Classroom Demonstrations.

    Science.gov (United States)

    Singleton, Royce, Jr.; Kerber, Kenneth W.

    1980-01-01

    Presents ideas for stimulating students' interest in college level sociology courses by involving students in individual v group decision making, nonverbal communication, romantic love, and ethnic stereotypes. Tips for organizing classroom demonstrations around these topics are presented. (Author/DB)

  4. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  5. PREFACE: CEWQO Topical Issue CEWQO Topical Issue

    Science.gov (United States)

    Bozic, Mirjana; Man'ko, Margarita

    2009-09-01

    Sascha Wallentowitz), 2004 (Trieste, Italy, by Naseem Rahman and Sascha Wallentowitz), 2005 (Bilkent, Ankara, by Alexander Shumovsky), 2006 (Vienna, by Helmut Rauch), 2007 (Palermo, Italy, by Antonino Messina) and 2008 (Belgrade, by Mirjana Bozic). The CEWQO series developed in two directions following the rapid development of quantum optics and the transitional development of the scientific collaboration of Central European researchers with researchers from old and new emerging Central European countries, and from all over the world. The topics discussed at CEWQO 08 were divided into ten groups that aimed to cover the broad scope of modern quantum optics: Fundamental aspects of quantum optics and quantum mechanics Single photons and photon pairs Cavity and circuit QED Atoms in intense fields Neutron, atom and molecular quantum optics Quantum gases and fluids Coherence, entanglement and decoherence Optical properties of condensed matter and nanostructures Open quantum systems and chaos Quantum information processing Central European Workshops on Quantum Optics realize and are consistent with a wider idea, and a social, economical, cultural and political program promoted since 1989 by the Central European Initiative (CEI), the main goal of which was to help transition countries in Central Europe to become closer to the EU. The resulting support of the CEI, first obtained thanks to the scientific reputation, organizing activities, and efforts of Helmut Rauch, has been very important for the organization of the CEWQO in recent years, particularly in 2008. The support of the Sixth and Seventh Framework Programs of the European Commission was also very important. A short review of papers in this topical issue A principal role in this topical issue is played by the photon. Vuletic et al describe the mapping of the photon-polarization state onto a single collective-spin excitation (magnon) shared between two atomic ensembles. A heralded quantum memory based on this mapping is

  6. Therapeutic Effect of Intrastromal Voriconazole, Topical Voriconazole, and Topical Natamycin on Fusarium Keratitis in Rabbit

    Science.gov (United States)

    Nejabat, Mahmood; Yaqubi, Nafiseh; Khosravi, Amir; Zomorodian, Kamiar; Ashraf, Mohammad Javad; Salouti, Ramin

    2016-01-01

    Purpose. Evaluating the therapeutic effect of topical and intrastromal voriconazole and topical natamycin on Fusarium keratitis. Methods. 24 rabbits were selected. The stroma of their corneas was inoculated with suspension of Fusarium solani species complex. Seven days after injection they were divided into 4 groups randomly: the first group was treated with topical voriconazole (TV) 1% for one week, the second one with one-time intrastromal injection of voriconazole (ISV) 50 microgram/0.1 mL, and the third group with topical gel of natamycin (TN) for one week, and the last one did not receive any antifungal treatment. Finally the eyes were enucleated and sclerocorneal buttons were sent for histological and microbiological examinations. Results. After treatment the ISV group and TN group showed significantly lower clinical score and colony forming units than the control group (P = 0.040 and P = 0.026, resp.), but there was statistically no significant difference between control and TV groups (P = 0.249) or between ISV and TN groups (P = 0.665). In pathological evaluation, fewer chronic inflammations were reported in 2 of the 3 buttons from TV group and 3 of the 3 buttons from ISV and TN groups in comparison with the control group. Conclusion. Intrastromal injection of voriconazole seems to be effective in treatment of Fusarium keratitis as much as topical natamycin and these are more effective than topical voriconazole.

  7. Berberine inhibits cyclin D1 expression via suppressed binding of AP-1 transcription factors to CCND1 AP-1 motif

    Institute of Scientific and Technical Information of China (English)

    Ye LUO; Yu HAO; Tai-ping SHI; Wei-wei DENG; Na LI

    2008-01-01

    Aim: To verify the suppressive effect of berberine on the proliferation of the human pulmonary giant cell carcinoma cell line PG and to demonstrate the mecha-nisms behind the antitumoral effects of berberine. Methods: The proliferative effects of PG cells were detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide colorimetry. The cell cycle was examined by flow cytometry. The expression level of cyclin D1 was detected by RT-PCR. The activities of the activating protein-1 (AP-1) and NF-κB signaling pathways related to cyclin D1 were examined by luciferase assay. The cytoplasmic level of c-Jun was detected by Western blot analysis. An electrophoretic mobility shift assay was used to examiae the binding of transcription factors to the cyclin D1 gene (CCNDl) AP-1 motif. Results: The results showed that the proliferation of PG cells treated with different concentrations (10, 20, and 40 μg/mL) of berberine for 24 and 48 h was suppressed significantly compared to the control group. After treatment with berberine, the proportion of PG cells at the G0/G1 phase increased, while cells at the S and G2/M phases decreased. Berberine could inhibit the expression of cyclin D1 in PG cells. Berberine inhibited the activity of the AP-1 signaling pathway, but had no significant effect on the NF-κB signaling pathway. Berberine suppressed the expression of c-Jun and decreased the binding of tran-scription factors to the CCND1 AP-1 motif. Conclusion: Berberine suppresses the activity of the AP-1 signaling pathway and decreases the binding of transcrip-tion factors to the CCND1 AP-1 motif. This is one of the important mechanisms behind the antitumoral effects of berberine as a regulator of cyclin D1.

  8. Duplication of AP1 within the Spinacia oleracea L. AP1/FUL clade is followed by rapid amino acid and regulatory evolution.

    Science.gov (United States)

    Sather, D Noah; Golenberg, Edward M

    2009-02-01

    The AP1/FUL clade of MADS box genes have undergone multiple duplication events among angiosperm species. While initially identified as having floral meristem identity and floral organ identity function in Arabidopsis, the role of AP1 homologs does not appear to be universally conserved even among eudicots. In comparison, the role of FRUITFULL has not been extensively explored in non-model species. We report on the isolation of three AP1/FUL genes from cultivated spinach, Spinacia oleracea L. Two genes, designated SpAPETALA1-1 (SpAP1-1) and SpAPETALA1-2 (SpAP1-2), cluster as paralogous genes within the Caryophyllales AP1 clade. They are highly differentiated in the 3', carboxyl-end encoding region of the gene following the third amphipathic alpha-helix region, while still retaining some elements of a signature AP1 carboxyl motifs. In situ hybridization studies also demonstrate that the two paralogs have evolved different temporal and spatial expression patterns, and that neither gene is expressed in the developing sepal whorl, suggesting that the AP1 floral organ identity function is not conserved in spinach. The spinach FRUITFULL homolog, SpFRUITFULL (SpFUL), has retained the conserved motif and groups with Caryophyllales FRUITFULL homologs. SpFUL is expressed in leaf as well as in floral tissue, and shows strong expression late in flower development, particularly in the tapetal layer in males, and in the endothecium layer and stigma, in the females. The combined evidence of high rates of non-synonymous substitutions and differential expression patterns supports a scenario in which the AP1 homologs in the spinach AP1/FUL gene family have experienced rapid evolution following duplication. PMID:19005675

  9. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  10. Coaching Strategies for AP: Building a Successful AP European History Program

    Science.gov (United States)

    Fornaciari, Jim

    2014-01-01

    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's…

  11. The status of APS, BESSRC, and NEET.

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Dunford, R. W.; Esbensen, H.; Gemmell, D. S.; Kanter, E. P.; Kraessig, B.; Rutt, U.; Southworth, S. H.

    1999-03-10

    We present a brief summary of the current status of the Advanced Photon Source (APS) at Argonne National Laboratory and of the facilities at two of the APS sectors operated by the Basic Energy Sciences Synchrotrons Radiation Center (BESSRC). This is followed by a report on recent measurements at BESSRC on the phenomenon of Nuclear Excitation by Electronic Transition (NEET).

  12. The status of APS, BESSRC, and NEET

    International Nuclear Information System (INIS)

    We present a brief summary of the current status of the Advanced Photon Source (APS) at Argonne National Laboratory and of the facilities at two of the APS sectors operated by the Basic Energy Sciences Synchrotrons Radiation Center (BESSRC). This is followed by a report on recent measurements at BESSRC on the phenomenon of Nuclear Excitation by Electronic Transition (NEET)

  13. AP Courses Get Audited for Quality

    Science.gov (United States)

    Ashford, Ellie

    2007-01-01

    As the college admissions process has gotten much more competitive, the number of high school students taking Advanced Placement (AP) courses has soared. At the same time, policymakers and education leaders seek to get more minorities and students not on the college track to sign up for AP and other rigorous classes. But as high schools have…

  14. AP-42 ADDITIONS AND REVISIONS - WILDLAND FIRES

    Science.gov (United States)

    This project is aimed at consolidating, selecting, and disseminating the most appropriate data and methods for estimating air emissions from wildfires and prescribed burns. The product will replace a current section of AP-42, but may not take the precise form of an AP-42 secti...

  15. Topics in Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Some topics in nuclear astrophysics are discussed, e.g.: highly evolved stellar cores, stellar evolution (through the temperature analysis of stellar surface), nucleosynthesis and finally the solar neutrino problem. (L.C.)

  16. Topical anesthesia in phacoemulsification

    Directory of Open Access Journals (Sweden)

    Saad Waheeb

    2010-01-01

    Conclusion : Topical anesthesia is a satisfactory and safe alternative to retrobulbar and peribulbar anesthesia for clear corneal phacoemulsification and intraocular lens implantation in selected cataract patients in the hands of experienced cataract surgeon.

  17. Advanced Topics in Aerodynamics

    DEFF Research Database (Denmark)

    Filippone, Antonino

    1999-01-01

    "Advanced Topics in Aerodynamics" is a comprehensive electronic guide to aerodynamics,computational fluid dynamics, aeronautics, aerospace propulsion systems, design and relatedtechnology. We report data, tables, graphics, sketches,examples, results, photos, technical andscientific literature, for...

  18. APS undulator radiation: First results

    International Nuclear Information System (INIS)

    The first undulator radiation has been extracted from the Advanced Photon Source (APS). The results from the characterization of this radiation are very satisfactory. With the undulator set at a gap of 15.8 mm (K=1.61), harmonics as high as the 17th were observed using a crystal spectrometer. The angular distribution of the third-harmonic radiation was measured, and the source was imaged using a zone plate to determine the particle beam emittance. The horizontal beam emittance was found to be 6.9 ± 1.0 nm-rad, and the vertical emittance coupling was found to be less than 3%. The absolute spectral flux was measured over a wide range of photon energies, and it agrees remarkably well with the theoretical calculations based on the measured undulator magnetic field profile and the measured beam emittance. These results indicate that both the emittance of the electron beam and the undulator magnetic field quality exceed the original specifications

  19. Topical treatment of melasma

    Directory of Open Access Journals (Sweden)

    Bandyopadhyay Debabrata

    2009-01-01

    Full Text Available Melasma is a common hypermelanotic disorder affecting the face that is associated with considerable psychological impacts. The management of melasma is challenging and requires a long-term treatment plan. In addition to avoidance of aggravating factors like oral pills and ultraviolet exposure, topical therapy has remained the mainstay of treatment. Multiple options for topical treatment are available, of which hydroquinone (HQ is the most commonly prescribed agent. Besides HQ, other topical agents for which varying degrees of evidence for clinical efficacy exist include azelaic acid, kojic acid, retinoids, topical steroids, glycolic acid, mequinol, and arbutin. Topical medications modify various stages of melanogenesis, the most common mode of action being inhibition of the enzyme, tyrosinase. Combination therapy is the preferred mode of treatment for the synergism and reduction of untoward effects. The most popular combination consists of HQ, a topical steroid, and retinoic acid. Prolonged HQ usage may lead to untoward effects like depigmentation and exogenous ochronosis. The search for safer alternatives has given rise to the development of many newer agents, several of them from natural sources. Well-designed controlled clinical trials are needed to clarify their role in the routine management of melasma.

  20. Topical Drugs for Pain Relief

    Directory of Open Access Journals (Sweden)

    Anjali Srinivasan

    2015-03-01

    Full Text Available Topical therapy helps patients with oral and perioral pain problems such as ulcers, burning mouth syndrome, temporomandibular disorders, neuromas, neuropathies and neuralgias. Topical drugs used in the field of dentistry are topical anaesthetics, topical analgesics, topical antibiotics and topical corticosteroids. It provides symptomatic/curative effect. Topical drugs are easy to apply, avoids hepatic first pass metabolism and more sites specific. But it can only be used for medications that require low plasma concentrations to achieve a therapeutic effect.

  1. The use of thioglycolate to distinguish between 3' AP (apurinic/apyrimidinic) endonucleases and AP lyases.

    OpenAIRE

    Bricteux-Grégoire, S; Verly, W G

    1989-01-01

    Addition of thioglycolate and DEAE-Sephadex chromatography were used to analyze the cleavage of the C(3')-O-P bond 3' to AP (apurinic/apyrimidinic) sites in DNA and to distinguish between a mechanism of hydrolysis (which would allow the nicking enzyme to be called 3' AP endonuclease) or beta-elimination (so that the nicking enzyme should be called AP lyase). For this purpose, DNA labelled in the AP sites was first cleaved by rat-liver AP endonuclease, then with the 3' nicking catalyst in the ...

  2. Group representations

    CERN Document Server

    Karpilovsky, G

    1994-01-01

    This third volume can be roughly divided into two parts. The first part is devoted to the investigation of various properties of projective characters. Special attention is drawn to spin representations and their character tables and to various correspondences for projective characters. Among other topics, projective Schur index and projective representations of abelian groups are covered. The last topic is investigated by introducing a symplectic geometry on finite abelian groups. The second part is devoted to Clifford theory for graded algebras and its application to the corresponding theory

  3. Characters and Topical Diversity

    DEFF Research Database (Denmark)

    Eriksson, Rune

    2014-01-01

    The purpose of this article is to contribute to our understanding of the difference between the bestseller and the non-bestseller in nonfiction. It is noticed that many bestsellers in nonfiction belongs to the sub-genre of creative nonfiction, but also that the topics in this kind of literature is...... largely ignored by the critics. Thus, the article tests how topics may work in creative nonfiction. Two Danish bestsellers belonging to the genre, Frank’s Mit smukke genom ( My Beautiful Genome), about genomics, and Buk-Swienty’s Slagtebænk Dybbøl ( ‘Slaughter-bench Dybbøl’), a history book, are chosen as...... cases and analysed using a slightly modified motif model by Johansen. The result is that in both books the main topic is treated from a double perspective, but also that six out of seven secondary topics, or motifs, are treated as well. It is concluded that also in a topical sense creative nonfiction...

  4. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.

    1999-08-12

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  5. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  6. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded

  7. Abelian Groups

    Energy Technology Data Exchange (ETDEWEB)

    Mishina, A.P.

    1995-10-15

    This fifth survey of reviews on abelian groups comprises papers reviewed in 1985-1992. Just as in the preceding surveys, the issues concerning finite abelian groups, topological groups, ordered groups, group algebras, modules (with rare exceptions), and topics on logic are not considered. The issues on the lattice of subgroups of an abelian group are included in Section 11. In contrast to the fourth survey, this one does not contain Sections 6 (N-high subgroups), 9 (rings with a given additive group), and 10 (valuated groups); since only a few papers treated these topics, the material discussed earlier in Sections 9, and 10 is now included in Section 11 and the material of the former Section 6 will be found in Sections 1, 7, 8, and 11 of this survey. On the other hand, the fifth survey has three new sections devoted to separable groups (a new Sect. 5), Butler groups (a new Sect. 6), and the endormorphism rings and automorphism groups of abelian groups (a new Sect. 9).

  8. Comparison of topical tretinoin and betamethasone in oral lichen planus

    Directory of Open Access Journals (Sweden)

    Kar H

    1996-01-01

    Full Text Available Thirty-one patients of oral lichen planus were enrolled in this study and two groups were made. Group 1 consisting of 16 patients who applied topical tretinoin 0.05% and Group 2 comprising of 15 patients who were given topical betamethasone dipropionate 0.05%. The patients applying tretinoin showed statistically significant improvement as compared to patients applying betamethasone.

  9. Digital Social Network Mining for Topic Discovery

    Science.gov (United States)

    Moradianzadeh, Pooya; Mohi, Maryam; Sadighi Moshkenani, Mohsen

    Networked computers are expanding more and more around the world, and digital social networks becoming of great importance for many people's work and leisure. This paper mainly focused on discovering the topic of exchanging information in digital social network. In brief, our method is to use a hierarchical dictionary of related topics and words that mapped to a graph. Then, with comparing the extracted keywords from the context of social network with graph nodes, probability of relation between context and desired topics will be computed. This model can be used in many applications such as advertising, viral marketing and high-risk group detection.

  10. Topic Identification in Discourse

    OpenAIRE

    Chen, Kuang-hua

    1995-01-01

    This paper proposes a corpus-based language model for topic identification. We analyze the association of noun-noun and noun-verb pairs in LOB Corpus. The word association norms are based on three factors: 1) word importance, 2) pair co-occurrence, and 3) distance. They are trained on the paragraph and sentence levels for noun-noun and noun-verb pairs, respectively. Under the topic coherence postulation, the nouns that have the strongest connectivities with the other nouns and verbs in the di...

  11. Topics in Physical Mathematics

    CERN Document Server

    Marathe, Kishore

    2010-01-01

    This title adopts the view that physics is the primary driving force behind a number of developments in mathematics. Previously, science and mathematics were part of natural philosophy and many mathematical theories arose as a result of trying to understand natural phenomena. This situation changed at the beginning of last century as science and mathematics diverged. These two fields are collaborating once again; 'Topics in Mathematical Physics' takes the reader through this journey. The author discusses topics where the interaction of physical and mathematical theories has led to new points o

  12. Topical Conference on Oportunities in Biology for Physicists II

    Energy Technology Data Exchange (ETDEWEB)

    Franz, Judy R.

    2004-02-01

    In 2002, the American Physical Society (APS) organized and held the first topical conference in Boston, MA, as a way of informing physicists, particularly those just entering the field, of opportunities emerging at the interface of physics and biology. Because of the tremendous success of the first conference, it was decided to organize a second conference, similar in nature and focus, but with different presentation topic areas. Again the intended audience would be graduate students and postdocs considering applying methods of physics to biological research, and those who advise others on such opportunities.

  13. Tank 241-AP-107 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Defense Nuclear Facilities Safety Board has directed the DOE to concentrate ear-term sampling and analysis activities on identification and resolution of issues (Conway 1993). The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44-00 has been made, which states that ''A Tank Characterization Plan (TCP) will be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process; Development of TCPs by the DQO process is intended to allow users (e.g., Hanford Facility user groups, regulators) to ensure their needs will be met and that resources are devoted to gaining only necessary information.'' This document satisfies that requirement for the tank 241-AP-107 (AP-107)

  14. Topic: Mastery Learning.

    Science.gov (United States)

    Killoran, James, Ed.

    1983-01-01

    This journal issue addresses the topic of mastery learning at both the elementary and secondary school levels. The first article, "The Theory and Practice of Mastery Learning" (Guskey), gives a definition of and information about the development, operation, and application of mastery learning, based on the theories of Benjamin Bloom. In addition,…

  15. Topical Research: Africa.

    Science.gov (United States)

    Lynn, Karen

    This lesson plan can be used in social studies, language arts, or library research. The instructional objective is for students to select a topic of study relating to Africa, write a thesis statement, collect information from media sources, and develop a conclusion. The teacher may assign the lesson for written or oral evaluation. The teacher…

  16. Differential Topic Models.

    Science.gov (United States)

    Chen, Changyou; Buntine, Wray; Ding, Nan; Xie, Lexing; Du, Lan

    2015-02-01

    In applications we may want to compare different document collections: they could have shared content but also different and unique aspects in particular collections. This task has been called comparative text mining or cross-collection modeling. We present a differential topic model for this application that models both topic differences and similarities. For this we use hierarchical Bayesian nonparametric models. Moreover, we found it was important to properly model power-law phenomena in topic-word distributions and thus we used the full Pitman-Yor process rather than just a Dirichlet process. Furthermore, we propose the transformed Pitman-Yor process (TPYP) to incorporate prior knowledge such as vocabulary variations in different collections into the model. To deal with the non-conjugate issue between model prior and likelihood in the TPYP, we thus propose an efficient sampling algorithm using a data augmentation technique based on the multinomial theorem. Experimental results show the model discovers interesting aspects of different collections. We also show the proposed MCMC based algorithm achieves a dramatically reduced test perplexity compared to some existing topic models. Finally, we show our model outperforms the state-of-the-art for document classification/ideology prediction on a number of text collections. PMID:26353238

  17. Contrastive topics decomposed

    Directory of Open Access Journals (Sweden)

    Michael Wagner

    2012-12-01

    Full Text Available The analysis of contrastive topics introduced in Büring 1997b and further developed in Büring 2003 relies on distinguishing two types of constituents that introduce alternatives: the sentence focus, which is marked by a FOC feature, and the contrastive topic, which is marked by a CT feature. A non-compositional rule of interpretation that refers to these features is used to derive a topic semantic value, a nested set of sets of propositions. This paper presents evidence for a correlation between the restrictive syntax of nested focus operators and the syntax of contrastive topics, a correlation which is unexpected under this analysis. A compositional analysis is proposed that only makes use of the flatter focus semantic values introduced by focus operators. The analysis aims at integrating insights from the original analysis while at the same time capturing the observed syntactic restrictions. http://dx.doi.org/10.3765/sp.5.8 BibTeX info

  18. Topics in Nonlinear Dynamics

    DEFF Research Database (Denmark)

    Mosekilde, Erik

    Through a significant number of detailed and realistic examples this book illustrates how the insights gained over the past couple of decades in the fields of nonlinear dynamics and chaos theory can be applied in practice. Aomng the topics considered are microbiological reaction systems, ecological...

  19. Selected topics in magnetism

    CERN Document Server

    Gupta, L C

    1993-01-01

    Part of the ""Frontiers in Solid State Sciences"" series, this volume presents essays on such topics as spin fluctuations in Heisenberg magnets, quenching of spin fluctuations by high magnetic fields, and kondo effect and heavy fermions in rare earths amongst others.

  20. Historical Topics in Algebra.

    Science.gov (United States)

    National Council of Teachers of Mathematics, Inc., Reston, VA.

    This is a reprint of the historical capsules dealing with algebra from the 31st Yearbook of NCTM,"Historical Topics for the Mathematics Classroom." Included are such themes as the change from a geometric to an algebraic solution of problems, the development of algebraic symbolism, the algebraic contributions of different countries, the origin and…

  1. Topic Tracking with Dynamic Topic Model and Topic-based Weighting Method

    Directory of Open Access Journals (Sweden)

    Xiaoyan Zhang

    2010-05-01

    Full Text Available In topic tracking, a topic is usually described by several stories. How to represent a topic is always an issue and a difficult problem in the research on topic tracking. To emphasis the topic in stories, we provide an improved topic-based tf*idf weighting method to measure the topical importance of the features in the representation model. To overcome the topic drift problem and filter the noise existed in the tracked topic description, a dynamic topic model is proposed based on the static model. It extends the initial topic model with the information from the incoming related stories and filters the noise using the latest unrelated story. The topic tracking systems are implemented on the TDT4 Chinese corpus. The experimental results indicate that both the new weighting method and the dynamic model can improve the tracking performance.

  2. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  3. Topics and topic prominence in two sign languages

    NARCIS (Netherlands)

    V. Kimmelman

    2015-01-01

    In this paper we describe topic marking in Russian Sign Language (RSL) and Sign Language of the Netherlands (NGT) and discuss whether these languages should be considered topic prominent. The formal markers of topics in RSL are sentence-initial position, a prosodic break following the topic, and non

  4. Problem topics and readers' responses on online forums

    OpenAIRE

    Tršan, Barbara

    2013-01-01

    Problem topics are among the most common thematic groups in modern youth literature. Problem topics or taboo topics emerged in literature in the 1960s. Taboos appearing in youth literature are the following: alcohol, drugs, sexual abuse, homosexuality, violence, disease, death, suicide, poverty, homelessness, religion, separation of parents, fear ... The thesis explores the question of which Slovenian youth texts containing problem topics are the most commented on the Internet forums and ...

  5. Effect of Topical Probiotic on MMP-13 and Collagen III Expression in the Dermis Layer of Male Rats Irradiated with Ultraviolet-B

    Directory of Open Access Journals (Sweden)

    Vita M. Tawaran

    2016-06-01

    Full Text Available Nowadays, there is a big interest in the use of topical probiotic preparations for skin health. One of the probiotics therurapeutic benefits is used as anti-aging. During aging, there is stimulation of activator protein-1 (AP-1 which is a transcription factor that inhibits the production of collagen and AP-1 supports the breakdown of collagen by enzymes called matrix metalloproteinases (MMPs. As administration of oral Lactobacillus plantarum could inhibit skin aging by lowering the activity of MMP, so the collagen degradation can be derived so probably topical use of Lactobacillus plantarum may give more prominent effects. We used 24 male rats Sprague-Dawley strain as research objects. This study was divided into two groups, the treatment and control groups. The shaved dorsal skin of rats were irradiated with UVB three times a week for 4 weeks with total irradiation dose of 840 mJ/cm2. Skin cream, containing 247.27x107 CFU non-replicating Lactobacillus plantarum FNCC 0020, was smeared on the treatment group, two times daily, whereas the control group did not receive any treatment. Skin biopsies were done at the end of the study for examination of MMP-13 and collagen III expressions. Intensity, distribution, and histoscore of MMP-13 between the treatment and the control group showed no significant difference (p>0.05. The treatment group showed a significant different in the intensity of collagen III with the density distribution of 20–50% and the highest density was 80% (p<0.01. Administration of topical cream L. plantarum FNCC 0020 increased the expression of collagen III density distribution, but not the MMP-13 expression.

  6. Discovering Health Topics in Social Media Using Topic Models

    OpenAIRE

    Paul, Michael J.; Dredze, Mark

    2014-01-01

    By aggregating self-reported health statuses across millions of users, we seek to characterize the variety of health information discussed in Twitter. We describe a topic modeling framework for discovering health topics in Twitter, a social media website. This is an exploratory approach with the goal of understanding what health topics are commonly discussed in social media. This paper describes in detail a statistical topic model created for this purpose, the Ailment Topic Aspect Model (ATAM...

  7. Topical retinoids for acne.

    Science.gov (United States)

    Yeh, Lindsey; Bonati, Lauren Meshkov; Silverberg, Nanette B

    2016-06-01

    Topical retinoids are currently approved by the US Food and Drug Administration for the treatment of acne vulgaris in nonpregnant, nonlactating patients 12 years of age and older. Their efficacy, safety, and tolerability are well documented for inflammatory and noninflammatory acne with studies repeatedly demonstrating a decrease in the number of lesions, significant improvement in acne severity, improvement in the cosmetic appearance of acne, and the prevention of acne lesions through microcomedone formation. There is some variability between prescription retinoid products regarding efficacy, safety, and tolerability; with erythema, peeling, and dryness being common, potential side effects. Due to their efficacious and safe profile, topical retinoids remain the first-line treatment for acne vulgaris. PMID:27416308

  8. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed

  9. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-12-22

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  10. AP1000's advanced control room

    International Nuclear Information System (INIS)

    AP1000 is a passive Advanced Light Water Reactor designed by Westinghouse Electric Company to comply with the Electric Power Research Institute's (EPRI) Advanced Light Water Reactor (ALWR) Utility Requirements Document (URD). AP600, the predecessor to AP1000, received Design Certification by the US Nuclear Regulatory Commission (USNRC) in 1999. The AP1000 received its Final Design Approval in the Fall of 2004 and Design Certification is expected in the fall of 2005. During both of these licensing efforts a control room and Human Machine Interface (HMI) design process was submitted and approved. Realizing that Instrumentation and Control (I and C) and HMI technology changes rapidly, Westinghouse chose to delay the detailed design of the control room and operator interfaces. This allows the latest technology to be used when a plant is actually going to be built. That time has now come. This paper describes the preliminary designs of the AP1000 main control room (MCR) and HMI planned for use in new plants both in the United States and abroad. The paper also addresses how the certified design process is being conducted to complete the detailed HMI designs. (authors)

  11. Building an AP Social Studies Program with Non-Traditional AP Students

    Science.gov (United States)

    Ashmead, Amanda; Blanchette, Sue

    2013-01-01

    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  12. Slotted Aloha with multi-AP diversity and APS transmit beamforming

    Directory of Open Access Journals (Sweden)

    Zheng Di

    2011-01-01

    Full Text Available Abstract Slotted Aloha is an effective random access protocol and can also be an important element of more advanced media access protocols. This paper investigates slotted Aloha in a radio environment with multiple access points. Specifically, we examine the impact of multi-access-point (multi-AP diversity on the performance of slotted Aloha. The paper considers both omni-directional (OM and beamforming (BF antennas at transmission nodes. This leads to the investigation and comparison of four different network scenarios, i.e., OM with multi-AP diversity, OM without multi-AP diversity, BF with multi-AP diversity and BF without multi-AP diversity. Performance evaluations and comparisons are presented in terms of throughput and average packet delay.

  13. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  14. Plyler Prize and APS Fellow Introductions

    Science.gov (United States)

    Nathanson, Gilbert

    2014-03-01

    The Division of Chemical Physics is delighted to announce the 2013 APS Fellows sponsored by DCP and to honor the 2014 Earl K. Plyler Prize Award winner. The new APS Fellows are: Ilan Benjamin, Hua Guo, Manos Mavrikakis, Josef Paldus, Joern Siepmann, Hans-Peter Steinrueck, Douglas Tobias, Angela Wilson, and Yijing Yan. The citations for each awardee will be read out loud. I will also introduce Prof. Lai-Sheng Wang of the Department of Chemistry at Brown University, who was awarded the 2014 Plyler Prize for Molecular Spectroscopy and Dynamics. Please come learn about these extraordinary scientists during this prize session. Prof. Wang's Plyler Prize talk will follow immediately after this introduction. For more information, see http://www.aps.org/units/dcp/.

  15. AP600 - an ALWR conceptual design

    International Nuclear Information System (INIS)

    The Electric Power Research Institute is spearheading an effort to develop utility requirements for the Advanced Light Water Reactor (ALWR) plants which will become the next generation nuclear power plants for the U.S. This EPRI ALWR Program involves utilities, the U.S. Department of Energy, the U.S. Nuclear Regulatory Commission, and various industry suppliers. The ALWR Program is aimed at ALWR plants which incorporate step improvements in safety, reliability, operability and power generation costs. As part of the ALWR efforts, a Westinghouse team is conducting conceptual design development of a PWR plant design called the AP600, reflecting advanced passive safety features and the chosen 600 MWe plant output. The AP600 conceptual design provides significant improvements while employing proven component technology. This paper describes the basic reactor and primary coolant system features, the passive safety system features, and plant arrangement/construction features of AP600

  16. Topics in Galois theory

    CERN Document Server

    Serre, Jean-Pierre

    2007-01-01

    This book is based on a course given by the author at Harvard University in the fall semester of 1988. The course focused on the inverse problem of Galois Theory: the construction of field extensions having a given finite group as Galois group. In the first part of the book, classical methods and results, such as the Scholz and Reichardt construction for p-groups, p != 2, as well as Hilbert's irreducibility theorem and the large sieve inequality, are presented. The second half is devoted to rationality and rigidity criteria and their application in realizing certain groups as Galois groups of

  17. Mechanical equipment classification research of AP1000 nuclear units

    International Nuclear Information System (INIS)

    According to the design features of AP1000, the AP1000 classification definition and seismic classification is described and analyzed. The characteristics of AP1000 mechanical equipment classification list is concluded for safety, seismic and manufacture classification. Through comparing the AP1000 classification and M310 classification, the questions perhaps met are found during the mechanical equipment classification of AP1000 nuclear power plants design and construction in China at future. Finally solution plans are given aiming at the above questions. (authors)

  18. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  19. Topical Acne Treatments and Pregnancy

    Science.gov (United States)

    Topical Acne Treatments and Pregnancy In every pregnancy, a woman starts out with a 3-5% chance of having ... This sheet talks about whether exposure to topical acne treatments may increase the risk for birth defects ...

  20. Topical tretinoin in acanthosis nigricans

    Directory of Open Access Journals (Sweden)

    Lahiri Koushik

    1996-01-01

    Full Text Available Efficacy of topical tretinoin was assessed in 30 cases of idiopathic acanthosis nigricans which were recalcitrant to conventional modalities of treatment. Topical tretinoin once at night application was found to be very effective both clinically and histologically.

  1. Topical tretinoin in acanthosis nigricans

    OpenAIRE

    Lahiri Koushik; Malakar Subrata

    1996-01-01

    Efficacy of topical tretinoin was assessed in 30 cases of idiopathic acanthosis nigricans which were recalcitrant to conventional modalities of treatment. Topical tretinoin once at night application was found to be very effective both clinically and histologically.

  2. Preparation of and porosity measurements on oxidic APS spray coatings; Praeparation und Porositaetsmessung an oxidischen APS-Spritzschichten

    Energy Technology Data Exchange (ETDEWEB)

    Motl, Wolfgang [H.C. Starck GmbH, Laufenburg (Germany); Schnarr, Holger [Struers GmbH, Willich (Germany)

    2015-07-01

    Zirconium oxide coatings for application in the field of turbine construction have to exhibit certain properties in order to meet high temperature requirements. One of the most important properties is the porosity, for it provides a thermal insulation of the coated material. For this reason, the porosity is routinely determined as quality parameter for spray coatings which helps determining their suitability for a particular application. The following work summarizes the results of the round robin test ''Preparation of and Porosity Measurements on Oxidic APS Spray Coatings'' by the DGM working group ''Preparation''.

  3. Tank 241-AP-107 tank characterization plan

    International Nuclear Information System (INIS)

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107

  4. 2000 Johnston Site 3A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  5. 2000 Johnston Site 2A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  6. 2000 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  7. 2006 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  8. Studies on rat liver nuclear DNA damaged by chemical carcinogen (3'-Me DAB) and AP DNA endonuclease. II. Kinetic properties of AP DNA endonucleases in rat liver chromatin.

    OpenAIRE

    Y. S. Kim; Kim, J. W.; Lee, S. E.; Oh, S.H.(Department of Physics, Duke University, Durham, NC, United States)

    1990-01-01

    An experiment was designed to investigate the reaction mechanism of AP (apurinic or apyrimidinic) DNA endonucleases (APcI, APcII, APcIII) purified from rat liver chromatin. Sulfhydryl compounds (2-mercaptoethanol, dithiothreitol) brought about optimal activities of AP DNA endonucleases and N-ethylmaleimide or HgCl2 inhibited the enzyme activities, indicating the presence of sulfhydryl group at or near the active sites of the enzymes. Mg2+ was essential and 4mM of Mg2+ was sufficient for the o...

  9. Topics in atomic physics

    CERN Document Server

    Burkhardt, Charles E

    2006-01-01

    The study of atomic physics propelled us into the quantum age in the early twentieth century and carried us into the twenty-first century with a wealth of new and, in some cases, unexplained phenomena. Topics in Atomic Physics provides a foundation for students to begin research in modern atomic physics. It can also serve as a reference because it contains material that is not easily located in other sources. A distinguishing feature is the thorough exposition of the quantum mechanical hydrogen atom using both the traditional formulation and an alternative treatment not usually found in textbooks. The alternative treatment exploits the preeminent nature of the pure Coulomb potential and places the Lenz vector operator on an equal footing with other operators corresponding to classically conserved quantities. A number of difficult to find proofs and derivations are included as is development of operator formalism that permits facile solution of the Stark effect in hydrogen. Discussion of the classical hydrogen...

  10. Tank 241-AP-106, grab samples, 6AP-96-1 through 6AP-96-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A., Westinghouse Hanford

    1996-12-11

    This document is the final report for tank 241-AP-106 grab samples. This document presents the analytical results for three samples (6AP-96-1, 6AP-96-2 and 6AP-96-3) taken from riser 1 @ 150{degrees} of tank 241-AP-1 06 on September 12, 1996. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1996) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler, 1995).

  11. Structural Determinants of DNA Binding by a P. falciparum ApiAP2 Transcriptional Regulator

    Energy Technology Data Exchange (ETDEWEB)

    Lindner, Scott E.; De Silva, Erandi K.; Keck, James L.; Llinás, Manuel (Princeton); (UW-MED)

    2010-11-05

    Putative transcription factors have only recently been identified in the Plasmodium spp., with the major family of regulators comprising the Apicomplexan Apetala2 (AP2) proteins. To better understand the DNA-binding mechanisms of these transcriptional regulators, we characterized the structure and in vitro function of an AP2 DNA-binding domain from a prototypical Apicomplexan AP2 protein, PF14{_}0633 from Plasmodium falciparum. The X-ray crystal structure of the PF14{_}0633 AP2 domain bound to DNA reveals a {beta}-sheet fold that binds the DNA major groove through base-specific and backbone contacts; a prominent {alpha}-helix supports the {beta}-sheet structure. Substitution of predicted DNA-binding residues with alanine weakened or eliminated DNA binding in solution. In contrast to plant AP2 domains, the PF14{_}0633 AP2 domain dimerizes upon binding to DNA through a domain-swapping mechanism in which the {alpha}-helices of the AP2 domains pack against the {beta}-sheets of the dimer mates. DNA-induced dimerization of PF14{_}0633 may be important for tethering two distal DNA loci together in the nucleus and/or for inducing functional rearrangements of its domains to facilitate transcriptional regulation. Consistent with a multisite binding mode, at least two copies of the consensus sequence recognized by PF14{_}0633 are present upstream of a previously identified group of sporozoite-stage genes. Taken together, these findings illustrate how Plasmodium has adapted the AP2 DNA-binding domain for genome-wide transcriptional regulation.

  12. The Clathrin Adaptor AP-1A Mediates Basolateral Polarity

    OpenAIRE

    Gravotta, Diego; Carvajal-Gonzalez, Jose Maria; Mattera, Rafael; Deborde, Sylvie; Banfelder, Jason R.; Bonifacino, Juan S.; Rodriguez-Boulan, Enrique

    2012-01-01

    Clathrin and the epithelial-specific clathrin adaptor AP-1B mediate basolateral trafficking in epithelia. However, several epithelia lack AP-1B and mice knocked-out for AP-1B are viable, suggesting the existence of additional mechanisms that control basolateral polarity. Here, we demonstrate a distinct role of the ubiquitous clathrin adaptor AP-1A in basolateral protein sorting. Knock-down of AP-1A causes missorting of basolateral proteins in MDCK cells but only after knock-down of AP-1B, sug...

  13. Dynamics of intracellular clathrin/AP1 and clathrin/AP3 containing carriers

    OpenAIRE

    2012-01-01

    Clathrin/AP1 and clathrin/AP3 coated vesicular carriers originate from endosomes and the TGN. We report here the real-time visualization of these structures in living cells reliably tracked by using rapid, three-dimensional imaging with a spinning-disk confocal microscope. We imaged relatively sparse, diffraction-limited, fluorescent objects containing chimeric fluorescent protein (clathrin light chain, σ adaptor subunits or dynamin2) with a spatial precision of up to ~ 30 nm and a temporal r...

  14. Representation Theory of Algebraic Groups and Quantum Groups

    CERN Document Server

    Gyoja, A; Shinoda, K-I; Shoji, T; Tanisaki, Toshiyuki

    2010-01-01

    Invited articles by top notch expertsFocus is on topics in representation theory of algebraic groups and quantum groupsOf interest to graduate students and researchers in representation theory, group theory, algebraic geometry, quantum theory and math physics

  15. Undergraduates and Topic Selection: A Librarian’s Role

    OpenAIRE

    Kacy Lundstrom; Flora Shrode

    2013-01-01

    Research shows that undergraduate students struggle with the initial stage of the research process, mainly identifying and defining a topic. Little current research addresses how undergraduates engage in this process, including how and where they seek help. The results of focus groups indicate that students have individual and varied methods for topic selection, but that many of them choose topics based on their perception of a few major characteristics, mainly perceived ease, pleasing t...

  16. Topics in statistical mechanics

    Energy Technology Data Exchange (ETDEWEB)

    Elser, V.

    1984-05-01

    This thesis deals with four independent topics in statistical mechanics: (1) the dimer problem is solved exactly for a hexagonal lattice with general boundary using a known generating function from the theory of partitions. It is shown that the leading term in the entropy depends on the shape of the boundary; (2) continuum models of percolation and self-avoiding walks are introduced with the property that their series expansions are sums over linear graphs with intrinsic combinatorial weights and explicit dimension dependence; (3) a constrained SOS model is used to describe the edge of a simple cubic crystal. Low and high temperature results are derived as well as the detailed behavior near the crystal facet; (4) the microscopic model of the lambda-transition involving atomic permutation cycles is reexamined. In particular, a new derivation of the two-component field theory model of the critical behavior is presented. Results for a lattice model originally proposed by Kikuchi are extended with a high temperature series expansion and Monte Carlo simulation. 30 references.

  17. Topics in statistical mechanics

    International Nuclear Information System (INIS)

    This thesis deals with four independent topics in statistical mechanics: (1) the dimer problem is solved exactly for a hexagonal lattice with general boundary using a known generating function from the theory of partitions. It is shown that the leading term in the entropy depends on the shape of the boundary; (2) continuum models of percolation and self-avoiding walks are introduced with the property that their series expansions are sums over linear graphs with intrinsic combinatorial weights and explicit dimension dependence; (3) a constrained SOS model is used to describe the edge of a simple cubic crystal. Low and high temperature results are derived as well as the detailed behavior near the crystal facet; (4) the microscopic model of the lambda-transition involving atomic permutation cycles is reexamined. In particular, a new derivation of the two-component field theory model of the critical behavior is presented. Results for a lattice model originally proposed by Kikuchi are extended with a high temperature series expansion and Monte Carlo simulation. 30 references

  18. Superconcentration and related topics

    CERN Document Server

    Chatterjee, Sourav

    2014-01-01

    A certain curious feature of random objects, introduced by the author as “super concentration,” and two related topics, “chaos” and “multiple valleys,” are highlighted in this book. Although super concentration has established itself as a recognized feature in a number of areas of probability theory in the last twenty years (under a variety of names), the author was the first to discover and explore its connections with chaos and multiple valleys. He achieves a substantial degree of simplification and clarity in the presentation of these findings by using the spectral approach. Understanding the fluctuations of random objects is one of the major goals of probability theory and a whole subfield of probability and analysis, called concentration of measure, is devoted to understanding these fluctuations. This subfield offers a range of tools for computing upper bounds on the orders of fluctuations of very complicated random variables. Usually, concentration of measure is useful when more direct prob...

  19. Advanced verification topics

    CERN Document Server

    Bhattacharya, Bishnupriya; Hall, Gary; Heaton, Nick; Kashai, Yaron; Khan Neyaz; Kirshenbaum, Zeev; Shneydor, Efrat

    2011-01-01

    The Accellera Universal Verification Methodology (UVM) standard is architected to scale, but verification is growing and in more than just the digital design dimension. It is growing in the SoC dimension to include low-power and mixed-signal and the system integration dimension to include multi-language support and acceleration. These items and others all contribute to the quality of the SOC so the Metric-Driven Verification (MDV) methodology is needed to unify it all into a coherent verification plan. This book is for verification engineers and managers familiar with the UVM and the benefits it brings to digital verification but who also need to tackle specialized tasks. It is also written for the SoC project manager that is tasked with building an efficient worldwide team. While the task continues to become more complex, Advanced Verification Topics describes methodologies outside of the Accellera UVM standard, but that build on it, to provide a way for SoC teams to stay productive and profitable.

  20. The AP-1A and AP-1B clathrin adaptor complexes define biochemically and functionally distinct membrane domains

    OpenAIRE

    Fölsch, Heike; Pypaert, Marc; Maday, Sandra; Pelletier, Laurence; Mellman, Ira

    2003-01-01

    Most epithelial cells contain two AP-1 clathrin adaptor complexes. AP-1A is ubiquitously expressed and involved in transport between the TGN and endosomes. AP-1B is expressed only in epithelia and mediates the polarized targeting of membrane proteins to the basolateral surface. Both AP-1 complexes are heterotetramers and differ only in their 50-kD μ1A or μ1B subunits. Here, we show that AP-1A and AP-1B, together with their respective cargoes, define physically and functionally distinct membra...

  1. Detection of Embryonic Research Topics by Analysing Semantic Topic Networks

    OpenAIRE

    Salatino, Angelo Antonio; Motta, Enrico

    2016-01-01

    Being aware of new research topics is an important asset for anybody involved in the research environment, including researchers, academic publishers and institutional funding bodies. In recent years, the amount of scholarly data available on the web has increased steadily, allowing the development of several approaches for detecting emerging research topics and assessing their trends. However, current methods focus on the detection of topics which are already associated with a label or a sub...

  2. Comparative efficacy and safety of topical permethrin, topical ivermectin, and oral ivermectin in patients of uncomplicated scabies

    Directory of Open Access Journals (Sweden)

    Sunita B Chhaiya

    2012-01-01

    Full Text Available Background: Ivermectin has opened a new era in the management of scabies as orally effective drug. However, topical route has been little explored for ivermectin. Aims: To compare the efficacy and safety of topical permethrin, oral ivermectin, and topical ivermectin in the treatment of uncomplicated scabies. Methods: This was an open-label, randomized, comparative, parallel clinical trial conducted in 315 patients, randomly allocated to 3 groups. First group received permethrin 5% cream as single application, second group received tablet ivermectin 200 mcg/kg as single dose, and third group received ivermectin 1% lotion as single application. All the patients received anti-histaminic for pruritus. The patients were followed up at intervals of 1, 2, 3, and 4 weeks. If there were no signs of cure, the same intervention was repeated at each follow up. Primary efficacy variable was clinical cure of lesions. Statistical analysis was done by chi square test and one way ANOVA test using SPSS version 12. Results: At the end of first week, cure rate was 74.8% in permethrin group, 30% in oral ivermectin group, and 69.3% in topical ivermectin group (P < 0.05. At the end of second week, cure rate was 99% in permethrin group, 63% in oral ivermectin group, and 100% in topical ivermectin group (P < 0.05. At the end of third week, 100% cure rate was observed in permethrin and topical ivermectin group while 99% in oral ivermectin group (P = 0.367. No serious adverse events were observed. Conclusions: Permethrin and topical ivermectin were equally effective against scabies while oral ivermectin was significantly less effective up to 2 weeks. Topical ivermectin can be used as an alternative to permethrin.

  3. Modeliranje nove jedrske elektrarne tipa AP1000

    OpenAIRE

    GERJEVIČ, GREGA

    2015-01-01

    Diplomsko delo zajema primerjavo rezultatov simulacije male izlivne nezgode s programskim orodjem Advanced PWR simulator z rezultati, ki jih je opravilo podjetje Westinghouse v testnem objektu APEX-1000. V prvem delu diplomskega dela sta opisana primarni in sekundarni sistem, ki se bistveno ne razlikujeta od sistemov ostalih jedrskih elektrarn. Nato sledi opis pasivnih varnostnih sistemov, po katerih je AP1000 znana. Sledi splošen opis izlivne nezgode, simulacijskega orodja in potek simul...

  4. Magnetic Doppler Imaging of Ap stars

    OpenAIRE

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Landstreet, J. D.; Bagnulo, S.

    2007-01-01

    Historically, the magnetic field geometries of the chemically peculiar Ap stars were modelled in the context of a simple dipole field. However, with the acquisition of increasingly sophisticated diagnostic data, it has become clear that the large-scale field topologies exhibit important departures from this simple model. Recently, new high-resolution circular and linear polarisation spectroscopy has even hinted at the presence of strong, small-scale field structures, which were completely une...

  5. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    International Nuclear Information System (INIS)

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report

  6. APS storage ring vacuum system performance

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) storage ring was designed to operated with 7-GeV, 100-mA positron beam with lifetimes > 20 hours. The lifetime is limited by residual gas scattering and Touschek scattering at this time. Photon-stimulated desorption and microwave power in the rf cavities are the main gas loads. Comparison of actual system gas loads and design calculations will be given. In addition, several special features of the storage ring vacuum system will be presented

  7. AP-42 ADDITIONS AND REVISIONS - RESIDENTIAL WOOD COMBUSTION

    Science.gov (United States)

    This project develops emission factors, etc., for residential fireplaces and woodstoves which are incorporated into AP-42. AP42 is a massive collection of material which describes processes which generate air emissions and presents emission factors and control effectiveness infor...

  8. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  9. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  10. Modelling of Biota Dose Effects. Report of Working Group 6 Biota Dose Effects Modelling of EMRAS II Topical Heading Reference Approaches for Biota Dose Assessment. Environmental Modelling for RAdiation Safety (EMRAS II) Programme

    International Nuclear Information System (INIS)

    Environmental assessment models are used for evaluating the radiological impact of actual and potential releases of radionuclides to the environment. They are essential tools for use in the regulatory control of routine discharges to the environment and in planning the measures to be taken in the event of accidental releases. They are also used for predicting the impact of releases which may occur far into the future, for example, from underground radioactive waste repositories. It is important to verify, to the extent possible, the reliability of the predictions of such models by a comparison with measured values in the environment or with the predictions of other models. The IAEA has been organizing programmes on international model testing since the 1980s. These programmes have contributed to a general improvement in models, in the transfer of data and in the capabilities of modellers in Member States. IAEA publications on this subject over the past three decades demonstrate the comprehensive nature of the programmes and record the associated advances which have been made. From 2009 to 2011, the IAEA organized a project entitled Environmental Modelling for RAdiation Safety (EMRAS II), which concentrated on the improvement of environmental transfer models and the development of reference approaches to estimate the radiological impacts on humans, as well as on flora and fauna, arising from radionuclides in the environment. Different aspects were addressed by nine working groups covering three themes: reference approaches for human dose assessment, reference approaches for biota dose assessment and approaches for addressing emergency situations. This publication describes the work of the Biota Effects Modelling Working Group

  11. Transfer of Tritium in the Environment after Accidental Releases from Nuclear Facilities. Report of Working Group 7 Tritium Accidents of EMRAS II Topical Heading Approaches for Assessing Emergency Situations. Environmental Modelling for Radiation Safety (Emras II) Programme

    International Nuclear Information System (INIS)

    Environmental assessment models are used for evaluating the radiological impact of actual and potential releases of radionuclides to the environment. They are essential tools for use in the regulatory control of routine discharges to the environment and also in planning measures to be taken in the event of accidental releases. They are also used for predicting the impact of releases which may occur far into the future, for example, from underground radioactive waste repositories. It is important to verify, to the extent possible, the reliability of the predictions of such models by a comparison with measured values in the environment or with predictions of other models. The IAEA has been organizing programmes of international model testing since the 1980s. These programmes have contributed to a general improvement in models, in the transfer of data and in the capabilities of modellers in Member States. IAEA publications on this subject over the past three decades demonstrate the comprehensive nature of the programmes and record the associated advances which have been made. From 2009 to 2011, the IAEA organized a programme entitled Environmental Modelling for RAdiation Safety (EMRAS II), which concentrated on the improvement of environmental transfer models and the development of reference approaches to estimate the radiological impacts on humans, as well as on flora and fauna, arising from radionuclides in the environment. Different aspects were addressed by nine working groups covering three themes: reference approaches for human dose assessment, reference approaches for biota dose assessment and approaches for assessing emergency situations. This publication describes the work of the Tritium Accidents Working Group

  12. AP Deployment Research Based on Physical Distance and Channel Isolation

    OpenAIRE

    Dangui Yan; Chengchang Zhang; Honghua Liao; Lisheng Yang; Ping Li; Guogang Yang

    2014-01-01

    Aiming at the problem of inefficiency of wireless local area networks (WLAN) access point (AP) deployment in urban environment, a new algorithm for AP deployment based on physical distance and channel isolation (DPDCI) is proposed. First, it detects the position information of deployed APs and then calculates the interference penalty factor combined with physical distance and channel isolation, and finally gets the optimal location and channel of the new AP through the genetic algorithm. Comp...

  13. Prediction of three-dimensional femoral offset from AP pelvis radiographs in primary hip osteoarthritis

    International Nuclear Information System (INIS)

    Background: In pre-operative planning for total hip arthroplasty (THA), femoral offset (FO) is frequently underestimated on AP pelvis radiographs as a result of inaccurate patient positioning, imprecise magnification, and radiographic beam divergence. The aim of the present study was to evaluate the accuracy and reliability of predicting three-dimensional (3-D) FO from standardised AP pelvis radiographs. Methods: In a retrospective cohort study, pre-operative AP pelvis radiographs, AP hip radiographs and CT scans of a consecutive series of 345 patients (345 hips, 146 males, 199 females, mean age 60 (range: 40–79) years, mean body-mass-index 27 (range: 19–57) kg/m2) with primary end-stage hip OA were reviewed. Patients were positioned according to a standardised protocol and all images were calibrated. Using validated custom programmes, FO was measured on corresponding radiographs and CT scans. Measurement reliability was evaluated using intra-class-correlation-coefficients. To predict 3-D FO from AP pelvis measurements and to assess the accuracy compared to CT, the entire cohort was randomly split into subgroups A and B. Gender specific regression equations were derived from group A (245 patients) and the accuracy of prediction was evaluated in group B (100 patients) using Bland–Altman plots. Results: In the entire cohort, mean FO was 39.2 mm (95%CI: 38.5–40.0 mm) on AP pelvis radiographs, 44.1 mm (95%CI: 43.4–44.9 mm) on AP hip radiographs and 44.6 mm (95%CI: 44.0–45.2 mm) on CT scans. In group B, we observed no significant difference between gender specific predicted FO (males: 48.0 mm, 95%CI: 47.1–48.8 mm; females: 42.0 mm, 95%CI: 41.1–42.8 mm) and FO as measured on CT (males: 47.7 mm, 95%CI: 46.1–49.4 mm, p = 0.689; females: 41.6 mm, 95%CI: 40.3–43.0 mm, p = 0.607). Conclusions: The present study suggests that FO can be accurately and reliably predicted from AP pelvis radiographs in patients with primary end-stage hip osteoarthritis. Our

  14. Prediction of three-dimensional femoral offset from AP pelvis radiographs in primary hip osteoarthritis

    Energy Technology Data Exchange (ETDEWEB)

    Merle, C., E-mail: christian.merle@med.uni-heidelberg.de [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Waldstein, W., E-mail: wwaldstein@gmail.com [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Pegg, E.C., E-mail: elise.pegg@ndorms.ox.ac.uk [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Streit, M.R., E-mail: marcus.streit@med.uni-heidelberg.de [Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Gotterbarm, T., E-mail: tobias.gotterbarm@med.uni-heidelberg.de [Department of Orthopaedic and Trauma Surgery, University Hospital Heidelberg (Germany); Aldinger, P.R., E-mail: peter.aldinger@diak-stuttgart.de [Department of Orthopaedic Surgery, Paulinenhilfe, Diakonieklinikum, Stuttgart (Germany); Murray, D.W., E-mail: david.murray@ndorms.ox.ac.uk [Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford (United Kingdom); Gill, H.S., E-mail: r.gill@bath.ac.uk [Department of Mechanical Engineering, University of Bath (United Kingdom)

    2013-08-15

    Background: In pre-operative planning for total hip arthroplasty (THA), femoral offset (FO) is frequently underestimated on AP pelvis radiographs as a result of inaccurate patient positioning, imprecise magnification, and radiographic beam divergence. The aim of the present study was to evaluate the accuracy and reliability of predicting three-dimensional (3-D) FO from standardised AP pelvis radiographs. Methods: In a retrospective cohort study, pre-operative AP pelvis radiographs, AP hip radiographs and CT scans of a consecutive series of 345 patients (345 hips, 146 males, 199 females, mean age 60 (range: 40–79) years, mean body-mass-index 27 (range: 19–57) kg/m{sup 2}) with primary end-stage hip OA were reviewed. Patients were positioned according to a standardised protocol and all images were calibrated. Using validated custom programmes, FO was measured on corresponding radiographs and CT scans. Measurement reliability was evaluated using intra-class-correlation-coefficients. To predict 3-D FO from AP pelvis measurements and to assess the accuracy compared to CT, the entire cohort was randomly split into subgroups A and B. Gender specific regression equations were derived from group A (245 patients) and the accuracy of prediction was evaluated in group B (100 patients) using Bland–Altman plots. Results: In the entire cohort, mean FO was 39.2 mm (95%CI: 38.5–40.0 mm) on AP pelvis radiographs, 44.1 mm (95%CI: 43.4–44.9 mm) on AP hip radiographs and 44.6 mm (95%CI: 44.0–45.2 mm) on CT scans. In group B, we observed no significant difference between gender specific predicted FO (males: 48.0 mm, 95%CI: 47.1–48.8 mm; females: 42.0 mm, 95%CI: 41.1–42.8 mm) and FO as measured on CT (males: 47.7 mm, 95%CI: 46.1–49.4 mm, p = 0.689; females: 41.6 mm, 95%CI: 40.3–43.0 mm, p = 0.607). Conclusions: The present study suggests that FO can be accurately and reliably predicted from AP pelvis radiographs in patients with primary end-stage hip osteoarthritis

  15. Scaling up Dynamic Topic Models

    OpenAIRE

    Bhadury, Arnab; Chen, Jianfei; Zhu, Jun; Liu, Shixia

    2016-01-01

    Dynamic topic models (DTMs) are very effective in discovering topics and capturing their evolution trends in time series data. To do posterior inference of DTMs, existing methods are all batch algorithms that scan the full dataset before each update of the model and make inexact variational approximations with mean-field assumptions. Due to a lack of a more scalable inference algorithm, despite the usefulness, DTMs have not captured large topic dynamics. This paper fills this research void, a...

  16. Topic Modeling of Hierarchical Corpora /

    OpenAIRE

    Kim, Do-kyum

    2014-01-01

    The sizes of modern digital libraries have grown beyond our capacity to comprehend manually. Thus we need new tools to help us in organizing and browsing large corpora of text that do not require manually examining each document. To this end, machine learning researchers have developed topic models, statistical learning algorithms for automatic comprehension of large collections of text. Topic models provide both global and local views of a corpus; they discover topics that run through the co...

  17. Topical corticosteroid addiction and phobia

    OpenAIRE

    Aparajita Ghosh; Sujata Sengupta; Arijit Coondoo; Amlan Kusum Jana

    2014-01-01

    Corticosteroids, one of the most widely prescribed topical drugs, have been used for about six decades till date. However, rampant misuse and abuse down the years has given the drug a bad name. Topical steroid abuse may lead to two major problems which lie at the opposing ends of the psychosomatic spectrum. Topical steroid addiction, a phenomenon that came to be recognized about a decade after the introduction of the molecule is manifested as psychological distress and rebound phenomenon on s...

  18. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S; Bruland, O; Løvås, K; Meager, A; Pedersen, Carsten; Husebye, E S; Knappskog, P M

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms or...

  19. The use of focus groups to investigate sensitive topics: an example taken from research on adolescent girls' perceptions about sexual risks O uso de grupos focais para investigar temas de natureza íntima: exemplo de uma pesquisa sobre pontos de vista de meninas adolescentes acerca dos riscos do sexo

    Directory of Open Access Journals (Sweden)

    Dora Lucia de Oliveira

    2011-07-01

    Full Text Available The methodology of focus groups has been increasingly employed in the context of research in the social sciences, particularly in health-related inquiries. Considerations about the sensitive aspects of such research are not, however, very often seen in research reports or discussion on ways of conducting sensitive research. The scope of this paper is to share an experience of conducting focus group research on sensitive topics, such as AIDS, risk and sexual issues, highlighting some methodological issues. More specifically, it suggests ways of working with teenage girls in focus groups about sensitive topics. The advantages of the use of focus groups to explore views on HIV/AIDS and other sexual risks are also discussed. Socio-cultural approaches to risk and feminist thinking permeate the main arguments.A metodologia de grupos focais tem sido cada vez mais usada em pesquisas no campo das ciências sociais, particularmente em investigações relacionadas à saúde. Considerações sobre os aspectos de natureza íntima que permeiam estas pesquisas não são, contudo, muito frequentemente vistas em relatórios de pesquisa, nem em discussões sobre as maneiras de se conduzir tais pesquisas. O objetivo deste artigo é compartilhar uma experiência de pesquisa com grupos focais sobre temas de natureza íntima, tais como AIDS, risco e sexualidade, destacando algumas questões metodológicas. Mais especificamente, o artigo sugere maneiras para desenvolver este tipo de pesquisa com meninas adolescentes. As vantagens do uso de grupos focais para explorar pontos de vista sobre HIV/AIDS e outros riscos sexuais são também discutidas. Abordagens sócio-culturais sobre risco e o pensamento feminista formam os principais argumentos.

  20. Hot topic [editorial

    International Nuclear Information System (INIS)

    simulations 'would be seriously in error'. One may ask if this magazine should give space to Lindzen or those involved in geoengineering to air their views. Given the uncertainties still present within climate models and the potential costs of dealing with global warming, it would be wrong for Physics World to ignore those outside the mainstream. After all, as Richard Feynman once wrote: 'There is no harm in doubt and scepticism, for it is through these that new discoveries are made'. Physicists should never take anything at face value, not least a topic as important as climate change. (U.K.)

  1. Phylogenetic utility of the AP3/DEF K-domain and its molecular evolution in Impatiens (Balsaminaceae)

    OpenAIRE

    Janssens, S.; Geuten, K.; Viaene, T.; Yong-Ming, Y.; Yi, S; Smets, E.

    2007-01-01

    APETALA3 (AP3)/DEFICIENS (DEF) is a MADS-box transcription factor that is involved in establishing the identity of petal and stamen floral organs. The AP3/DEF gene lineage has been extensively examined throughout the angiosperms in order to better understand its role in floral diversity and evolution. As a result, a large number of cloned AP3/DEF orthologues are available, which can be used for the design of taxon specific primers for phylogeny reconstruction of close relatives of the group o...

  2. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  3. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  4. Pharmakologische Charakterisierung der vasoaktiven Eigenschaften von Ap7A und Ap8A an der isolierten perfundierten Rattenniere

    OpenAIRE

    Blaschke, Daniela

    2010-01-01

    Recently, diadenosine heptaphosphate and diadenosine octaphosphate have been isolated in human platelets. With thrombin-induced platelet aggregation, Ap7A and Ap8A are released from the platelets into the extracellular space. Like other dinucleoside polyphosphates, maybe they play an important role in the control of vascular tone and platelet aggregation. Here we describe the effects on regulation of vascular tone of Ap7A and Ap8A in isolated perfused rat kidney. Our experiments demonstrate t...

  5. The Virtual Robotics Laboratory; TOPICAL

    International Nuclear Information System (INIS)

    The growth of the Internet has provided a unique opportunity to expand research collaborations between industry, universities, and the national laboratories. The Virtual Robotics Laboratory (VRL) is an innovative program at Oak Ridge National Laboratory (ORNL) that is focusing on the issues related to collaborative research through controlled access of laboratory equipment using the World Wide Web. The VRL will provide different levels of access to selected ORNL laboratory secondary education programs. In the past, the ORNL Robotics and Process Systems Division has developed state-of-the-art robotic systems for the Army, NASA, Department of Energy, Department of Defense, as well as many other clients. After proof of concept, many of these systems sit dormant in the laboratories. This is not out of completion of all possible research topics. but from completion of contracts and generation of new programs. In the past, a number of visiting professors have used this equipment for their own research. However, this requires that the professor, and possibly his/her students, spend extended periods at the laboratory facility. In addition, only a very exclusive group of faculty can gain access to the laboratory and hardware. The VRL is a tool that enables extended collaborative efforts without regard to geographic limitations

  6. 77 FR 24480 - Application for New Awards; Advanced Placement (AP) Test Fee Program-Reopening the AP Test Fee...

    Science.gov (United States)

    2012-04-24

    .... ACTION: Notice reopening the AP Test Fee fiscal year 2012 competition. Catalog of Federal Domestic Assistance (CFDA) Number: 84.330B. SUMMARY: On February 15, 2012, we published in the Federal Register (77 FR... Application for New Awards; Advanced Placement (AP) Test Fee Program--Reopening the AP Test Fee Fiscal...

  7. Topics in topology

    CERN Document Server

    Todorcevic, Stevo

    1997-01-01

    The book describes some interactions of topology with other areas of mathematics and it requires only basic background. The first chapter deals with the topology of pointwise convergence and proves results of Bourgain, Fremlin, Talagrand and Rosenthal on compact sets of Baire class-1 functions. In the second chapter some topological dynamics of beta-N and its applications to combinatorial number theory are presented. The third chapter gives a proof of the Ivanovskii-Kuzminov-Vilenkin theorem that compact groups are dyadic. The last chapter presents Marjanovic's classification of hyperspaces of compact metric zerodimensional spaces.

  8. Automated cloning methods.; TOPICAL

    International Nuclear Information System (INIS)

    Argonne has developed a series of automated protocols to generate bacterial expression clones by using a robotic system designed to be used in procedures associated with molecular biology. The system provides plate storage, temperature control from 4 to 37 C at various locations, and Biomek and Multimek pipetting stations. The automated system consists of a robot that transports sources from the active station on the automation system. Protocols for the automated generation of bacterial expression clones can be grouped into three categories (Figure 1). Fragment generation protocols are initiated on day one of the expression cloning procedure and encompass those protocols involved in generating purified coding region (PCR)

  9. Modern topics in theoretical nuclear physics

    OpenAIRE

    Jennings, B. K.; Schwenk, A

    2005-01-01

    Over the past five years there have been profound advances in nuclear physics based on effective field theory and the renormalization group. In this brief, we summarize these advances and discuss how they impact our understanding of nuclear systems and experiments that seek to unravel their unknowns. We discuss future opportunities and focus on modern topics in low-energy nuclear physics, with special attention to the strong connections to many-body atomic and condensed matter physics, as wel...

  10. Importance of thiols in the repair mechanisms of DNA containing AP (apurinic or apyrimidinic) sites.

    OpenAIRE

    Bailly, V; Verly, W G

    1988-01-01

    Addition of thiol compounds containing an anionic group to the 3'-terminal unsaturated sugar of the 5' fragment obtained from an oligonucleotide containing an AP site cleaved by beta-elimination, can be followed by gel electrophoresis. The technique enables to distinguish between two mechanisms of cleavage of the C3'-O-P bond 3' to an AP site: hydrolysis or beta-elimination. Addition of thiols to the double-bond of the 3'-terminal sugar resulting from beta-elimination prevents a subsequent de...

  11. Topics in superstring theory

    International Nuclear Information System (INIS)

    The author discusses two specific issues in superstring theory as follows: regularization of open superstring from oriented closed surface and worldsheet supersymmetry. Regarding the first issue, the author discusses a technical issue occurring in the open superstring which allows introduction of a multiplicative Chan-Paton factor. For O(N) groups the adjoint representation is the antisymmetric part of N x N and this simple property is lacking in the exceptional groups. The author discusses how for superstrings there are two relevant kinds of supersymmetry: spacetime supersymmetry in d = 10 spacetime dimensions and worldsheet supersymmetry in d = 2 worldsheet dimensions. Until a few months ago, all known superstrings possessed both: at least N = 1 spacetime supersymmetry and at lest (1,0) worldsheet supersymmetry. Recently, however, an 0(16) x 0(16) superstring was proposed with no spacetime supersymmetry; the model has infrared problems on flat M10 but these problems might be cured by compactification. This motivates one to study the restrictions on the six-dimensional compact manifold for the case without spacetime supersymmetry. The author finds that (2,2) worldsheet supersymmetry and quantum conformal invariance of the two-dimensional field theory lead to equally strong restrictions as does the assumption of preserving a spacetime supersymmetry

  12. Topics of Evolutionary Computation 2001

    DEFF Research Database (Denmark)

    Ursem, Rasmus Kjær

    This booklet contains the student reports from the course: Topics of Evolutionary Computation, Fall 2001, given by Thiemo Krink, Rene Thomsen and Rasmus K. Ursem......This booklet contains the student reports from the course: Topics of Evolutionary Computation, Fall 2001, given by Thiemo Krink, Rene Thomsen and Rasmus K. Ursem...

  13. Topical betamethasone for prevention of radiation dermatitis

    Directory of Open Access Journals (Sweden)

    Omidvari Shapour

    2007-01-01

    Full Text Available Background: Although acute radiation dermatitis (ARD is a common side-effect of radiotherapy (RT, currently there is no general consensus about its prevention or treatment of choice. Aims: The purpose of this study was to investigate whether prophylactic use of topical betamethasone 0.1% can prevent ARD caused by chest wall irradiation. Methods: Fifty-one patients who underwent modified radical mastectomy for breast cancer and were going to receive RT, were randomly assigned to receive topical betamethasone 0.1%, petrolatum or none during RT. The frequency and severity of ARD (measured using Radiation Therapy Oncology Group acute radiation morbidity scoring criteria were recorded at the end of each week during RT and two weeks after its completion. Clinical outcomes were analyzed by relevant statistical methods. Results: All patients developed some degree of ARD, the frequency and severity of which increased with time and reached the maximum at the end of the seventh week for all groups. Patients receiving betamethasone had less severe ARD than the other two groups throughout the course of the study, but this difference was significant only at the end of the third week (p =0.027. No significant difference was observed between the petrolatum and control arms. Conclusion: Prophylactic and ongoing use of topical betamethasone 0.1% during chest wall RT for breast cancer delays occurrence of ARD but does not prevent it. Petrolatum has no effect on the prevention of ARD in these patients.

  14. Advancements in Topical Antifungal Vehicles.

    Science.gov (United States)

    Kircik, Leon H

    2016-02-01

    The primary treatment for superficial fungal infections is antifungal topical formulations, and allylamines and azoles represent the two major classes of topical formulations that are used to treat these infections. The stratum corneum (SC) is composed of keratinocytes that are surrounded by a matrix of lipids. The efficacy of topically applied formulations depends on their ability to penetrate this lipid matrix, and the vehicle plays an integral role in the penetration of active molecule into skin. There are several challenges to formulating topical drugs, which include the biotransformation of the active molecules as they pass through the SC and the physical changes that occur to the vehicle itself when it is applied to the skin. This article will review current and emerging topical antifungal vehicles. PMID:26885798

  15. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  16. Ozone mitigation tests at the APS

    International Nuclear Information System (INIS)

    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented

  17. Groups, combinatorics and geometry

    CERN Document Server

    Ivanov, A A; Saxl, J

    2003-01-01

    Over the past 20 years, the theory of groups in particular simplegroups, finite and algebraic has influenced a number of diverseareas of mathematics. Such areas include topics where groups have beentraditionally applied, such as algebraic combinatorics, finitegeometries, Galois theory and permutation groups, as well as severalmore recent developments.

  18. Inhibition of Corneal Neovascularization by Topical and Subconjunctival Tigecycline

    Directory of Open Access Journals (Sweden)

    Sertan Goktas

    2014-01-01

    Full Text Available Objective. To investigate the effects of topical and subconjunctival tigecycline on the prevention of corneal neovascularization. Materials and Methods. Following chemical burn, thirty-two rats were treated daily with topical instillation of 1 mg/mL tigecycline (group 1 or subconjunctival instillation of 1 mg/mL tigecycline (group 3 for 7 days. Control rats received topical (group 2 or subconjunctival (group 4 0.9% saline. Digital photographs of the cornea were taken on the eighth day after treatment and analyzed to determine the percentage area of the cornea covered by neovascularization. Corneal sections were analyzed histopathologically. Results. The median percentages of corneal neovascularization in groups 1 and 3 were 48% (95% confidence interval (CI, 44.2–55.8% and 33.5% (95% CI, 26.6–39.2%, respectively. The median percentages of corneal neovascularization of groups 1 and 3 were significantly lower than that of the control group (P=0.03 and P<0.001, resp.. Histologic examination of samples from groups 1 and 3 showed lower vascularity than that of control groups. Conclusion. Topical and subconjunctival administration of tigecycline seems to be showing promising therapeutic effects on the prevention of corneal neovascularization. Furthermore, subconjunctival administration of tigecycline is more potent than topical administration in the inhibition of corneal neovascularization.

  19. Topics In Quantum Geometry

    CERN Document Server

    Raugas, M V

    2001-01-01

    In this work, we investigate different features of the quantum geometry associated to string theory. In chapter one, we use the language of quiver theory to determine the toric part of the classical moduli space of D-branes on a nonabelian Calabi-Yau threefold singularity and see that it admits topology-changing transitions. In chapter two, we determine the worldvolume field theories of D3-branes transverse to Calabi-Yau cones over singular Fano surfaces, which can be realized as partial resolutions of an orbifold of complex three-space by a discrete group. A mismatch between the isometries of the complex line bundle over the Fano surfaces and the discrete symmetries of the effective superpotential is found. In chapter three, we investigate the quantum volume of D-branes wrapped around cycles of various dimension in Calabi-Yau fourfolds and fivefolds. We consider the cases of the sextic and heptic hypersurface Calabi-Yau manifolds, as well as one example in weighted projective space, and find expressions for...

  20. Dosimetry: an ARDENT topic

    CERN Multimedia

    CERN Bulletin

    2012-01-01

    The first annual ARDENT workshop took place in Vienna from 20 to 23 November. The workshop gathered together the Early-Stage Researchers (ESR) and their supervisors, plus other people involved from all the participating institutions.   “The meeting, which was organised with the local support of the Austrian Institute of Technology, was a nice opportunity for the ESRs to get together, meet each other, and present their research plans and some preliminary results of their work,” says Marco Silari, a member of CERN Radiation Protection Group and the scientist in charge of the programme. Two full days were devoted to a training course on radiation dosimetry, delivered by renowned experts. The workshop closed with a half-day visit to the MedAustron facility in Wiener Neustadt. ARDENT (Advanced Radiation Dosimetry European Network Training) is a Marie Curie ITN project funded under EU FP7 with €4 million. The project focuses on radiation dosimetry exploiting se...

  1. Topic Model for Graph Mining.

    Science.gov (United States)

    Xuan, Junyu; Lu, Jie; Zhang, Guangquan; Luo, Xiangfeng

    2015-12-01

    Graph mining has been a popular research area because of its numerous application scenarios. Many unstructured and structured data can be represented as graphs, such as, documents, chemical molecular structures, and images. However, an issue in relation to current research on graphs is that they cannot adequately discover the topics hidden in graph-structured data which can be beneficial for both the unsupervised learning and supervised learning of the graphs. Although topic models have proved to be very successful in discovering latent topics, the standard topic models cannot be directly applied to graph-structured data due to the "bag-of-word" assumption. In this paper, an innovative graph topic model (GTM) is proposed to address this issue, which uses Bernoulli distributions to model the edges between nodes in a graph. It can, therefore, make the edges in a graph contribute to latent topic discovery and further improve the accuracy of the supervised and unsupervised learning of graphs. The experimental results on two different types of graph datasets show that the proposed GTM outperforms the latent Dirichlet allocation on classification by using the unveiled topics of these two models to represent graphs. PMID:25616091

  2. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  3. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  4. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  5. Effects of systemic flunixin meglumine, topical oxytetracycline, and topical prednisolone acetate on tear film proteinases innormal horses

    OpenAIRE

    Rainbow, Marc E

    2004-01-01

    The purpose of this study was to determine the effects of three medical treatments, topical oxytetracycline, topical prednisolone acetate, and systemic flunixin meglumine, on the activity of two proteinases, matrix metalloproteinase-2 (MMP-2) and matrix metalloproteinase-9 (MMP-9), in equine tear film. The study design consisted of twelve ophthalmically normal horses separated into three groups of four in a cross-over study design. Each group was treated for 5 days with flunixin meglumine (...

  6. The future of topical analgesics.

    Science.gov (United States)

    Arnstein, Paul M

    2013-07-01

    Topically applied analgesic therapies have been used throughout history to treat a variety of patient conditions that present with pain. Before modem pharmaceuticals became readily available, mud-based emollients, salves, cold therapies, and other natural remedies were often used. Now we have effective therapies and are developing advanced topical analgesics as we learn more about the physiology and pathophysiology of pain. The use of topical analgesics may be associated with fewer patient systemic side effects than are seen with oral, parenteral, or transdermally administered agents, making the topical route of administration attractive to prescribers and patients. With further refinement of existing drugs and the development of novel agents, topical analgesics may offer relief for treating patient pain conditions that are currently challenging to treat, such as pain resulting from burns, wound debridement, and pressure ulcers. Recognizing the value of a multimodal approach, topical analgesics may offer a therapeutic option that can become part of a comprehensive treatment plan for the patient. With continued advancements in targeted drug-delivery systems, topical analgesics may be able to provide a method to prevent or reverse the phenomena of peripheral and central sensitization, or the neuroplastic changes believed to be responsible for the transition from acute to chronic pain states in patients. For those patients at risk for developing chronic pain states, such as complex regional pain syndrome, the combination of cutaneous stimulation (achieved through rubbing during application) and analgesic effects produced by the drug itself may prevent the disabling pain that often emerges during the subacute phase of disease. In summary, better utilization of currently available topical analgesics and continued research promise to ensure that topical analgesics are, and will continue to be, important tools in the treatment of patients with resistant pain. PMID

  7. Correction magnet power supplies for APS machine

    International Nuclear Information System (INIS)

    A number of correction magnets are required for the advanced photon source (APS) machine to correct the beam. There are five kinds of correction magnets for the storage ring, two for the injector synchrotron, and two for the positron accumulator ring (PAR). Table I shoes a summary of the correction magnet power supplies for the APS machine. For the storage ring, the displacement of the quadrupole magnets due to the low frequency vibration below 25 Hz has the most significant effect on the stability of the positron closed orbit. The primary external source of the low frequency vibration is the ground motion of approximately 20 μm amplitude, with frequency components concentrated below 10 Hz. These low frequency vibrations can be corrected by using the correction magnets, whose field strengths are controlled individually through the feedback loop comprising the beam position monitoring system. The correction field require could be either positive or negative. Thus for all the correction magnets, bipolar power supplies (BPSs) are required to produce both polarities of correction fields. Three different types of BPS are used for all the correction magnets. Type I BPSs cover all the correction magnets for the storage ring, except for the trim dipoles. The maximum output current of the Type I BPS is 140 Adc. A Type II BPS powers a trim dipole, and its maximum output current is 60 Adc. The injector synchrotron and PAR correction magnets are powered form Type III BPSs, whose maximum output current is 25 Adc

  8. APS insertion devices: Recent developments and results

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) now has a total of 23 insertion devices (IDs). Over two-thirds of them are installed on the storage ring. The installed devices include 18, 27 and 55 mm-period undulators; an 85 mm-period wiggler; a 16 cm-period elliptical multipole wiggler; and many 33 mm-period undulators. Most of the IDs occupy storage-ring straight sections equipped with 8 mm vertical-aperture vacuum chambers. All of the IDs were measured magnetically at the APS and, in most cases, underwent a final magnetic tuning in order to minimize variation in the various integrals of the field through the ID over the full gap range. Special shimming techniques to correct magnetic field parameters in appropriate gap-dependent ways were developed and applied. Measurements of the closed-orbit distortion as a function of the ID gap variation have been completed, and results are in a good agreement with magnetic measurements. Spectral diagnostics of the ID radiation, including measurements of the absolute spectral flux, brilliance and polarization, show excellent agreement between calculated and measured results. Studies of the sensitivity of IDs to radiation exposure and measurements of the dose rate received by the IDs are in progress

  9. The APS control system network upgrade

    International Nuclear Information System (INIS)

    When it was installed,the Advanced Photon Source (APS) control system network was at the state-of-the-art. Different aspects of the system have been reported at previous meetings [1,2]. As loads on the controls network have increased due to newer and faster workstations and front-end computers, we have found performance of the system declining and have implemented an upgraded network. There have been dramatic advances in networking hardware in the last several years. The upgraded APS controls network replaces the original FDDI backbone and shared Ethernet hubs with redundant gigabit uplinks and fully switched 10/100 Ethernet switches with backplane fabrics in excess of 20 Gbits/s (Gbps). The central collapsed backbone FDDI concentrator has been replaced with a Gigabit Ethernet switch with greater than 30 Gbps backplane fabric. Full redundancy of the system has been maintained. This paper will discuss this upgrade and include performance data and performance comparisons with the original network

  10. Abelian groups

    CERN Document Server

    Fuchs, László

    2015-01-01

    Written by one of the subject’s foremost experts, this book focuses on the central developments and modern methods of the advanced theory of abelian groups, while remaining accessible, as an introduction and reference, to the non-specialist. It provides a coherent source for results scattered throughout the research literature with lots of new proofs. The presentation highlights major trends that have radically changed the modern character of the subject, in particular, the use of homological methods in the structure theory of various classes of abelian groups, and the use of advanced set-theoretical methods in the study of undecidability problems. The treatment of the latter trend includes Shelah’s seminal work on the undecidability in ZFC of Whitehead’s Problem; while the treatment of the former trend includes an extensive (but non-exhaustive) study of p-groups, torsion-free groups, mixed groups, and important classes of groups arising from ring theory. To prepare the reader to tackle these topics, th...

  11. Genome-wide investigation and expression profiling of AP2/ERF transcription factor superfamily in foxtail millet (Setaria italica L..

    Directory of Open Access Journals (Sweden)

    Charu Lata

    Full Text Available The APETALA2/ethylene-responsive element binding factor (AP2/ERF family is one of the largest transcription factor (TF families in plants that includes four major sub-families, namely AP2, DREB (dehydration responsive element binding, ERF (ethylene responsive factors and RAV (Related to ABI3/VP. AP2/ERFs are known to play significant roles in various plant processes including growth and development and biotic and abiotic stress responses. Considering this, a comprehensive genome-wide study was conducted in foxtail millet (Setaria italica L.. A total of 171 AP2/ERF genes were identified by systematic sequence analysis and were physically mapped onto nine chromosomes. Phylogenetic analysis grouped AP2/ERF genes into six classes (I to VI. Duplication analysis revealed that 12 (∼7% SiAP2/ERF genes were tandem repeated and 22 (∼13% were segmentally duplicated. Comparative physical mapping between foxtail millet AP2/ERF genes and its orthologs of sorghum (18 genes, maize (14 genes, rice (9 genes and Brachypodium (6 genes showed the evolutionary insights of AP2/ERF gene family and also the decrease in orthology with increase in phylogenetic distance. The evolutionary significance in terms of gene-duplication and divergence was analyzed by estimating synonymous and non-synonymous substitution rates. Expression profiling of candidate AP2/ERF genes against drought, salt and phytohormones revealed insights into their precise and/or overlapping expression patterns which could be responsible for their functional divergence in foxtail millet. The study showed that the genes SiAP2/ERF-069, SiAP2/ERF-103 and SiAP2/ERF-120 may be considered as potential candidate genes for further functional validation as well for utilization in crop improvement programs for stress resistance since these genes were up-regulated under drought and salinity stresses in ABA dependent manner. Altogether the present study provides new insights into evolution, divergence and

  12. Evaluating EPA’s AP-42 development methodology to convert or rerate current AP-42 datasets

    Science.gov (United States)

    In August 2013, the U.S. Environmental Protection Agency’s (EPA) published their new methodology for updating the Compilation of Air Pollution Emission Factors (AP-42). The “Recommended Procedures for Development of Emissions Factors and Use of the WebFIRE Database” instructs that the ratings of the...

  13. Angular momentum in quantum mechanics as a group study topic

    International Nuclear Information System (INIS)

    A largely practical approach to the teaching of angular momentum in quantum mechanics at the undergraduate level is described. In an intensive seven week period towards the end of their final year, undergraduates working in pairs perform experiments in nuclear physics which demonstrate some of the important properties of angular momentum. Three experiments are selected and discussed in this article to illustrate the teaching method. The existence of intrinsic spin and parity is investigated by measuring the polarisation of annihilation radiation; the conservation of angular momentum is demonstrated by a measurement of orbital angular momentum in a nucleon transfer reaction and the coupling of angular momenta is illustrated by the method of angular correlation. (author)

  14. Health Topic XML File Description

    Science.gov (United States)

    ... XML File Description: MedlinePlus URL of this page: https://www.nlm.nih.gov/medlineplus/xmldescription.html Health ... corresponding health topic page on MedlinePlus. Example: url="https://www.nlm.nih.gov/medlineplus/abdominalpain.html" Use ...

  15. Selected topics in nuclear structure

    International Nuclear Information System (INIS)

    The collection of abstracts on selected topics in nuclear structure are given. Special attention pays to collective excitations and high-spin states of nuclei, giant resonance structure, nuclear reaction mechanisms and so on

  16. Topics of Bioengineering in Wikipedia

    Directory of Open Access Journals (Sweden)

    Vassia Atanassova

    2009-10-01

    Full Text Available The present report aims to give a snapshot of how topics from the field of bioengineering (bioinformatics, bioprocess systems, biomedical engineering, biotechnology, etc. are currently covered in the free electronic encyclopedia Wikipedia. It also offers insights and information about what Wikipedia is, how it functions, how and when to cite Wikipedian articles, if necessary. Several external wikis, devoted to topics of bioengineering, are also listed and reviewed.

  17. Key Topics in Sports Medicine

    OpenAIRE

    Amir Ali Narvani; Panagiotis Thomas; Burce Lynn

    2006-01-01

    Key Topics in Sports Medicine is a single quick reference source for sports and exercise medicine. It presents the essential information from across relevant topic areas, and includes both the core and emerging issues in this rapidly developing field. It covers: 1) Sports injuries, rehabilitation and injury prevention, 2) Exercise physiology, fitness testing and training, 3) Drugs in sport, 4) Exercise and health promotion, 5) Sport and exercise for special and clinical populations, 6) The ps...

  18. A Comparative Study On The Action Potential Simulation (APS Therapy And The Routine Physiotherapy Protocol In Knee Osteoarthritisin Elderly People

    Directory of Open Access Journals (Sweden)

    Abbas Rahimi

    2012-04-01

    Full Text Available Background and Aim: Knee osteoarthritis is the most common cause for which the elderly people refere to physiotherapy outpatient clinics. This study aimed to investigate the effects of the Action Potential Stimulation (APS Therapy and the routine physiotherapy (PT protocol on relieving pain and swelling as well as the duration of the relief period in patients with knee osteoarthritis. Materials and Methods: 69 patients (62 females & 7 males with knee osteoarthritis were recruited in this study. The subjects were divided into two groups including APS Therapy (n=37, mean age: 55±13 years old and the routine PT protocol (n=32, mean age: 61±14 years old groups. A 10-session treatment period was carried out for each group; and their pain and swelling were measured at the first, fifth and tenth sessions and also one-month after the last session (follow up. The swelling was measured using measuring the circumference of the knee on the patella, 5 Cm above and 5 Cm below the patella. The routine PT protocol consisted of hot pack, ultrasound, TENS and exercise; and the APS therapy protocol included hot pack, APS Therapy and the same exercise. During the follow up, 50 out of 61 subjects were called on the phone and any pain changes were recorded.Results: In terms of swelling, the results showed significant reduction just on the patella only in the APS Therapy group (P<0.05. Visual Analogue Pain Scale (VAPS indicated a significant pain reduction in both groups. However, the APS Therapy group showed significantly pain reduction at the end of sessions five, ten and the follow up session (P<0.05. It was also revealed that while routine PT subjects showed no significant pain changes between the tenth and the follow up session, a gradual pain reduction was seen in the APS therapy group during this period (P<0.05. A gradual dosage reduction was recorded only in the APS therapy group, indicating a slight correlation with pain reduction (r=0.4.Conclusion: The

  19. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  20. Network Cooperation for Client-AP Association Optimization

    OpenAIRE

    Baid, Akash; Schapira, Michael; Seskar, Ivan; Rexford, Jennifer; Raychaudhuri, Dipankar

    2012-01-01

    In a WiFi deployment with multiple access points, optimizing the way each client selects an AP from amongst the available choices, has a significant impact on the realized performance. When two or more such multi-AP networks are deployed in the same region, APs from different networks can cause severe interference to one another. In this paper, we study how inter-network interference effects the intra-network association optimization and propose a cooperative optimization scheme to mitigate t...

  1. Genome-wide analysis of AP2/ERF transcription factors in carrot (Daucus carota L.) reveals evolution and expression profiles under abiotic stress.

    Science.gov (United States)

    Li, Meng-Yao; Xu, Zhi-Sheng; Huang, Ying; Tian, Chang; Wang, Feng; Xiong, Ai-Sheng

    2015-12-01

    AP2/ERF is a large transcription factor family that regulates plant physiological processes, such as plant development and stress response. Carrot (Daucus carota L.) is an important economical crop with a genome size of 480 Mb; the draft genome sequencing of this crop has been completed by our group. However, little is known about the AP2/ERF factors in carrot. In this study, a total of 267 putative AP2/ERF factors were identified from the whole-genome sequence of carrot. These AP2/ERF proteins were phylogenetically clustered into five subfamilies based on their similarity to the amino acid sequences from Arabidopsis. The distribution and comparative genome analysis of the AP2/ERF factors among plants showed the AP2/ERF factors had expansion during the evolutionary process, and the AP2 domain was highly conserved during evolution. The number of AP2/ERF factors in land plants expanded during their evolution. A total of 60 orthologous and 145 coorthologous AP2/ERF gene pairs between carrot and Arabidopsis were identified, and the interaction network of orthologous genes was constructed. The expression patterns of eight AP2/ERF family genes from each subfamily (DREB, ERF, AP2, and RAV) were related to abiotic stresses. Yeast one-hybrid and β-galactosidase activity assays confirmed the DRE and GCC box-binding activities of DREB subfamily genes. This study is the first to identify and characterize the AP2/ERF transcription factors in carrot using whole-genome analysis, and the findings may serve as references for future functional research on the transcription factors in carrot. PMID:25971861

  2. Market analysis of APS/SCM applications and technologies

    OpenAIRE

    Prášil, Zdeněk

    2009-01-01

    The bachelor thesis aims to describe a current worldwide market of APS/SCM technologies and applications , i.e. advanced planned scheduling /supply chain management. In the first part, the APS/SCM is described in theory. The APS/SCM is defined and its benefits and impacts on company are discussed. The next part of the work is focused on the market with APS/SCM and the distribution of forces in the market. The demand and supply of this market segment is analyzed. In the last part, solutions of...

  3. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    International Nuclear Information System (INIS)

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability

  4. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  5. Topical agents in burn care

    Directory of Open Access Journals (Sweden)

    Momčilović Dragan

    2002-01-01

    Full Text Available Introduction Understanding of fluid shifts and recognition of the importance of early and appropriate fluid replacement therapy have significantly reduced mortality in the early post burn period. After the bum patient successfully passes the resuscitation period, the burn wound represents the greatest threat to survival. History Since the dawn of civilization, man has been trying to find an agent which would help burn wounds heal, and at the same time, not harm general condition of the injured. It was not until the XX century, after the discovery of antibiotics, when this condition was fulfilled. In 1968, combining silver and sulfadiazine, fox made silver-sulfadiazine, which is a 1% hydro-soluble cream and a superior agent in topical treatment of burns today. Current topical agents None of the topical antimicrobial agents available today, alone or combined, have the characteristics of ideal prophylactic agents, but they eliminate colonization of burn wound, and invasive infections are infrequent. With an excellent spectrum of activity, low toxicity, and ease of application with minimal pain, silver-sulfadiazine is still the most frequently used topical agent. Conclusion The incidence of invasive infections and overall mortality have been significantly reduced after introduction of topical burn wound antimicrobial agents into practice. In most burn patients the drug of choice for prophylaxis is silver sulfadiazine. Other agents may be useful in certain clinical situations.

  6. Treatment of phimosis with topical steroids and foreskin anatomy

    OpenAIRE

    Tatiana C. Marques; Sampaio, Francisco J.B.; Luciano A. Favorito

    2005-01-01

    OBJECTIVES: To correlate topical steroidal treatment of stenosed foreskin with the different degrees of glans exposure and the length of time the ointment is applied. MATERIALS AND METHODS: We studied 95 patients with phimosis, divided according to the degree of foreskin retraction. Group A presented no foreskin retraction, group B presented exposure of only the urethral meatus, group C presented exposure of half of the glans, and group D presented exposure of the glans, which was incomplete ...

  7. Genome-Wide Identification of the Target Genes of AP2-O, a Plasmodium AP2-Family Transcription Factor.

    Science.gov (United States)

    Kaneko, Izumi; Iwanaga, Shiroh; Kato, Tomomi; Kobayashi, Issei; Yuda, Masao

    2015-05-01

    Stage-specific transcription is a fundamental biological process in the life cycle of the Plasmodium parasite. Proteins containing the AP2 DNA-binding domain are responsible for stage-specific transcriptional regulation and belong to the only known family of transcription factors in Plasmodium parasites. Comprehensive identification of their target genes will advance our understanding of the molecular basis of stage-specific transcriptional regulation and stage-specific parasite development. AP2-O is an AP2 family transcription factor that is expressed in the mosquito midgut-invading stage, called the ookinete, and is essential for normal morphogenesis of this stage. In this study, we identified the genome-wide target genes of AP2-O by chromatin immunoprecipitation-sequencing and elucidate how this AP2 family transcription factor contributes to the formation of this motile stage. The analysis revealed that AP2-O binds specifically to the upstream genomic regions of more than 500 genes, suggesting that approximately 10% of the parasite genome is directly regulated by AP2-O. These genes are involved in distinct biological processes such as morphogenesis, locomotion, midgut penetration, protection against mosquito immunity and preparation for subsequent oocyst development. This direct and global regulation by AP2-O provides a model for gene regulation in Plasmodium parasites and may explain how these parasites manage to control their complex life cycle using a small number of sequence-specific AP2 transcription factors. PMID:26018192

  8. Topical corticosteroid addiction and phobia

    Directory of Open Access Journals (Sweden)

    Aparajita Ghosh

    2014-01-01

    Full Text Available Corticosteroids, one of the most widely prescribed topical drugs, have been used for about six decades till date. However, rampant misuse and abuse down the years has given the drug a bad name. Topical steroid abuse may lead to two major problems which lie at the opposing ends of the psychosomatic spectrum. Topical steroid addiction, a phenomenon that came to be recognized about a decade after the introduction of the molecule is manifested as psychological distress and rebound phenomenon on stoppage of the drug. The rebound phenomenon, which can affect various parts of the body particularly the face and the genitalia has been reported by various names in the literature. TC phobia which lies at the opposite end of the psychiatric spectrum of steroid abuse has been reported particularly among parents of atopic children. Management of both conditions is difficult and frustrating. Psychological counseling and support can be of immense help in both the conditions.

  9. Topical corticosteroid addiction and phobia.

    Science.gov (United States)

    Ghosh, Aparajita; Sengupta, Sujata; Coondoo, Arijit; Jana, Amlan Kusum

    2014-09-01

    Corticosteroids, one of the most widely prescribed topical drugs, have been used for about six decades till date. However, rampant misuse and abuse down the years has given the drug a bad name. Topical steroid abuse may lead to two major problems which lie at the opposing ends of the psychosomatic spectrum. Topical steroid addiction, a phenomenon that came to be recognized about a decade after the introduction of the molecule is manifested as psychological distress and rebound phenomenon on stoppage of the drug. The rebound phenomenon, which can affect various parts of the body particularly the face and the genitalia has been reported by various names in the literature. TC phobia which lies at the opposite end of the psychiatric spectrum of steroid abuse has been reported particularly among parents of atopic children. Management of both conditions is difficult and frustrating. Psychological counseling and support can be of immense help in both the conditions. PMID:25284851

  10. Quantum mechanics II advanced topics

    CERN Document Server

    Rajasekar, S

    2015-01-01

    Quantum Mechanics II: Advanced Topics uses more than a decade of research and the authors’ own teaching experience to expound on some of the more advanced topics and current research in quantum mechanics. A follow-up to the authors introductory book Quantum Mechanics I: The Fundamentals, this book begins with a chapter on quantum field theory, and goes on to present basic principles, key features, and applications. It outlines recent quantum technologies and phenomena, and introduces growing topics of interest in quantum mechanics. The authors describe promising applications that include ghost imaging, detection of weak amplitude objects, entangled two-photon microscopy, detection of small displacements, lithography, metrology, and teleportation of optical images. They also present worked-out examples and provide numerous problems at the end of each chapter.

  11. Application of Topic Map on Knowledge Organization

    Directory of Open Access Journals (Sweden)

    Sou-shan Wu

    2003-06-01

    Full Text Available Knowledge management (KM has received much attention from both academics and practitioners in the past few years. Following the KM trend, many organizations have built their own knowledge repositories or data warehouses. However, information or knowledge is still scattered everywhere without being properly managed. The rapid growth of the Internet accelerates the creation of unstructured and unclassified information and causes the explosion of information overload. The effort of browsing information through general-purpose search engines turns out to be tedious and painstaking. Hence, an effective technology to solve this information retrieval problem is much needed. The purpose of this research is to explore the application of text mining technique in organizing knowledge stored in unstructured natural language text documents. Major components of text mining techniques required for topic map in particular will be presented in detail.Two sets of unstructured documents are utilized to demonstrate the usage of SOM for topic categorization. The first set of documents is a collection of speeches given by Y.C. Wang, Chairman of the Taiwan Plastics Group, and the other is the collection of all laws and regulations related to securities and future markets in Taiwan. We also try to apply text mining to these two sets of documents to generate their respective topic maps, thus revealing the differences between organizing explicit and tacit knowledge as well as the difficulties associated with tacit knowledge.[Article content in Chinese

  12. Anesthetic effectiveness of topical levobupivacaine 0.75% versus topical proparacaine 0.5% for intravitreal injections

    Directory of Open Access Journals (Sweden)

    Nurgül Örnek

    2014-01-01

    Full Text Available Background and Purpose: Today no method of topical anesthesia for intravitreal injection administration has been proven to make the patient comfortable yet. We compared the efficacy of topical levobupivacaine 0.75% and proparacaine 0.5% in patients undergoing intravitreal injections. Materials and Methods: A prospective, randomized study comparing two agents for topical anesthesia in intravitreal injections. Ninety-six consecutive patients were enrolled into two groups to receive either topical levobupivacaine 0.75% (n=48 or proparacaine 0.5% (n=48. Patients were asked to score their pain using a visual analog scale (VAS immediately following the injection. The average of these scores was used as the primary outcome. The surgeon performing the procedure scored his perception of the patients′ pain using the Wong-Baker FACES scale. Results: Mean VAS pain scores for two groups were found to be 44.77 ± 16.42 and 34.18 ± 14.83, respectively. Mean VAS pain score in the proparacaine group was significantly lower than that in the levobupivacaine group (P= 0.003. Mean Wong-Baker FACES scores for the two groups were 1.08 ± 0.49 and 1.10 ± 0.30, respectively. There was no statistically significant difference between levobupivacaine and proparacaine groups (P=0.824. Conclusions: Topical proparacaine 0.5% was more effective in preventing pain during intravitreal injections.

  13. [Topical administration of cyclosporin in psoriasis vulgaris].

    Science.gov (United States)

    Bunse, T; Schulze, H J; Mahrle, G

    1990-06-01

    Two groups of patients with chronic plaque psoriasis were topically treated either with 10% cyclosporin in a jelly base or with 5% cyclosporin in an ointment base under occlusion. We found that cyclosporin penetrates into the lower epidermis and the dermis, when it is applied under occlusion. Obviously, the target cells are neutrophil granulocytes, since they decrease in number under cyclosporin, whereas the other inflammatory cells as well as the epidermal proliferation remain unchanged. In contrast to systemic application of cyclosporin, we did not observe any clinical differences between plaques treated with cyclosporin and those treated with placebo. PMID:2202163

  14. Selected topics in nuclear structure

    International Nuclear Information System (INIS)

    The Fourth International Conference on selected topics in nuclear structure was held at Dubna in July 1994 on recent experimental and theoretical investigations in nuclear structure. Topics discussed were the following: nuclear structure at low-energy excitations (collective quasiparticle phenomena, proton-neutron interactions, microscopic and phenomenological theories of nuclear structure; nuclear structure studies with charged particles. heavy ions, neutrons and photons; nuclei at high angular momenta and superdeformation, structure and decay properties of giant resonances, charge-exchange resonances and β-decay; semiclassical approach of large amplitude collective motion and structure of hot nuclei

  15. Topics in millimeter wave technology

    CERN Document Server

    Button, Kenneth

    1988-01-01

    Topics in Millimeter Wave Technology, Volume 1 presents topics related to millimeter wave technology, including fin-lines and passive components realized in fin-lines, suspended striplines, suspended substrate microstrips, and modal power exchange in multimode fibers. A miniaturized monopulse assembly constructed in planar waveguide with multimode scalar horn feeds is also described. This volume is comprised of five chapters; the first of which deals with the analysis and synthesis techniques for fin-lines as well as the various passive components realized in fin-line. Tapers, discontinuities,

  16. Topics in current aerosol research

    CERN Document Server

    Hidy, G M

    1971-01-01

    Topics in Current Aerosol Research deals with the fundamental aspects of aerosol science, with emphasis on experiment and theory describing highly dispersed aerosols (HDAs) as well as the dynamics of charged suspensions. Topics covered range from the basic properties of HDAs to their formation and methods of generation; sources of electric charges; interactions between fluid and aerosol particles; and one-dimensional motion of charged cloud of particles. This volume is comprised of 13 chapters and begins with an introduction to the basic properties of HDAs, followed by a discussion on the form

  17. High death rate in mice treated topically with diclofenac

    DEFF Research Database (Denmark)

    Lerche, Catharina M; Philipsen, Peter A; Poulsen, Thomas;

    2011-01-01

    ). Diclofenac was applied topically on the backs of hairless, female, C3.Cg/TifBomTac immunocompetent mice three times weekly followed by ultraviolet radiation (2, 3, or 4 Standard Erythema Dose) until death. There was a significant difference in survival between diclofenac-treated groups and control groups (P...

  18. Safety of warfarin therapy during cataract surgery under topical anesthesia

    OpenAIRE

    2015-01-01

    ABSTRACT Purpose: To analyze the safety of warfarin therapy during cataract surgery under topical anesthesia. Methods: This was a prospective nonrandomized comparative study of 60 eyes of 60 patients treated with or without concurrent oral warfarin anticoagulant therapy, referred for cataract surgery under topical anesthesia. The sample included a treatment (n=30) and a control (n=30) group. Results: There were no records of intraoperative or postoperative intracameral bleeding complications ...

  19. Residual radiation studies at AP0

    Energy Technology Data Exchange (ETDEWEB)

    Alexander J Elwyn et al.

    2002-06-19

    The radiation environment at the NuMI experiment has received a lot of attention in the last few years in preparation for project construction. One important issue is the induced radioactivation of the components in the beam line and the shielding materials. This arises from irradiation by hadrons that are generated in the target. Since the level of the residual activity has to be considered when determining access procedures for maintenance during NuMI operation, an understanding of the properties of the remnant radiation is important. To this end, experimental studies were performed in the target vault at AP0 which is similar in design to the NuMI target area. Here 120 GeV protons bombard a target, generating the hadrons that produce the induced radioactivity. Two sets of samples each consisting of three small cylindrical or rectangular solids of iron and steel, one sample of aluminum, and one of concrete were irradiated. One set was hung just below the bottom of a module near the lithium lens (in-vault), and the other was placed on top of the modules downstream of this location (above-vault), just beneath the movable concrete roof of the vault at AP0. Further, four thin activation foils of Au, Au+Cd, In, and Al (along with small disks of the same iron, aluminum, and concrete samples discussed above) were mounted on four 10.2 cm diameter Al disks, one placed on the in-vault module and three at above-vault downstream locations as well. The radioactivity of all these materials on the 10.2 cm Al disks was determined at the Radioisotope Analysis Facility in an attempt to characterize the radionuclides produced during irradiation. The activities of the thin foils were employed in an effort to unfold a spectrum of the neutrons produced during the hadronic cascades in the target. The MARS Monte Carlo code (MO95, MO00) was used to predict and analyze the residual radiation produced during the beam irradiation. New subroutines have been developed for the MARS14 version

  20. Status of the Advanced Photon Source (APS) linear accelerator

    International Nuclear Information System (INIS)

    A 2856-MHz S-band, 450-MeV electron/positron linear accelerator is the first part of the injector for the Advanced Photon Source (APS) 7-GeV storage ring. Construction of the APS linac is currently nearing completion, and commissioning will begin in July 1993. The linac and its current status are discussed in this paper

  1. AP1000 passive safety system design and analysis

    International Nuclear Information System (INIS)

    Westinghouse Electric Company has designed an advanced 600 MW nuclear power plant called the AP600. The AP600 uses passive safety systems to enhance plant safety and to satisfy US licensing requirements. The use of passive safety systems has provided significant and measurable improvements in plant simplification, safety, reliability, investment protection and plant costs. The overnight capital cost for the first AP600 plant is calculated to be between 1300- 1500 $/kw depending on the site selection. Although the AP600 is the most cost effective plant ready for deployment, it is still more expensive than the $1000/kw needed to compete in the United States today. In order to develop a cost competitive nuclear power plant Westinghouse has completed design studies which demonstrate that it is feasible to increase the power output of the AP600 to at least 1000 MW, maintaining its current design configuration, use of proven components and licensing basis. The AP1000 reactor and passive safety features retain the same configuration as the AP600. The approach to designing the passive core cooling features is to evaluate each feature to determine if changes are necessary to provide proper safety margins at the higher power rating. Both design basis and PRA based accidents sequences are considered in this evaluation. Insights from the extensive AP600 test and analysis program are used to assist in this process. The results of preliminary accident analysis for DBA and PRA sequences are used to demonstrate the effectiveness of this approach. (author)

  2. A Closer Examination of the Academic Benefits of AP

    Science.gov (United States)

    McKillip, Mary E. M.; Rawls, Anita

    2013-01-01

    The authors sought to better understand the relationship between students participating in the Advanced Placement (AP) program and subsequent performance on the Scholastic Aptitude Test (SAT). Focusing on students graduating from U.S. public high schools in 2010, the authors used propensity scores to match junior year AP examinees in 3 subjects to…

  3. AP-42 ADDITIONS AND REVISIONS - LANDFILLS (COMBUSTION CONTROLS)

    Science.gov (United States)

    This project develops emission factors, etc., for landfills, in particular for combustion devices fed by landfill gas, for incorporation into AP-42. AP-42 is a massive collection of information concerning processes which generate air emissions and presents emission factors and co...

  4. Data-Based Decision Making: The Road to AP Equity

    Science.gov (United States)

    Edwards, Kelcey; Duggan, Odette

    2012-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Lake Buena Vista, FL in July 2012. This presentation reviews concepts central to achieving equitable AP access and success for all willing and academically prepared students. We analyze trends in participation and performance by race/ethnicity from the AP Report to the Nation and…

  5. Training and development of the Assistant Practitioners (APs) in radiography

    International Nuclear Information System (INIS)

    A mixed methods study conducted over three phases (Phase I – scoping exercise, Phase II – questionnaire and Phase III – semi-structured interviews) aimed to explore the role and integration of the assistant practitioner (AP) practitioner in radiography from the AP perspective. Findings of the overall study are presented across a range of articles where this publication only presents the findings in relation to the training and education of APs from all three phases. Results showed the educational routes undertaken by APs in radiography during training. Training whilst working in the clinical department has highlighted a number of key issues relating to educational pathways and delivery methods. Findings showed that APs felt that more could be done to prepare the individual for clinical practice thereby increasing their confidence and facilitating role development. Results also identified a number of challenges in the training and education of APs in radiography. Clear routes of progression and career pathways are not available to APs in radiography. In conclusion the findings suggest the need for a review of existing educational programmes and future standardisation. The need exists to clarify the justifiable methods of training and differentiate between recognised educational qualifications to enable informed career development decisions by APs and their employers

  6. Teachers' Views of Moral Education Topics - Taiwan and the USA

    Science.gov (United States)

    Lin, Huey-Ya; Davidman, Patricia; Petersen, George; Thomas, R. Murray

    1998-01-01

    In a questionnaire survey, 94 teachers in Taiwan and 140 in the United States judged which topics among 20 moral issues would be appropriate subjects of study in grade six of the primary school and in the first year of the university. The issues related to religion, ethnicity, gender, health care, crime, alcohol, tobacco, gambling, guns, government corruption, birth control, caring for the elderly, and television programming. The results revealed great diversity of opinion within each group of respondents. No single topic was approved by all teachers in either group, nor was any topic rejected by all. Among the 234 teachers, no two offered precisely the same configuration of answers over the 20 topics. Nevertheless, some group trends could be identified for individual topics. For example, in both countries the great majority of respondents would teach about industrial pollution, whereas very few would approve of trying to identify the best religion. In the rationales teachers offered in support of their choices, the four reasons that figured most prominently in both countries were that a topic would contribute to the nation's welfare, would help students to make wise decisions, would be interesting for students, and would represent a peaceful way to face social problems.

  7. The development of beam current monitors in the APS

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) is a third-generation 7-GeV synchrotron radiation source. The precision measurement of beam current is a challenging task in high energy accelerators, such as the APS, with a wide range of beam parameters and complicated noise, radiation, and thermal environments. The beam pulses in the APS injector and storage ring have charge ranging from 50pC to 25nC with pulse durations varying from 30ps to 30ns. A total of nine non- intercepting beam current monitors have been installed in the APS facility (excluding those in the linac) for general current measurement. In addition, several independent current monitors with specially designed redundant interlock electronics are installed for personnel safety and machine protection. This paper documents the design and development of current monitors in the APS,. discusses the commissioning experience in the past year, and presents the results of recent operations

  8. Properties of LuAP: CE scintillator containing intentional impurities

    CERN Document Server

    Petrosyan, A G; Ovanesyan, K; Lecoq, Paul; Auffray, Etiennette; Trummer, Julia; Kronberger, Matthias; Pédrini, C; Dujardin, C; Anfre, P

    2007-01-01

    Single crystals of LuAP:Ce and LuYAP(Lu*70%):Ce co-doped with tetravalent (Hf and Zr) and pentavalent (Ta) ions were grown from melts by the Bridgman process. Underlying absorption, slope of the optical edge and transmission in the range of emission were compared to those of LuAP:Ce crystals. Absorption coefficients at 260 nm less than 2 cm−1 have been recorded in LuAP:Ce crystals containing tetravalent ions that are lower than the corresponding figures (5–6 cm−1) measured in undoped LuAP. At high concentrations of added impurities, despite of suppression of the parasitic underlying absorption below 300 nm, the slope of the optical edge and transmission in the range of emission are seriously damaged. Scintillation parameters of crystals with added impurities are compared to those of LuAP:Ce.

  9. AP1000, a nuclear central of advanced design

    International Nuclear Information System (INIS)

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  10. Facilities removal working group

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    This working group`s first objective is to identify major economic, technical, and regulatory constraints on operator practices and decisions relevant to offshore facilities removal. Then, the group will try to make recommendations as to regulatory and policy adjustments, additional research, or process improvements and/or technological advances, that may be needed to improve the efficiency and effectiveness of the removal process. The working group will focus primarily on issues dealing with Gulf of Mexico platform abandonments. In order to make the working group sessions as productive as possible, the Facilities Removal Working Group will focus on three topics that address a majority of the concerns and/or constraints relevant to facilities removal. The three areas are: (1) Explosive Severing and its Impact on Marine Life, (2) Pile and Conductor Severing, and (3) Deep Water Abandonments This paper will outline the current state of practice in the offshore industry, identifying current regulations and specific issues encountered when addressing each of the three main topics above. The intent of the paper is to highlight potential issues for panel discussion, not to provide a detailed review of all data relevant to the topic. Before each panel discussion, key speakers will review data and information to facilitate development and discussion of the main issues of each topic. Please refer to the attached agenda for the workshop format, key speakers, presentation topics, and panel participants. The goal of the panel discussions is to identify key issues for each of the three topics above. The working group will also make recommendations on how to proceed on these key issues.

  11. Using metallic filters in APS undulator beamlines

    International Nuclear Information System (INIS)

    Metallic filters are needed by APS users in their beamlines. Two general areas of use for the white-beam metallic filters are: (1) to attenuate the x-ray beam to reduce the thermal load during routine operations and (2) to attenuate the x-ray beam during alignment and for special testing of optics at low power. Metallic filters are important for users who will be working primarily in the high energy x-ray range because unwanted lower energy photons are absorbed through the metallic filters. Notwithstanding their high thermal conductivity, the metals, in general, absorb x-rays significantly near surface layers and hence can attain very large temperatures causing structural deformations and/or damage. Thermomechanical behavior and failure prediction need to be done carefully. In this paper, particulars of metallic filters are discussed and generalized analytical solutions are offered to help users of metallic filters determine their applicability for x-ray beamlines copyright 1996 American Institute of Physics

  12. Top-up operation experience at APS

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) is a 7-OeV, third-generation synchrotrons radiation source. To provide more stable beam for users, in September 1998 we began commissioning a new operating mode called ''top-up.'' In this mode, the beam current does not decay but is maintained at a high level using frequent injection, while photon shutters are open and photon beams are delivered to users. The hardware, software, and safety requirements for top-up will be reported. Safety issues related to injection with open photon shutters are covered in companion papers in this conference. Recent operational experience includes testing aspects of top-up injection and delivering beam to X-ray users for a few hours with fractional current stability of 10-3. We expect to run several top-up operation shifts in Spring 1999. Issues of importance are orbit and emittance transients during the injection and scheduling of injection pulses for the convenience of users

  13. Beam instability studies at the APS

    International Nuclear Information System (INIS)

    The Argonne Advanced Photon Source, APS (Fig. 1), is a 7-GeV positron storage ring with a circumference of 1104 m. It has a ''third generation, DBA or Chasman-Green'' lattice composed of 40 sectors each having a ∼6 m long zero-dispersion straight-section for accommodating insertion devices. Neighboring straight-sections are connected by a 360 degrees/40 = 9 degrees double-bend-achromatic bending section designed to produce the smallest emittance attainable with reasonable component parameter values and dynamic apertures. Thus, it is a very strongly focusing lattice with vx = 35.22 and vy = 14.30. The beam chamber of the storage ring including all rf, vacuum and photon beam components is designed to ensure that a beam current > 100 mA can be stably stored. We expect that the maximum stable beam current could be as high as 300 mA. This paper will give some details of the studies and computations to ensure the stability of such a beam. The discussions will be organized in the following three parts: Coupled-bunch instability caused by the higher-order modes (HOMs) of the rf cavities; Single-bunch instability due to the resistive wall impedance; and Single-bunch instability due to broadband impedances arising from beam chamber irregularities

  14. Topics in optics and music

    Science.gov (United States)

    Sparks, Andrew W.

    2012-10-01

    While the use of optics in the playback of music has been a tremendously successful technology and laser light shows are a common occurrence, other intersections of optics and music tend to be less well known. Topics such as optics-based instruments, performance tools and effects, instrument characterization and manufacturing, recording, playback, and signal processing are explored.

  15. The Health Curriculum: 500 Topics.

    Science.gov (United States)

    Byrd, Oliver E.

    2001-01-01

    This 1958 paper divides 500 health topics into 20 categories: health as a social accomplishment/social problem; nutrition; physical fitness; mental health and disease; heredity/eugenics; infection/immunity; chronic and degenerative disease; substance abuse; skin care; vision, hearing, and speech; dental health; safety; physical environment; health…

  16. Topics on Galactic Chemical Evolution

    OpenAIRE

    Prantzos, Nikos

    2011-01-01

    I discuss three different topics in Galactic chemical evolution:the "puzzling" absence of any observational signature of secondary elements ; the building of the Galactic halo in the framework of hierarchical galaxy formation, as evidenced from its metallicity distribution ; and the potentially important role that radial migration may play in the evolution of galactic disks, according to recent studies.

  17. Two topics in quantum chromodynamics

    International Nuclear Information System (INIS)

    The two topics are (1) estimates of perturbation theory coefficients for R(e+e- → hadrons), and (2) the virtual-photon structure function, with emphasis on the analytic behavior in its squared mass. 20 refs., 4 figs., 2 tabs

  18. Topics in combinatorial pattern matching

    DEFF Research Database (Denmark)

    Vildhøj, Hjalte Wedel

    This dissertation studies problems in the general theme of combinatorial pattern matching. More specifically, we study the following topics: Longest Common Extensions. We revisit the longest common extension (LCE) problem, that is, preprocess a string T into a compact data structure that supports...

  19. Selected topics in nuclear structure

    International Nuclear Information System (INIS)

    19. winter school in Zakopane was devoted to selected topics in nuclear structure such as: production of spin resonances, heavy ions reactions and their applications to the investigation of high spin states, octupole deformations, excited states and production of new elements etc. The experimental data are ofen compared with theoretical predictions. Report contains 28 papers. (M.F.W.)

  20. Topical nonsteroidal anti-inflammatory drugs for the treatment of pain due to soft tissue injury: diclofenac epolamine topical patch

    OpenAIRE

    Lionberger, David R; Brennan, Michael J.

    2010-01-01

    David R Lionberger1, Michael J Brennan21Southwest Orthopedic Group, Houston, TX, USA; 2Department of Medicine, Bridgeport Hospital, Bridgeport, CT, USAAbstract: The objective of this article is to review published clinical data on diclofenac epolamine topical patch 1.3% (DETP) in the treatment of acute soft tissue injuries, such as strains, sprains, and contusions. Review of published literature on topical nonsteroidal anti-inflammatory drugs (NSAIDs), diclofenac, and DETP in patients with ac...

  1. Monolingual and cross-lingual probabilistic topic models and their applications in information retrieval

    OpenAIRE

    Moens, Marie-Francine; Vulic, Ivan

    2013-01-01

    Probabilistic topic models are a group of unsupervised generative machine learning models that can be effectively trained on large text collections. They model document content as a two-step generation process, i.e., documents are observed as mixtures of latent topics, while topics are probability distributions over vocabulary words. Recently, a significant research effort has been invested into transferring the probabilistic topic modeling concept from monolingual to multilingual settings. N...

  2. Dicty_cDB: FC-AP05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP05 (Link to dictyBase) - - - Contig-U16521-1 FC-AP05Z (Li...nk to Original site) - - FC-AP05Z 532 - - - - Show FC-AP05 Library FC (Link to library) Clone ID FC-AP05 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP05Q.Seq.d/ Representative seq. ID FC-AP...05Z (Link to Original site) Representative DNA sequence >FC-AP05 (FC-AP05Q) /CSM/FC/FC-AP/FC-AP05Q.Seq....GAGA TCCGTCAAAGTTTCAAGCAAAAAAGTTGTTGCCAAGTAAATAAATAATACTTTTTTCCCT AT sequence update 1997. 3.25 Translated Amino Acid sequence ---AP

  3. Dicty_cDB: FC-AP23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP23 (Link to dictyBase) - G03230 DDB0190153 Contig-U16094-1 FC-AP...23P (Link to Original site) FC-AP23F 515 FC-AP23Z 472 FC-AP23P 987 - - Show FC-AP23 Library FC (Link ...ontig Contig-U16094-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...23Q.Seq.d/ Representative seq. ID FC-AP23P (Link to Original site) Representative DNA sequence >FC-AP23 (FC-AP...23Q) /CSM/FC/FC-AP/FC-AP23Q.Seq.d/ CAAATACATAATCTCTTTTTTGAAAATGTCCGAAAATAACGAAATTGAAATGGAACTCC

  4. Dicty_cDB: FC-AP12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP12 (Link to dictyBase) - G01739 DDB0232214 Contig-U15924-1 FC-AP...12P (Link to Original site) FC-AP12F 323 FC-AP12Z 613 FC-AP12P 936 - - Show FC-AP12 Library FC (Link ...ontig Contig-U15924-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...12Q.Seq.d/ Representative seq. ID FC-AP12P (Link to Original site) Representative DNA sequence >FC-AP12 (FC-AP...12Q) /CSM/FC/FC-AP/FC-AP12Q.Seq.d/ CATATTATTTTAAATTTCAGATGTTCCCAAAATAACACATTAATTTGCTTTTTTTGTTG

  5. Efeito da mitomicina C tópica na cicatrização de prega vocal em modelo suíno Topical mitomycin C effect on swine vocal folds healing

    Directory of Open Access Journals (Sweden)

    Paulo Antônio Monteiro Camargo

    2006-10-01

    Full Text Available Várias terapias adjuvantes à cirurgia vêm sendo usadas para modular o processo cicatricial nas pregas vocais, entre elas a Mitomicina tópica (MTC. OBJETIVOS: Avaliar os efeitos da MTC no processo de cicatrização de pregas vocais de suínos 30 dias após exérese de fragmento de mucosa com laser de CO2 mediante a mensuração da deposição de colágeno. FORMA DE ESTUDO: Experimental em suínos. MATERIAIS E MÉTODOS: Dois grupos de 6 suínos cada foram avaliados após exérese de fragmento de mucosa de prega vocal a laser de CO2 (grupo controle sem uso e grupo experimento com uso de MTC tópica. Após 30 dias os animais foram submetidos à eutanásia, sendo coletadas amostras das pregas vocais para análise histológica, a fim de quantificar a deposição de colágeno mediante coloração de Picrosirius Red. RESULTADOS: A média da área do colágeno total das pregas vocais do grupo controle foi de 2648,03 µm2, enquanto a média do colágeno total das pregas vocais do grupo experimento foi de 2200,30 µm2 (p = 0,0043. CONCLUSÃO: A MTC usada topicamente após a exérese de fragmento de mucosa da prega vocal a laser de CO2 em suínos, diminui, significativamente, a deposição do colágeno total.several adjuvant therapies to surgery have been used to modulate the healing process of vocal folds, including topic mitomycin (MTC. AIM: to evaluate the effect of topical MTC in the healing process of vocal folds 30 days after the exeresis of a mucosal fragment with CO2 laser in a swine model (control group without mitomycin and study group with topical MTC, with collagen deposition measurement. STUDY TYPE: prospective experimental in swine. METHODS: two groups of 6 swine each were subjected to exeresis of a mucosal fragment of the vocal fold with CO2 laser. Immediately after the procedure MTC was applied topically for three minutes on the study group. Thirty days later the animals were slaughtered and samples of the vocal folds were collected for

  6. The A.P Møller shares, the US dollar and the price of oil

    DEFF Research Database (Denmark)

    Risager, Ole

    2003-01-01

    1. Brief IntroductionThe two companies D/S Svendborg and D/S 1912 have for almost a century been the parent companiesof the A.P. Møller Group. These companies were founded by Mr. Arnold Peter Møller and his fatherCaptain Peter Mærsk Møller. They were in the beginning entirely into shipping. In 1912......, the fleetconsisted of 6 vessels.Much has happened since the company was founded: The A.P. Møller Group has by any standardsbecome the biggest company in Denmark. Moreover, `Svendborg' and `1912' have recently beenmerged into one company `A.P. Møller - Mærsk A/S'. However, as we shall be concerned with...... theperformance of the company also in the past we will repeatedly make reference to the historic parentcompanies.As `Svendborg' and `1912' grew bigger they expanded into a number of other businesses. It iscommon to split the main businesses of the APM Group into three broad categories:...

  7. AP1000R licensing and deployment in the United States

    International Nuclear Information System (INIS)

    In recent years, both domestic and foreign utilities have turned to the standardized Westinghouse AP1000 plant design in satisfying their near - and long-term - sustainable energy needs. As direct support to these actions, licensing the AP1000 design has played a significant role by providing one of the fundamental bases in clearing regulatory hurdles leading to the start of new plant construction. Within the U.S. alone, Westinghouse AP1000 licensing activities have reached unprecedented milestones with the approvals of both AP1000 Design Certification and Southern Company's combined construction permit and operating license (COL) application directly supporting the construction of two new nuclear plants in Georgia. Further COL application approvals are immediately pending for an additional two AP1000 plants in South Carolina. And, across the U.S. nuclear industry spectrum, there are 10 other COL applications under regulatory review representing some 16 new plants at 10 sites. In total, these actions represent the first wave of new plant licensing under the regulatory approval process since 1978. Fundamental to the Nuclear Regulatory Commission's AP1000 Design Certification is the formal recognition of the AP1000 passive safety design through regulatory acceptance rulemaking. Through recognition and deployment of the AP1000 Design Certification, the utility licensee / operator of this reactor design are now offered an opportunity to use a simplified 'one-step' combined license process, thereby managing substantial back-end construction schedule risk from regulatory and intervention delays. Application of this regulatory philosophy represents both acceptance and encouragement of standardized reactor designs like the AP1000. With the recent AP1000 Design Certification and utility COL acceptances, the fundamental licensing processes of this philosophy have successfully proven the attainment of significant milestones with the next stage licensing actions directed

  8. Antimicrobial Susceptibility and AP-PCR Typing of Acine¬tobac-ter Spp. Strains

    Directory of Open Access Journals (Sweden)

    R Ranjbar

    2007-10-01

    Full Text Available Background: Acinetobacter spp., as important opportunistic pathogens, have been found to be responsible for an increas­ing number of nosocomial infections. This study was undertaken to investigate the antimicrobial susceptibility and molecular typing of Iranian isolates of A. baumannii. Methods: The study was conducted over a period of 19 months in three hospitals in Tehran, Iran. Acinetobacter spp. were isolated from different clinical specimens using standard bacteriological methods. Antimicrobial susceptibility test was performed according to the standard CLSI guideline using 17 antibiotic disks. The AP-PCR fingerprinting was car­ried out using ARB11 primer. The PCR product was run and visualized in 2% agarose gels and stained with ethidium bro­mide. The AP-PCR profiles were grouped depending on the patterns of the amplified bands.Results: Sixty seven strains of Acinetobacter spp. (including 21 A. baumannii and 46 non- A. baumannii were isolated. The sources of these isolates were blood, urine, wound, and respiratory tract.  A. baumannii isolates were further studied. Re­sults showed that all A. baumannii isolates were resistant to at least 11 antibiotics tested. AP-PCR analysis of A. bauman­nii strains resulted in 7 different patterns. The dominant AP-PCR pattern was E (57.1%. Conclusion: Acinetobacter spp. are still important nosocomial pathogens in the region studied and most of isolates were multi-drug resistant. Our results also indicate that the AP-PCR technique represents a rapid and simple means for typing of A. baumannii.

  9. DatAlign - implementation of the new APS survey and alignment database

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) at Argonne National Laboratory is a national 3rd-generation synchrotron-radiation light source research facility located about twenty-five miles southwest of Chicago. The APS accelerator systems and X-ray beamlines are approximately six kilometers in length with more than four thousand precisely aligned components. The APS Survey and Alignment Group (SAG) is responsible for the correct positioning of beamline components for the APS accelerator systems. SAG fiducializes beamline components, aligns components in the accelerator tunnel and in the experiment hall, and maintains all necessary geodetic control networks to achieve required placement tolerances. All these tasks generate large amounts of data that have to be stored and readily accessible to the SAG members. As a result, the utilization of a database system is inevitable. During the 1990s, the SAG depended on Geonet software (1) for its data storage and management needs. Geonet was originally developed under the DOS environment at SLAC in the 1980s as an all-inclusive software package for the accelerator alignment community. After a decade of a reliable service, Geonet unavoidably became obsolete. First, some Geonet utilities, like data collection and data reduction programs, were phased out or replaced by new tools to keep up with advancements in survey and alignment technology. By the year 2002, a decision was made to also replace the database portion of Geonet with a new relational database. The conceptual design of the new APS Survey and Alignment Database (2) was completed in 2002. After a review of commercially available database management systems (DBMSs), Microsoft(regsign) Access 2000 was chosen for the implementation of our database design. The implementation of the new database (DB), under the name 'DatAlign,' commenced the following year.

  10. Hemostatic effect of topical hemocoagulase spray in digestive endoscopy

    Science.gov (United States)

    Wang, Tao; Wang, Dan-Na; Liu, Wen-Tian; Zheng, Zhong-Qing; Chen, Xin; Fang, Wei-Li; Li, Shu; Liang, Li; Wang, Bang-Mao

    2016-01-01

    AIM: To evaluate the hemostatic effect of topical hemocoagulase spray in digestive endoscopy. METHODS: Eighty-nine patients who developed oozing bleeding during endoscopic treatment from September 2014 to October 2014 at Center for Digestive Endoscopy, Tianjin Medical University General Hospital were randomly divided into either a study group (n = 39) or a control group (n = 50). The study group was given topical hemocoagulase spray intraoperatively, while the control group was given traditional 8% norepinephrine spray. Hemostatic efficacy was compared between the two groups. Bleeding site, wound cleanliness and perforation were recorded, and the rates of perforation and late bleeding were compared. RESULTS: Successful hemostasis was achieved in 39 (100%) patients of the study group and in 47 (94.0%) patients of the control group, and there was no significant difference in the rate of successful hemostasis between the two groups. Compared with the control group, after topical hemocoagulase spray in the study group, the surgical field was clearer, the bleeding site was more easily identified, and the wound was cleaner. There was no significant difference in the rate of perforation between the study and control groups (16.7% vs 35.0%, P = 0.477), but the rates of late bleeding (0% vs 15.8%, P = 0.048) and overall complications (P = 0.032) were significantly lower in the study group. CONCLUSION: Topical hemocoagulase spray has a definite hemostatic effect for oozing bleeding in digestive endoscopy, and this method is convenient, safe, and reliable. It is expected to become a new method for endoscopic hemostasis. PMID:27433096

  11. Molecular Characterization of Epidemic Isolates of Vibrio Cholerae O1 by Arbitrarily Primed PCR (AP-PCR

    Directory of Open Access Journals (Sweden)

    M Izadi

    2008-07-01

    Full Text Available Background: Epidemic and endemic cholera is a major public health problem for many countries. Aim of this study was to evaluate AP-PCR for investigation of clonal relatedness among the strains of Vibrio cholerae recovered from an outbreak occurred in different parts of Iran in 2005. Methods: The study was conducted during the cholera outbreak occurred in some of provinces in Iran in summer 2005. Bacterial isolation and identification was carried out according to the standard bacteriological methods. Arbitrarily primed PCR (AP-PCR used to study the genetic relatedness between the V.cholerae isolates. Results: Thirty-nine isolates of V.cholerae O1 were identified. All isolates belonged to serotype Inaba. AP-PCR could differentiate the isolates into five groups. AP-PCR cluster types 1 and 2 were the most prevalent groups, accounting for 36% and 41%, respectively, of V.cholerae isolates. Conclusion: The most of epidemic strains of V.cholerae O1 isolated in the year 2005 could be attributed to two predominant clusters including AP-PCR cluster types 1 and 2 accounting for more than 77% of isolates. In conclusion, a few epidemic clones were responsible for the apparently epidemic occurrence of cholera in provinces studied.

  12. AP600 post blowdown containment transients

    International Nuclear Information System (INIS)

    The containment response in a hypothetical large loss of coolant accident can be divided into two major phases. A blowdown phase which lasts less than a minute and a long term phase, which is the topic of this paper, lasting for the remainder of the transient - on the order of hours. The long term containment pressure is controlled by the rate of heat exchange processes on the outer containment wall and by the driving force of heat and mass sources continuously released from the primary system. In order to estimate the magnitude of the primary energy sources, we have chosen to examine a hypothetical event in which the core remains partially uncovered for an extended period of time following a large loss of coolant accident. (authors). 3 refs., 2 figs

  13. Ethical use of topical corticosteroids

    Directory of Open Access Journals (Sweden)

    Abir Saraswat

    2014-01-01

    Full Text Available Dermatologists rely very heavily on corticosteroids for treating many common dermatoses. Concerns about their incorrect use are widely expressed both in lay public and specialist discourse. From the point of view of medical ethics, issues of autonomy, beneficence and non-maleficence are all raised frequently when we prescribe topical corticosteroids to our patients. We need to be aware of situations when conflicts between these issues arise and have a clear thought process about resolving them. This can only be achieved if we have a thorough understanding of the skin disease being treated coupled with expertise in the use of the varied potencies and available dosage forms of topical corticosteroids. A good understanding of human psychology and effective communication is also needed to use these agents optimally.

  14. Four (Somewhat Nonstandard) Research Topics

    OpenAIRE

    Paun, Gheorghe; Research Group on Natural Computing (Universidad de Sevilla) (Coordinador)

    2014-01-01

    Four research directions are suggested, dealing with the following four main ideas: computing along the axon (up to now, this topic was only preliminarily investi- gated), using pre-computed resources in order to solve computationally hard problems, considering in P systems both objects \\of matter" and \\of anti-matter" (which annihilate each other when meet), and considering the distance (naturally de ned in a membrane structure of a given type) as a support of information.

  15. Preface to Special Topic: Optofluidics

    OpenAIRE

    Liu, Ai-qun

    2010-01-01

    This Special Topic section of Biomicrofluidics is on optofluidics or micro-optofluidic systems (MOFS), a burgeoning technology that aims to manipulate light and fluid at microscale and exploits their interaction to create highly versatile devices and integrated systems. This special issue puts together various contributed articles focusing on optofluidics or MOFS, which help inspire new research ideas and innovation in the microfluidics and nanofluidics community.

  16. Stochastic Analysis and Related Topics

    CERN Document Server

    Ustunel, Ali

    1988-01-01

    The Silvri Workshop was divided into a short summer school and a working conference, producing lectures and research papers on recent developments in stochastic analysis on Wiener space. The topics treated in the lectures relate to the Malliavin calculus, the Skorohod integral and nonlinear functionals of white noise. Most of the research papers are applications of these subjects. This volume addresses researchers and graduate students in stochastic processes and theoretical physics.

  17. Topics in clinical oncology. 15

    International Nuclear Information System (INIS)

    The monograph comprising primarily papers on topical subjects of oncology and cancer research, contains also a selection of papers presented at the 2. Congress of the Czechoslovak Society of Nuclear Medicine and Radiation Hygiene. Seven papers were selected on behalf of their subject related to clinical oncology. All of them were iputted in INIS; five of them deal with the scintiscanning of the skeleton of cancer patients, one with radioimmunodetection of tumors, and one with radionuclide lymphography. (A.K.)

  18. Hot topics from the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Glenzinski, D.; /Fermilab

    2008-01-01

    The Tevatron Run-II began in March 2001. To date, both the CDF and D0 experiments have collected 1 fb{sup -1} of data each. The results obtained from this data set were summarized at this conference in 39 parallel session presentations covering a wide range of topics. The author summarizes the most important of those results here and comments on some of the prospects for the future.

  19. AP600 design certification thermal hydraulics testing and analysis

    International Nuclear Information System (INIS)

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power

  20. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.

    1995-09-01

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  1. Topic prominence in Chinese EFL learners’ interlanguage

    OpenAIRE

    Li, Shaopeng; Yang, Lianrui

    2014-01-01

    The present study aims to investigate the general characteristics of topic-prominent typological interlanguage development of Chinese learners of English in terms of acquiring subject-prominent English structures from a discourse perspec- tive. Topic structures mainly appear in Chinese discourse in the form of topic chains (Wang, 2002; 2004). The research target are the topic chain, which is the main topic-prominent structure in Chinese discourse, and zero anaphora, which is the most common t...

  2. Dicty_cDB: FC-AP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 SJMBIB09 SJM Schistosoma japonicum cDNA, mRNA sequence. 80 8e-20 2 BE859184 |BE859184.1 SsS0499 Suaeda salsa ZAP...FC (Link to library) FC-AP17 (Link to dictyBase) - - - Contig-U16254-1 FC-AP17Z (Li...nk to Original site) - - FC-AP17Z 546 - - - - Show FC-AP17 Library FC (Link to library) Clone ID FC-AP17 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP17Q.Seq.d/ Representative seq. ID FC-AP...17Z (Link to Original site) Representative DNA sequence >FC-AP17 (FC-AP17Q) /CSM/FC/FC-AP/FC-AP17Q.Seq.

  3. Dicty_cDB: FC-AP11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone IMAGE:4920557 5', mRNA sequence. 56 1e-04 2 BF345929 |BF345929.1 602017931F1 NCI_CGAP_Brn67 Homo sap...FC (Link to library) FC-AP11 (Link to dictyBase) - - - Contig-U16101-1 FC-AP11F (Li...nk to Original site) FC-AP11F 394 - - - - - - Show FC-AP11 Library FC (Link to library) Clone ID FC-AP11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP11Q.Seq.d/ Representative seq. ID FC-AP...11F (Link to Original site) Representative DNA sequence >FC-AP11 (FC-AP11Q) /CSM/FC/FC-AP/FC-AP11Q.Seq.

  4. Dicty_cDB: FC-AP18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP18 (Link to dictyBase) - - - Contig-U16455-1 FC-AP18Z (Li...nk to Original site) - - FC-AP18Z 367 - - - - Show FC-AP18 Library FC (Link to library) Clone ID FC-AP18 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP18Q.Seq.d/ Representative seq. ID FC-AP...18Z (Link to Original site) Representative DNA sequence >FC-AP18 (FC-AP18Q) /CSM/FC/FC-AP/FC-AP18Q.Seq....XELTPSRPMCVESFNEYPP LGRFAVRDMGQTVAVGVIKSTVKKAPGKAGDKKGAXAPSKKK*innis**iafynnfkkk kkkkk Translated Amino Acid

  5. Dicty_cDB: FC-AP16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP16 (Link to dictyBase) - - - Contig-U16269-1 FC-AP16Z (Li...nk to Original site) - - FC-AP16Z 552 - - - - Show FC-AP16 Library FC (Link to library) Clone ID FC-AP16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP16Q.Seq.d/ Representative seq. ID FC-AP...16Z (Link to Original site) Representative DNA sequence >FC-AP16 (FC-AP16Q) /CSM/FC/FC-AP/FC-AP16Q.Seq....7. 3.28 Translated Amino Acid sequence ---RNRRYKVRKGPLVVVSGKTTVSQALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWT KSAFEQLD

  6. Dicty_cDB: FC-AP15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP15 (Link to dictyBase) - - - Contig-U15444-1 FC-AP15Z (Li...nk to Original site) - - FC-AP15Z 594 - - - - Show FC-AP15 Library FC (Link to library) Clone ID FC-AP15 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP15Q.Seq.d/ Representative seq. ID FC-AP...15Z (Link to Original site) Representative DNA sequence >FC-AP15 (FC-AP15Q) /CSM/FC/FC-AP/FC-AP15Q.Seq....AAAAAAAAAAAAAAAAAA AAAA sequence update 1997. 3.25 Translated Amino Acid sequence ---RLLKIAEARAATPKGQAAPKAEK

  7. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  8. Testing of the AP600 automatic depressurization system

    International Nuclear Information System (INIS)

    The Automatic Depressurization System (ADS) of the Westinghouse AP600 reactor will be used to provide controlled depressurization of the reactor coolant system (RCS). This will, in turn allow the initiation and long term operation of gravity driven cooling flow in the RCS. ADS tests were conducted at the VAPORE test facility in Casaccia, Italy through a Technical Cooperation Agreement between Westinghouse, ENEA, SOPREN/ANSALDO, and ENEL to produce data for the development and verification of computer codes to simulate the system. The test program also provided insights about the operation of valves supplied from various vendors that could be used in the AP600 ADS. The data gathered from the tests showed the ability of the ADS design to fulfill its function over the range of conditions expected in the AP600. The tests also demonstrated the abilities of gate and globe valves from several vendors to initiate and terminate an ADS blowdown as could be required in the AP600

  9. A hot-spare injector for the APS linac

    International Nuclear Information System (INIS)

    Last year a second-generation SSRL-type thermionic cathode rf gun was installed in the Advanced Photon Source (APS) linac. This gun (referred to as ''gun2'') has been successfully commissioned and now serves as the main injector for the APS linac, essentially replacing the Koontz-type DC gun. To help ensure injector availability, particularly with the advent of top-up mode operation at the APS, a second thermionic-cathode rf gun will be installed in the APS linac to act as a hot-spare beam source. The hot-spare installation includes several unique design features, including a deep-orbit Panofsky-style alpha magnet. Details of the hot-spare beamline design and projected performance are presented, along with some plans for future performance upgrades

  10. Renal effects of atriopeptin (AP) II in conscious SHR

    International Nuclear Information System (INIS)

    Diuresis and natriuresis following APs has been suggested to depend upon increased renal blood flow (RBF). In a previous study, they found that APII infusions in conscious SHR decrease RBF. In this study, they report effects of APII on glomerular filtration rate (GFR) and renal excretory function in conscious SHR. Male SHR were equipped with arterial and venous catheters. Furthermore, a special catheter was implanted into the bladder to allow continuous urine sampling from conscious, freely moving rats. Animals were allowed at least 4 days to recover. In one group of SHR, APII (N=7) or saline (N=7) was infused to quantitate excretion of water, Na+, and K+. Two other groups of SHR (N=8 each) were infused with 51Cr-EDTA and 125I-PAH. GFR and renal plasma flow (ERPF) were calculated from urine and a mid-time plasma sample during APII or saline infusion. Following changes in infusion rates, urine from the first 5 min was discarded, after which a 10-min collection was made. APII (0.5-4 μg/kg/min) increased water, Na+ and K+ output maximally during 2 μg/kg/min. ERPF decreased from 10.7 +/- 1.1 ml/min to 7.9 +/- 0.5 ml/min. GFR did not change significantly. Filtration fraction increased from 24 +/- 1% to 33 +/- 2%. Fractional water excretion increased from 0.8 +/- 0.2% to 2.5 +/- 0.7%. Saline infusions did not affect renal function. The results indicate that in conscious SHR, APII causes diuresis and natriuresis which does not depend upon increased GFR, but, rather, upon a primary tubular effect

  11. Simple Lie groups without the approximation property

    DEFF Research Database (Denmark)

    Haagerup, Uffe; de Laat, Tim

    2013-01-01

    For a locally compact group G, let A(G) denote its Fourier algebra, and let M0A(G) denote the space of completely bounded Fourier multipliers on G. The group G is said to have the Approximation Property (AP) if the constant function 1 can be approximated by a net in A(G) in the weak-∗ topology...... on the space M0A(G). Recently, Lafforgue and de la Salle proved that SL(3,R) does not have the AP, implying the first example of an exact discrete group without it, namely, SL(3,Z). In this paper we prove that Sp(2,R) does not have the AP. It follows that all connected simple Lie groups with finite center...

  12. Analysis and characterization of double shell tank 241-AP-108

    International Nuclear Information System (INIS)

    This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank

  13. AP1000 design adaptation to European Markets and EUR compliance

    International Nuclear Information System (INIS)

    The AP1000 plant is an 1100-MWe pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. One of the key approaches in the AP1000 design is to use passive features to mitigate design basis accidents. In addition to redundancy, these features incorporate diversity based on PRA insights. The AP1000 design has incorporated a standardization approach, which together with the level of safety achieved by the passive safety features, results in a plant design that can be applied to different geographical regions with varying regulatory standards and utility expectations without major changes. Westinghouse has cooperated for almost 2 decades with European utilities to ensure adaptation of the AP1000 design to European market. The AP1000 50 Hz standard design (also referred to as European Passive Standard) is the resulting adaptation of the AP1000 design to European market needs and requirements, addressing both customer input from the EPP program and regulatory needs identified in the UK GDA process. This standard 50 Hz design retains the overall AP1000 design (safe, simple, standard), the use of proven components and its cost, safety and operability advantages, while it incorporates some changes to adapt to the European environment. In this paper, the key changes incorporated into the AP1000 50 Hz design are discussed, including: -) Adaptation of the electrical systems and Turbine adaptation from 60 Hz to 50 Hz, including approach to IEC vs IEEE compliance; -) Modifications to defense in depth (US class D, European Class 2) and other systems to simplify European licensing and address customer requirements; -) Option for adoption of KSB RUV type Main Reactor Coolant Pumps; -) Limited design adaptations in the areas of instrumentation-control and ventilation and filtration to adapt to European requirements and simplify the licensing process

  14. AP1000 radiation monitoring system design and engineering solution

    International Nuclear Information System (INIS)

    It presents the design concept and solution, including system integration architecture, communication network design and monitoring software of Radiation Monitoring System in Sanmen and Haiyang AP1000 nuclear power plant. The design of AP1000 radiation monitoring system has been simplified comparing to general Pressurized Water Reactor. Radiation monitoring network is composed of the radiation monitoring computer system (CRPS-1000) and four kinds of radiation monitors through standard interface. The data of radiation monitoring system are monitored and managed by CRPS-1000. (authors)

  15. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-05-18

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  16. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov

    2005-06-01

    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  17. Analysis of an accident type sbloca in reactor contention AP1000 with 8.0 Gothic code; Analisis de un accidente tipo Sbloca en la contencion del reactor AP1000 con el codigo Gothic 8.0

    Energy Technology Data Exchange (ETDEWEB)

    Goni, Z.; Jimenez Varas, G.; Fernandez, K.; Queral, C.; Montero, J.

    2016-08-01

    The analysis is based on the simulation of a Small Break Loss-of-Coolant-Accident in the AP1000 nuclear reactor using a Gothic 8.0 tri dimensional model created in the Science and Technology Group of Nuclear Fision Advanced Systems of the UPM. The SBLOCA has been simulated with TRACE 5.0 code. The main purpose of this work is the study of the thermo-hydraulic behaviour of the AP1000 containment during a SBLOCA. The transients simulated reveal close results to the realistic behaviour in case of an accident with similar characteristics. The pressure and temperature evolution enables the identification of the accident phases from the RCS point of view. Compared to the licensing calculations included in the AP1000 Safety Analysis, it has been proved that the average pressure and temperature evolution is similar, yet lower than the licensing calculations. However, the temperature and inventory distribution are significantly heterogeneous. (Author)

  18. 45-Day safety screening report for grab samples from Tank 241-AP-107

    International Nuclear Information System (INIS)

    Three samples; 107-AP-1C, 107-AP-2c and 107-AP-3C; were received at 222-S Laboratory for analysis of DSC, TGA and visual appearance. Four additional samples; 107-AP-1D, 107-AP-2D, 107-AP-3D and 107-AP-6; were received for visual appearance only. No results exceeded the safety screen notification criteria. This report compiles the analytical results. Tank 241-AP-107 is a double-shell tank which is not on any of the four Watch Lists

  19. Topics in black hole evaporation

    International Nuclear Information System (INIS)

    Two major aspects of particle creation by gravitational fields of black holes are studied: the neutrino emission from rotating black holes; and interactions between scalar particles emitted by a black hole. Neutrino emission is investigated under three topics: The asymmetry of the angular dependence of neutrino emission from rotating black holes; the production of a local matter excess by rotating black holes in a baryon symmetric universe; and cosmological magnetic field generation by neutrinos from evaporating black holes. Finally the author studies the effects of interactions on the black hole evaporation process

  20. Topics in strangeness nuclear physics

    International Nuclear Information System (INIS)

    Strangeness nuclear physics bears a broad impact on contemporary physics since it lies at the intersection of nuclear and elementary particle physics, having, moreover, significant implications to the astrophysics of compact objects. This set of extensive lectures presents a balanced theoretical and experimental introduction to, and survey of, the field, addressing topics such as the production and spectroscopy of strange nuclear systems, modern approaches to the hyperon-nucleon interaction, and weak decays of hypernuclei. With new experiments underway, this burgeoning research field is well served by this tutorial primer and review for both newcomers and seasoned researchers alike. (orig.)

  1. Topics in commutative ring theory

    CERN Document Server

    Watkins, John J

    2009-01-01

    Topics in Commutative Ring Theory is a textbook for advanced undergraduate students as well as graduate students and mathematicians seeking an accessible introduction to this fascinating area of abstract algebra. Commutative ring theory arose more than a century ago to address questions in geometry and number theory. A commutative ring is a set-such as the integers, complex numbers, or polynomials with real coefficients--with two operations, addition and multiplication. Starting from this simple definition, John Watkins guides readers from basic concepts to Noetherian rings-one of

  2. Modern topics in electron scattering

    CERN Document Server

    Frois, Bernard

    1991-01-01

    This book summarizes the considerable progress recently achieved in the understanding of nucleon and nuclear structure by using high energy electrons as a probe. A collection of papers discusses in detail the new frontiers of this field. Experimental and theoretical articles cover topics such as the structure of the nucleon, nucleon distributions, many-body correlations, non-nucleonic degrees of freedom and few-body systems. This book is an up-to-date introduction to the research planned with continuous beam electron accelerators.

  3. Algorithms and theoretical topics on selected combinatorial optimization problems

    OpenAIRE

    Kaveh, Arman

    2010-01-01

    We study the Quadratic Assignment Problem (QAP), Three Dimensional Assignment Problem (3AP) and Quadratic Three Dimensional Assignment Problem (Q3AP), which combines aspects of both QAP and 3AP. The three problems are known to be NP-hard. We propose new algorithms for obtaining near optimal solutions of QAP and 3AP and present computational results. Our algorithms obtain improved solutions in some benchmark instances of QAP and 3AP. We also discuss theoretical results on 3AP and Q3AP such as ...

  4. Safety of warfarin therapy during cataract surgery under topical anesthesia

    Directory of Open Access Journals (Sweden)

    Newton Kara-Junior

    2015-06-01

    Full Text Available ABSTRACT Purpose: To analyze the safety of warfarin therapy during cataract surgery under topical anesthesia. Methods: This was a prospective nonrandomized comparative study of 60 eyes of 60 patients treated with or without concurrent oral warfarin anticoagulant therapy, referred for cataract surgery under topical anesthesia. The sample included a treatment (n=30 and a control (n=30 group. Results: There were no records of intraoperative or postoperative intracameral bleeding complications in both the groups. At 1-month postoperative follow-up, 90.0% of patients presented spectacle-corrected visual acuity of at least 20/40. Conclusion: Cataract surgery by phacoemulsification with topical anesthesia can be successfully conducted without discontinuing warfarin.

  5. SU-E-T-14: A Feasibility Study of Using Modified AP Proton Beam for Post-Operative Pancreatic Cancer Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Ding, X; Witztum, A; Kenton, O; Younan, F; Dormer, J; Kremmel, E; Lin, H; Liu, H; Tang, S; Both, S; Kassaee, A; Avery, S [UniversityPennsylvania, Philadelphia, PA (United States)

    2014-06-01

    Purpose: Due to the unpredictability of bowel gas movement, the PA beam direction is always favored for robust proton therapy in post-operative pancreatic cancer treatment. We investigate the feasibility of replacing PA beam with a modified AP beam to take the bowel gas uncertainty into account. Methods: Nine post-operative pancreatic cancer patients treated with proton therapy (5040cGy, 28 fractions) in our institution were randomly selected. The original plan uses PA and lateral direction passive-scattering proton beams. Beam weighting is about 1:1. All patients received weekly verification CTs to assess the daily variations(total 17 verification CTs). The PA direction beam was replaced by two other groups of AP direction beam. Group AP: takes 3.5% range uncertainty into account. Group APmod: compensates the bowel gas uncertainty by expanding the proximal margin to 2cm more. The 2cm margin was acquired from the average bowel diameter in from 100 adult abdominal CT scans near pancreatic region (+/- 5cm superiorly and inferiorly). Dose Volume Histograms(DVHs) of the verification CTs were acquired for robustness study. Results: Without the lateral beam, Group APmod is as robust as Group PA. In Group AP, more than 10% of iCTV D98/D95 were reduced by 4–8%. LT kidney and Liver dose robustness are not affected by the AP/PA beam direction. There is 10% of chance that RT kidney and cord will be hit by AP proton beam due to the bowel gas. Compared to Group PA, APmod plan reduced the dose to kidneys and cord max significantly, while there is no statistical significant increase in bowel mean dose. Conclusion: APmod proton beam for the target coverage could be as robust as the PA direction without sacrificing too much of bowel dose. When the AP direction beam has to be selected, a 2cm proximal margin should be considered.

  6. Topical erythromycin-zinc acetate complex lotion versus topical erythromycin gel in treatment of mild to moderate acne vulgaris

    Directory of Open Access Journals (Sweden)

    Hayder R. Al-Hamamy

    2014-10-01

    Full Text Available Introduction: Topical antibiotics are the main step in the treatment of mild to moderate acne vulgaris. Erythromycin is one of the effective topical therapies for this disease. Zinc sulfate 5% solution was reported to be effective in treatment of acne vulgaris and rosacea. Aim: To compare the effectiveness and side effects of topical erythromycin in combination with zinc and erythromycin alone in treatment of mild to moderate acne vulgaris. Material and Methods: This single, blind, therapeutic, comparative study was done in the Department of Dermatology – Baghdad Teaching Hospital, Baghdad, Iraq; from May 2012 – August 2013.Scoring of acne was carried out and the patients were examined every two weeks for 10 weeks of treatment. One month after stopping drugs, patients were evaluated for drug complications and disease recurrence. Eighty patients fulfilling enrollment criteria were included in this study. Patients were divided into two groups: Group A (40 patients treated twice daily with topical erythromycin-zinc complex lotion and Group B (40 patients treated twice daily with topical 2% erythromycin gel. Results: Both topical erythromycin-zinc lotion and erythromycin gel were statistically an effective therapy starting after 6 weeks treatment and up to 4 weeks after stopping treatment. Erythromycin-zinc lotion was more effective and act earlier than erythromycin gel starting from 4 weeks of therapy till the end of treatment (after 10 week and even after 4 weeks after stopping the treatment (p value <0.0001. Conclusions: Erythromycin-zinc complex lotion was an effective and well tolerated topical therapy for mild to moderate inflammatory acne vulgaris and was more effective than erythromycin gel alone.

  7. Approaching acquisition path analysis formally. A comparison between AP and nonAP states

    International Nuclear Information System (INIS)

    In the past, the IAEA has planned its activities mainly based on the presence of nuclear material. However, resources should be spent where they are needed most. Therefore, a new risk model was developed to change the inspection system to a comprehensive, objective‑driven approach where the State is considered as a whole, the so called State‑level concept (SLC). Acquisition path analysis (APA) is a key element of the State‑level concept. By considering the State’s nuclear profile, the APA generates a list of acquisition paths ranked by their attractiveness for the State. Currently, this process is mainly based on expert judgment. However, the IAEA’s requirements state that APA must be objective, reproducible, transparent, standardized, documented and as a result non‑discriminatory. A formal approach fulfilling the requirements was set up by the authors in the past [1]. This methodology is based on a three step approach. The process starts in the first step with the parametrization of the network. In the second step, the network is analyzed in order find all acquisition paths for a State. Finally, game theory is used in the third step to model the decisions made by the IAEA and the State. In this paper, an advanced methodology will be presented. Improvements were made in the interface definition between the three stages. Also, the general network model was updated and the automatic visualization of acquisition paths was accomplished. Furthermore, a prototype implementation will be shown. The advanced methodology was applied to two test non‑nuclear weapon States under comprehensive safeguards agreements with the IAEA. Both States hold complex fuel cycles with only small technical differences. However,only one State is supposed to have the additional protocol (AP) in force. The example will show how the presence of the AP influences the detection probabilities of illegal behavior. As a consequence, these examples also indicate where to best focus

  8. Misuse of topical corticosteroids: A clinical study of adverse effects

    Directory of Open Access Journals (Sweden)

    Vivek Kumar Dey

    2014-01-01

    Full Text Available Background: Misuse of topical corticosteroids is a widespread phenomenon among young people in India, especially women. The practice is associated with significant adverse effects and poor awareness of these effects among the general public. Aim: This study was conducted to examine the misuse and adverse effects of topical corticosteroids among the people in Bastar region in Chhattisgarh state of India. Materials and Methods: Data collected from patients presenting with at least one of the adverse effects of topical corticosteroids as the chief complaint, from November 2010 to October 2011. Results: Out of the 6723 new patients, 379 (5.63% had presented with misuse and adverse effects of topical corticosteroids, of whom 78.89% were females. More than 65% of the patients were in the age group 10-29 years. The main reason for using the topical corticosteroids was to lighten skin colour and treat melasma and suntan. Acne (37.99% and telangiectasia (18.99% were the most common adverse effects noted. Conclusions: Misuse of topical corticosteroids has a huge impact on dermatological practice, leading to a significant proportion of visits to the dermatologist. This hydra-headed problem needs multi-dimensional interventions, involving educational, legal and managerial approaches with cooperation from different sectors of society.

  9. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands.

    Science.gov (United States)

    Abe, Yukiko S; Sasaki, Shigeki

    2016-02-15

    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site. PMID:26777298

  10. "Two Cultures" Topics for General Studies Science Courses.

    Science.gov (United States)

    Larson, James H.

    1982-01-01

    Theses proposed in C. P. Snow's book "The Two Cultures," including uncommunicative scientific and literary groups, gap between rich and poor, overpopulation, and nuclear war remain viable topics. Discusses the scientific and literary cultural gap and what can be done in general studies science courses to ameliorate the condition. (Author/JN)

  11. Groups, rings, modules

    CERN Document Server

    Auslander, Maurice

    2014-01-01

    This classic monograph is geared toward advanced undergraduates and graduate students. The treatment presupposes some familiarity with sets, groups, rings, and vector spaces. The four-part approach begins with examinations of sets and maps, monoids and groups, categories, and rings. The second part explores unique factorization domains, general module theory, semisimple rings and modules, and Artinian rings. Part three's topics include localization and tensor products, principal ideal domains, and applications of fundamental theorem. The fourth and final part covers algebraic field extensions

  12. Human-competitive automatic topic indexing

    CERN Document Server

    Medelyan, Olena

    2009-01-01

    Topic indexing is the task of identifying the main topics covered by a document. These are useful for many purposes: as subject headings in libraries, as keywords in academic publications and as tags on the web. Knowing a document’s topics helps people judge its relevance quickly. However, assigning topics manually is labor intensive. This thesis shows how to generate them automatically in a way that competes with human performance. Three kinds of indexing are investigated: term assignment, a task commonly performed by librarians, who select topics from a controlled vocabulary; tagging, a popular activity of web users, who choose topics freely; and a new method of keyphrase extraction, where topics are equated to Wikipedia article names. A general two-stage algorithm is introduced that first selects candidate topics and then ranks them by significance based on their properties. These properties draw on statistical, semantic, domain-specific and encyclopedic knowledge. They are combined using a machine learn...

  13. An alternatively spliced mRNA from the AP-2 gene encodes a negative regulator of transcriptional activation by AP-2.

    OpenAIRE

    Buettner, R; Kannan, P; Imhof, A.; Bauer, R.; Yim, S O; Glockshuber, R; Van Dyke, M W; Tainsky, M A

    1993-01-01

    AP-2 is a retinoic acid-inducible and developmentally regulated activator of transcription. We have cloned an alternative AP-2 transcript (AP-2B) from the human teratocarcinoma cell line PA-1, which encodes a protein differing in the C terminus from the previously isolated AP-2 protein (AP-2A). This protein contains the activation domain of AP-2 and part of the DNA binding domain but lacks the dimerization domain which is necessary for DNA binding. Analysis of overlapping genomic clones spann...

  14. AP@home: The Artificial Pancreas Is Now at Home.

    Science.gov (United States)

    Heinemann, Lutz; Benesch, Carsten; DeVries, J Hans

    2016-07-01

    In the past years the development of an artificial pancreas (AP) has made great progress and many activities are ongoing in this area of research. The major step forward made in the last years was moving the evaluation of AP systems from highly controlled experimental conditions to daily life conditions at the home of patients with diabetes; this was also the aim of the European Union-funded AP@home project. Over a time period of 5 years a series of clinical studies were performed that culminated in 2 "final studies" during which an AP system was used by patients in their home environment for 2 or 3 months without supervision by a physician, living their normal lives. Two different versions of the AP system developed within this project were evaluated. A significant improvement in glycated hemoglobin was observed during closed-loop conditions despite the fact that during the control period the patients used the best currently available therapeutic option. In addition, a "single-port AP system" was developed within the project that combines continuous glucose monitoring and insulin infusion at a single tissue site. By using such a combined device the patients not only have to carry one less device around, the number of access points through the skin is also reduced from 2 to 1. In summary, close cooperation of 12 European partners, both academic centers and industry, enabled the development and evaluation of AP systems under daily life conditions. The next step is to develop these into products in cooperation with commercial partners. PMID:26888971

  15. SnAP-eX Reagents for the Synthesis of Exocyclic 3-Amino- and 3-Alkoxypyrrolidines and Piperidines from Aldehydes.

    Science.gov (United States)

    Luescher, Michael U; Bode, Jeffrey W

    2016-06-01

    SnAP-eX (tin amine protocol, exocyclic heteroatoms) reagents allow the single-step transformation of aldehydes and ketones into 2,3-disubstituted pyrrolidines and piperidines containing exocyclic amine or alkoxy groups. These saturated N-heterocycles are of importance in modern drug discovery approaches and are prepared in moderate yields using an operationally simple protocol that is compatible with a range of functional groups and heterocyclic aldehydes. PMID:27192447

  16. Topical report review status: Volume 10

    International Nuclear Information System (INIS)

    This report provides industry with procedures for submitting topical reports, guidance on how the U.S. Nuclear Regulatory Commission (NRC) processes and responds to topical report submittals, and an accounting, with review schedules, of all topical reports currently accepted for review by the NRC. This report is published annually

  17. Effects of Preexamination Disclosure of Essay Topics.

    Science.gov (United States)

    Powers, Donald E.; Fowles, Mary E.

    1998-01-01

    To determine the effects on test performance and test validity of releasing essay topics before an examination, 300 prospective graduate students wrote essays on a released and an unreleased topic. Analyses did not reveal any statistically significant effect of topic release. (SLD)

  18. Topics in Banach space theory

    CERN Document Server

    Albiac, Fernando

    2016-01-01

    This text provides the reader with the necessary technical tools and background to reach the frontiers of research without the introduction of too many extraneous concepts. Detailed and accessible proofs are included, as are a variety of exercises and problems. The two new chapters in this second edition are devoted to two topics of much current interest amongst functional analysts: Greedy approximation with respect to bases in Banach spaces and nonlinear geometry of Banach spaces. This new material is intended to present these two directions of research for their intrinsic importance within Banach space theory, and to motivate graduate students interested in learning more about them. This textbook assumes only a basic knowledge of functional analysis, giving the reader a self-contained overview of the ideas and techniques in the development of modern Banach space theory. Special emphasis is placed on the study of the classical Lebesgue spaces Lp (and their sequence space analogues) and spaces of continuous f...

  19. Conclusion from the fifth topic

    International Nuclear Information System (INIS)

    The topic ''mechanics and alteration kinetics of glasses'' is a crucial point for the understanding of the long-term behaviour of nuclear glasses. Kinetic models used in simulation are based on the works made by Grambow who imputes the control of the alteration kinetics of borosilicate glasses to the desorption of the ortho-silica acid produced at the reactive interface. The ensuing kinetics law requires the existence of an equilibrium of the silica at the interface glass/gel and the existence of a linear concentration gradient dissolved in the interstitial gel solution. The role of the gel needs further studies to be well understood. The difficulty lies in the fact that the composition and the structure of the gel varies with time, space (anisotropy) and with the conditions of alteration (temperature, pH, flowrate...). (A.C.)

  20. Synergetics introduction and advanced topics

    CERN Document Server

    Haken, Hermann

    2004-01-01

    This book is an often-requested reprint of two classic texts by H. Haken: "Synergetics. An Introduction" and "Advanced Synergetics". Synergetics, an interdisciplinary research program initiated by H. Haken in 1969, deals with the systematic and methodological approach to the rapidly growing field of complexity. Going well beyond qualitative analogies between complex systems in fields as diverse as physics, chemistry, biology, sociology and economics, Synergetics uses tools from theoretical physics and mathematics to construct an unifying framework within which quantitative descriptions of complex, self-organizing systems can be made. This may well explain the timelessness of H. Haken's original texts on this topic, which are now recognized as landmarks in the field of complex systems. They provide both the beginning graduate student and the seasoned researcher with solid knowledge of the basic concepts and mathematical tools. Moreover, they admirably convey the spirit of the pioneering work by the founder of ...

  1. KEY TOPICS IN SPORTS MEDICINE

    Directory of Open Access Journals (Sweden)

    Amir Ali Narvani

    2006-12-01

    Full Text Available Key Topics in Sports Medicine is a single quick reference source for sports and exercise medicine. It presents the essential information from across relevant topic areas, and includes both the core and emerging issues in this rapidly developing field. It covers: 1 Sports injuries, rehabilitation and injury prevention, 2 Exercise physiology, fitness testing and training, 3 Drugs in sport, 4 Exercise and health promotion, 5 Sport and exercise for special and clinical populations, 6 The psychology of performance and injury. PURPOSE The Key Topics format provides extensive, concise information in an accessible, easy-to-follow manner. AUDIENCE The book is targeted the students and specialists in sports medicine and rehabilitation, athletic training, physiotherapy and orthopaedic surgery. The editors are authorities in their respective fields and this handbook depends on their extensive experience and knowledge accumulated over the years. FEATURES The book contains the information for clinical guidance, rapid access to concise details and facts. It is composed of 99 topics which present the information in an order that is considered logical and progressive as in most texts. Chapter headings are: 1. Functional Anatomy, 2. Training Principles / Development of Strength and Power, 3. Biomechanical Principles, 4. Biomechanical Analysis, 5. Physiology of Training, 6. Monitoring of Training Progress, 7. Nutrition, 8. Hot and Cold Climates, 9. Altitude, 10. Sport and Travelling, 11. Principles of Sport Injury Diagnosis, 12. Principles of Sport and Soft Tissue Management, 13. Principles of Physical Therapy and Rehabilitation, 14. Principles of Sport Injury Prevention, 15. Sports Psychology, 16. Team Sports, 17. Psychological Aspects of Injury in Sport, 18. Injury Repair Process, 19. Basic Biomechanics of Tissue Injury, 20. Plain Film Radiography in Sport, 21. Nuclear Medicine, 22. Diagnostic Ultrasound, 23. MRI Scan, 24. Other Imaging, 5. Head Injury, 26. Eye

  2. Tank 241-AP-105, cores 208, 209 and 210, analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final laboratory report for Tank 241-AP-105. Push mode core segments were removed from Risers 24 and 28 between July 2, 1997, and July 14, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-AP-105 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997) and Tank Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT), differential scanning calorimetry (DSC) analysis, or total organic carbon (TOC) analysis exceeded the notification limits as stated in TSAP and DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report. Appearance and Sample Handling Two cores, each consisting of four segments, were expected from Tank 241-AP-105. Three cores were sampled, and complete cores were not obtained. TSAP states core samples should be transported to the laboratory within three calendar days from the time each segment is removed from the tank. This requirement was not met for all cores. Attachment 1 illustrates subsamples generated in the laboratory for analysis and identifies their sources. This reference also relates tank farm identification numbers to their corresponding 222-S Laboratory sample numbers

  3. [Potential uses of AP-DRG to describe the health care profile in hospital units].

    Science.gov (United States)

    Noronha, Marina Ferreira de; Portela, Margareth Crisóstomo; Lebrão, Maria Lúcia

    2004-01-01

    The All Patient Diagnosis Related Groups (AP-DRG) provide a classification system for general hospital inpatients, aggregating hospitalizations based on resource use and clinical criteria. The different versions of the AP-DRG have been applied to inpatient care management and reimbursement. This paper aimed to describe the classification and explore the potential for generating information on inpatient care management based on data from the Ribeirão Preto region (Sao Paulo State, Brazil) in 1997, including public, private, and charity hospitals. We compared average length of stay related to DRGs in the Ribeirão Preto region and the United States. Using the relative cost weights of the AP-DRGs constructed for New York State, we verified the profile of inpatient care provided by 30 hospitals in the Ribeirão Preto region, and reimbursement for hospital care provided to patients referred from other municipalities and covered by the Unified National Health System (SUS). Our findings indicate the applicability of the classification to inform the decision-making process on inpatient care regionalization and organization in levels of complexity, as well as for improvement of inpatient care monitoring and reimbursement. PMID:15608938

  4. Current Topics in Epilepsy Surgery.

    Science.gov (United States)

    Usui, Naotaka

    2016-05-15

    This article reviews the current topics in the field of epilepsy surgery. Each type of epilepsy is associated with a different set of questions and goals. In mesial temporal lobe epilepsy (MTLE) with hippocampal sclerosis (HS), postoperative seizure outcome is satisfactory. A recent meta-analysis revealed superior seizure outcome after anterior temporal lobectomy compared with selective amygdalohippocampectomy; in terms of cognitive outcome; however, amygdalohippocampectomy may be beneficial. In temporal lobe epilepsy with normal magnetic resonance imaging (MRI), postoperative seizure outcome is not as favorable as it is in MTLE with HS; further improvement of seizure outcome in these cases is necessary. Focal cortical dysplasia is the most common substrate in intractable neocortical epilepsy, especially in children, as well as in MRI-invisible neocortical epilepsy. Postoperative seizure-free outcome is approximately 60-70%; further diagnostic and therapeutic improvement is required. Regarding diagnostic methodology, an important topic currently under discussion is wideband electroencephalogram (EEG) analysis. Although high-frequency oscillations and ictal direct current shifts are considered important markers of epileptogenic zones, the clinical significance of these findings should be clarified further. Regarding alternatives to surgery, neuromodulation therapy can be an option for patients who are not amenable to resective surgery. In addition to vagus nerve stimulation, intracranial stimulation such as responsive neurostimulation or anterior thalamic stimulation is reported to have a modest seizure suppression effect. Postoperative management such as rehabilitation and antiepileptic drug (AED) management is important. It has been reported that postoperative rehabilitation improves postoperative employment status. Pre- and post-operative comprehensive care is mandatory for postoperative improvement of quality of life. PMID:26984452

  5. Study of 99mTc-Ap4A in detection of experimental atherosclerotic plaques

    International Nuclear Information System (INIS)

    , blood samples, atherosclerotic plaques and normal aortic walls were removed. Lesions to blood (target/blood, T/B), lesions to normal (target/non-target, T/NT) ratios were calculated. 74 MBq 99mTc-Ap4A was injected into marginal ear veins of 5 atherosclerotic and 5 normal NZW rabbits. Simultaneously in vivo gamma camera images were recorded for more than 4 hours. In another group, 30 minutes after 99mTc-Ap4A administrated, the animals were sacrificed and their aortas were removed. The aortas were placed on the face of gamma camera (3 mm diameter pin-hole collimater) and image acquisition was performed. Results: The radiochemistry purity of 99mTc-Ap4A was 85% to 91%. Biodistribution study revealed 99mTc-Ap4A cleared from blood rapidly. 30 minutes after 99mTc-Ap4A administrated, T/B ratio was 3.17±1.27, T/NT ratio was 5.23±1.87. On the radioautograms shadows of atherosclerotic plaques were clearly visible. The aortas with atherosclerotic plaques also can be seen on ex vivo images. Atherosclerotic abdominal aortas and lesions were clearly visible on in vivo images 15 minutes to 3 hours after 99mTc-Ap4A administrated. Conclusion: 99mTc-labeled Ap4A has potential for rapid noninvasive detection of plaque formation. The results were similar to the report of Elmaleh. As an atherosclerotic imaging agent 99mTc-Ap4A got better images than we previously reported radioiodine labeled SP-4

  6. AP1000 - the new standard for nuclear power

    International Nuclear Information System (INIS)

    Full text of publication follows: The AP1000 is the only Generation III+ reactor to receive Final Design Approval (FDA) from the Nuclear Regulatory Commission, and is expected to receive its Design Certification by the end of the year. Building on the proven features of current generation nuclear plants, the AP1000 combines experience with innovation into a design that surpasses current standards of safety and reliability. Use of passive safety features results in a simpler and more compact design that enhances safety, simplifies O and M requirements, and reduces capital and operating costs. At 1117 Mwe, the AP1000 is well suited for almost any grid system and will be fully competitive with combined-cycle gas and comparable fossil fuel plants. The AP1000 is ready to help launch a renaissance in new nuclear plant construction throughout the world. Maturity of Design: In excess of 1300 man-years and $400 million in development funding have been expended on the AP1000. It has undergone extensive, part scale testing at the system, sub-system and component level, in addition to a series of part scale integrated tests. The AP1000 is the most analyzed of the next generation reactors. Simplicity of Design/Economics: The AP1000 uses simplified and innovative passive safety systems to an unprecedented extent. Simplified passive safety systems provide reliable operation, reduced capital costs, and enhanced plant safety with large plant operating margins. The AP1000 features improved reliability through simplicity rather than addition of redundant safety trains. This simpler design is easier and less costly to operate and maintain than larger, more complex plants, while less equipment and smaller buildings translate into lower capital costs and shorter construction durations. After construction, economic benefit will be found in reduced operating and maintenance costs, largely due to reduced operating and maintenance staffing requirements. Construction aspects

  7. Learning through delivery, Westinghouse AP1000 plant construction

    International Nuclear Information System (INIS)

    The AP1000 plant, which is a 1100 MWe class pressurized water reactor with passive safety features, is designed around a conventional 2 loop, 2 steam generator primary system configuration with 2 hot legs, 4 reactor coolant pumps directly mounted in the steam generator lower head and 4 cold legs. A particular feature of AP1000 is its modular construction to minimize the time and cost of construction. Modular construction allows activities to be run in parallel, it allows more activities to be performed in a controlled factory instead of in the field, and it provides a better level of quality. The AP1000 plant design includes 106 structural modules and 52 mechanical modules. Structural modules include all penetrations for piping, cable trays, HVAC duct runs, and all reinforcement for pipe, equipment hangers, and supports. Structural modules are shipped in sub-modules to support transportation by rail or truck or barge. Mechanical modules contain equipment such as pumps, tanks, heat exchangers, air-handling units, and filters along with interconnecting pipes, valves, instruments, wiring and support services. Modular construction requires strong coordination between engineering, supply chain and construction. A total of 8 AP1000 units are currently under construction in China and in the United States. The lessons learned and best practices of each new AP1000 construction are systematically incorporated into the standard design. (A.C.)

  8. Antagonism of the presumed presynaptic action of L-AP4 on GABAergic transmission in the ventrobasal thalamus by the novel mGluR antagonist MPPG.

    Science.gov (United States)

    Salt, T E; Turner, J P

    1996-02-01

    The metabotropic glutamate receptor (mGluR) agonists CCG-I and L-AP4, acting at Group II and Group III mGluRs respectively, can reduce GABAergic synaptic inhibition on single neurones in the rat thalamus in vivo via a presumed presynaptic mechanism. The actions of L-AP4 were antagonized by (+/-)-alpha-methyl-4-phosphonophenylglycine (MPPG), whereas CCG-I was significantly less affected. Thus MPPG may be a useful tool for detecting physiological roles for Group III mGluRs. PMID:8734494

  9. Past, Present, and Future of AP Chemistry: A Brief History of Course and Exam Alignment Efforts

    Science.gov (United States)

    Magrogan, Serena

    2014-01-01

    As part of the Advanced Placement (AP) Program's commitment to continually enhance alignment with current best practices in college-level learning, the AP Program is currently evaluating and redesigning courses and exams, one of which launched during the 2013-2014 academic school year: AP chemistry. The history of the AP chemistry course and…

  10. AP Report to the Nation: A Closer Look at the Nation and Florida

    Science.gov (United States)

    Sawtell, Ellen A.; Gillie, Jacqueline M.; Smith, Patricia Z.

    2012-01-01

    In February 2012, the College Board published The 8th Annual AP Report to the Nation. This session provides a deeper dive into key information for the United States with an emphasis on Florida, and participants hear how one school in Florida utilizes AP Potential™ to help build their AP Program. Participants also learn about AP participation and…

  11. Multilingual Topic Models for Unaligned Text

    CERN Document Server

    Boyd-Graber, Jordan

    2012-01-01

    We develop the multilingual topic model for unaligned text (MuTo), a probabilistic model of text that is designed to analyze corpora composed of documents in two languages. From these documents, MuTo uses stochastic EM to simultaneously discover both a matching between the languages and multilingual latent topics. We demonstrate that MuTo is able to find shared topics on real-world multilingual corpora, successfully pairing related documents across languages. MuTo provides a new framework for creating multilingual topic models without needing carefully curated parallel corpora and allows applications built using the topic model formalism to be applied to a much wider class of corpora.

  12. Safety and Health Topics: Asbestos

    Science.gov (United States)

    ... to Z Index Contact Us FAQs What's New Asbestos This page requires that javascript be enabled for ... Hazards and Toxic Substances Hazardous Waste What is asbestos? Asbestos is the name given to a group ...

  13. Vibration analysis of primary air pump JE01 AP003

    International Nuclear Information System (INIS)

    JE01 AP003 primary coolant pump is one of the main components in the safe operation of the reactor so that needs to be done early detection of damage types and levels of its constituent components. The main components of the pump that is often damaged bearing. The purpose of this paper is to know the symptoms of bearing damage and the level of damage based on vibration analysis. One indication of the bearing has been damaged, that is the vibration or temperature rise in the bearing. One way to detect early symptoms of damage to the pump is to use the vibration response peak Based on the analysis of the measurement results cited the obtained results that the primary coolant pump JE01 AP003 has been damage to a free end looseness bearing with moderate levels of damage. Need JE01 AP003 bearing replacement even though the damage is not severe. (author)

  14. Containment integrity analysis for the Westinghouse Advanced AP600

    International Nuclear Information System (INIS)

    Since 1987, Westinghouse has been performing containment cooling analyses in support of the advanced AP600 plant design. This analysis effort was intended to verify the feasibility of the passive containment cooling system (PCCS) features of the AP600 design, which is being jointly developed by Westinghouse, Burns and Roe Company, and Avondale Industries. To support this goal, the response of the AP600 containment has been analyzed for a large-break loss-of-coolant-accident (LOCA) and for a large steam line break (SLB). These cases were chosen based on the characteristic mass and energy releases each scenario would impose on the containment, with LOCA releases taxing the long-term heat-removal aspects while the SLB release typically defines the limiting short-term response. The transient results indicate that the PCCS design is feasible and capable of removing sufficient heat to limit containment pressure to within acceptable limits

  15. Experience with the EPICS PV Gateway at the APS

    CERN Document Server

    Evans, Kenneth

    2005-01-01

    The EPICS PV Gateway has become a stable, high-performance application that provides access to process variables while minimizing the impact on critical IOCs and implementing additional access security. The additional access security typically prevents write access but is highly configurable. The Advanced Photon Source (APS) currently uses 40 Gateways running on 11 machines to provide access to the machine network from the offices and for the individual experimental teams. These include reverse Gateways that allow administration of all 40 APS Gateways from a single MEDM screen, even though the Gateways are running on separate networks. This administration includes starting, stopping, making and viewing reports, and viewing and editing access security files. There is one Gateway that provides process variable renaming. This paper provides an overview of the Gateways at the APS and describes the procedures that have been set up to use and administer them.

  16. PKA-activated ApAF–ApC/EBP heterodimer is a key downstream effector of ApCREB and is necessary and sufficient for the consolidation of long-term facilitation

    OpenAIRE

    LEE, Jin-A; Lee, Sue-Hyun; Lee, Changhoon; Chang, Deok-Jin; Lee, Yong; Kim, Hyoung; Cheang, Ye-Hwang; Ko, Hyoung-Gon; Lee, Yong-Seok; Jun, Heejung; Bartsch, Dusan; Kandel, Eric R.; Kaang, Bong-Kiun

    2006-01-01

    Long-term memory requires transcriptional regulation by a combination of positive and negative transcription factors. Aplysia activating factor (ApAF) is known to be a positive transcription factor that forms heterodimers with ApC/EBP and ApCREB2. How these heterodimers are regulated and how they participate in the consolidation of long-term facilitation (LTF) has not, however, been characterized. We found that the functional activation of ApAF required phosphorylation of ApAF by PKA on Ser-2...

  17. Identifying Topics in Microblogs Using Wikipedia.

    Science.gov (United States)

    Yıldırım, Ahmet; Üsküdarlı, Suzan; Özgür, Arzucan

    2016-01-01

    Twitter is an extremely high volume platform for user generated contributions regarding any topic. The wealth of content created at real-time in massive quantities calls for automated approaches to identify the topics of the contributions. Such topics can be utilized in numerous ways, such as public opinion mining, marketing, entertainment, and disaster management. Towards this end, approaches to relate single or partial posts to knowledge base items have been proposed. However, in microblogging systems like Twitter, topics emerge from the culmination of a large number of contributions. Therefore, identifying topics based on collections of posts, where individual posts contribute to some aspect of the greater topic is necessary. Models, such as Latent Dirichlet Allocation (LDA), propose algorithms for relating collections of posts to sets of keywords that represent underlying topics. In these approaches, figuring out what the specific topic(s) the keyword sets represent remains as a separate task. Another issue in topic detection is the scope, which is often limited to specific domain, such as health. This work proposes an approach for identifying domain-independent specific topics related to sets of posts. In this approach, individual posts are processed and then aggregated to identify key tokens, which are then mapped to specific topics. Wikipedia article titles are selected to represent topics, since they are up to date, user-generated, sophisticated articles that span topics of human interest. This paper describes the proposed approach, a prototype implementation, and a case study based on data gathered during the heavily contributed periods corresponding to the four US election debates in 2012. The manually evaluated results (0.96 precision) and other observations from the study are discussed in detail. PMID:26991442

  18. Identifying Topics in Microblogs Using Wikipedia.

    Directory of Open Access Journals (Sweden)

    Ahmet Yıldırım

    Full Text Available Twitter is an extremely high volume platform for user generated contributions regarding any topic. The wealth of content created at real-time in massive quantities calls for automated approaches to identify the topics of the contributions. Such topics can be utilized in numerous ways, such as public opinion mining, marketing, entertainment, and disaster management. Towards this end, approaches to relate single or partial posts to knowledge base items have been proposed. However, in microblogging systems like Twitter, topics emerge from the culmination of a large number of contributions. Therefore, identifying topics based on collections of posts, where individual posts contribute to some aspect of the greater topic is necessary. Models, such as Latent Dirichlet Allocation (LDA, propose algorithms for relating collections of posts to sets of keywords that represent underlying topics. In these approaches, figuring out what the specific topic(s the keyword sets represent remains as a separate task. Another issue in topic detection is the scope, which is often limited to specific domain, such as health. This work proposes an approach for identifying domain-independent specific topics related to sets of posts. In this approach, individual posts are processed and then aggregated to identify key tokens, which are then mapped to specific topics. Wikipedia article titles are selected to represent topics, since they are up to date, user-generated, sophisticated articles that span topics of human interest. This paper describes the proposed approach, a prototype implementation, and a case study based on data gathered during the heavily contributed periods corresponding to the four US election debates in 2012. The manually evaluated results (0.96 precision and other observations from the study are discussed in detail.

  19. Identifying Topics in Microblogs Using Wikipedia

    Science.gov (United States)

    Yıldırım, Ahmet; Üsküdarlı, Suzan; Özgür, Arzucan

    2016-01-01

    Twitter is an extremely high volume platform for user generated contributions regarding any topic. The wealth of content created at real-time in massive quantities calls for automated approaches to identify the topics of the contributions. Such topics can be utilized in numerous ways, such as public opinion mining, marketing, entertainment, and disaster management. Towards this end, approaches to relate single or partial posts to knowledge base items have been proposed. However, in microblogging systems like Twitter, topics emerge from the culmination of a large number of contributions. Therefore, identifying topics based on collections of posts, where individual posts contribute to some aspect of the greater topic is necessary. Models, such as Latent Dirichlet Allocation (LDA), propose algorithms for relating collections of posts to sets of keywords that represent underlying topics. In these approaches, figuring out what the specific topic(s) the keyword sets represent remains as a separate task. Another issue in topic detection is the scope, which is often limited to specific domain, such as health. This work proposes an approach for identifying domain-independent specific topics related to sets of posts. In this approach, individual posts are processed and then aggregated to identify key tokens, which are then mapped to specific topics. Wikipedia article titles are selected to represent topics, since they are up to date, user-generated, sophisticated articles that span topics of human interest. This paper describes the proposed approach, a prototype implementation, and a case study based on data gathered during the heavily contributed periods corresponding to the four US election debates in 2012. The manually evaluated results (0.96 precision) and other observations from the study are discussed in detail. PMID:26991442

  20. Autosomal recessive spastic tetraplegia caused by AP4M1 and AP4B1 gene mutation: expansion of the facial and neuroimaging features.

    Science.gov (United States)

    Tüysüz, Beyhan; Bilguvar, Kaya; Koçer, Naci; Yalçınkaya, Cengiz; Çağlayan, Okay; Gül, Ece; Sahin, Sezgin; Çomu, Sinan; Günel, Murat

    2014-07-01

    Adaptor protein complex-4 (AP4) is a component of intracellular transportation of proteins, which is thought to have a unique role in neurons. Recently, mutations affecting all four subunits of AP4 (AP4M1, AP4E1, AP4S1, and AP4B1) have been found to cause similar autosomal recessive phenotype consisting of tetraplegic cerebral palsy and intellectual disability. The aim of this study was analyzing AP4 genes in three new families with this phenotype, and discussing their clinical findings with an emphasis on neuroimaging and facial features. Using homozygosity mapping followed by whole-exome sequencing, we identified two novel homozygous mutations in AP4M1 and a homozygous deletion in AP4B1 in three pairs of siblings. Spastic tetraplegia, microcephaly, severe intellectual disability, limited speech, and stereotypic laughter were common findings in our patients. All patients also had similar facial features consisting of coarse and hypotonic face, bitemporal narrowing, bulbous nose with broad nasal ridge, and short philtrum which were not described in patients with AP4M1 and AP4B1 mutations previously. The patients presented here and previously with AP4M1, AP4B1, and AP4E1 mutations shared brain abnormalities including asymmetrical ventriculomegaly, thin splenium of the corpus callosum, and reduced white matter volume. The patients also had hippocampal globoid formation and thin hippocampus. In conclusion, disorders due to mutations in AP4 complex have similar neurological, facial, and cranial imaging findings. Thus, these four genes encoding AP4 subunits should be screened in patients with autosomal recessive spastic tetraplegic cerebral palsy, severe intellectual disability, and stereotypic laughter, especially with the described facial and cranial MRI features. PMID:24700674

  1. Transcriptional Regulation of the AP-2α Promoter by BTEB-1 and AP-2rep, a Novel wt-1/egr-Related Zinc Finger Repressor

    OpenAIRE

    Imhof, Axel; Schuierer, Marion; Werner, Oliver; Moser, Markus; Roth, Christina; Bauer, Reinhard; BUETTNER, REINHARD

    1999-01-01

    AP-2 transcription factors have been suggested to exert key regulatory functions in vertebrate embryonic development, in tumorigenicity of various cancer cell types, and in controlling cell cycle and apoptotic effector genes. In this study, we investigated transcriptional regulation of the AP-2α gene promoter mediated by an autoregulatory element (referred to as A32) with a core consensus AP-2 binding site at position −336 relative to the mRNA initiation site. AP-2 and multiple different nucl...

  2. Some ethylene biosynthesis and AP2/ERF genes reveal a specific pattern of expression during somatic embryogenesis in Hevea brasiliensis

    Directory of Open Access Journals (Sweden)

    Piyatrakul Piyanuch

    2012-12-01

    Full Text Available Abstract Background Ethylene production and signalling play an important role in somatic embryogenesis, especially for species that are recalcitrant in in vitro culture. The AP2/ERF superfamily has been identified and classified in Hevea brasiliensis. This superfamily includes the ERFs involved in response to ethylene. The relative transcript abundance of ethylene biosynthesis genes and of AP2/ERF genes was analysed during somatic embryogenesis for callus lines with different regeneration potential, in order to identify genes regulated during that process. Results The analysis of relative transcript abundance was carried out by real-time RT-PCR for 142 genes. The transcripts of ERFs from group I, VII and VIII were abundant at all stages of the somatic embryogenesis process. Forty genetic expression markers for callus regeneration capacity were identified. Fourteen markers were found for proliferating calli and 35 markers for calli at the end of the embryogenesis induction phase. Sixteen markers discriminated between normal and abnormal embryos and, lastly, there were 36 markers of conversion into plantlets. A phylogenetic analysis comparing the sequences of the AP2 domains of Hevea and Arabidopsis genes enabled us to predict the function of 13 expression marker genes. Conclusions This first characterization of the AP2/ERF superfamily in Hevea revealed dramatic regulation of the expression of AP2/ERF genes during the somatic embryogenesis process. The gene expression markers of proliferating callus capacity to regenerate plants by somatic embryogenesis should make it possible to predict callus lines suitable to be used for multiplication. Further functional characterization of these markers opens up prospects for discovering specific AP2/ERF functions in the Hevea species for which somatic embryogenesis is difficult.

  3. Preliminary study on operational transient analysis for AP1000

    International Nuclear Information System (INIS)

    Typical operational transients have been analyzed with RELAP5 code for AP1000 NPP, in which the reactor power control system was simulated, including Reactor Control System (RECS), Rapid Power Reduction (RPR), Steam Dump Control System (SDCS), Feedwater Control System (FWCS), Pressurizer Pressure Control System (PPCS) and Pressurizer Level Control System (PLCS). It indicates that the plant control system is effective to bring the plant into a safe steady state without actuation of reactor protection system under the representative operational transient, only depends upon the plant control system adjustment. Analysis results show that the design requirement will be met for AP1000 operational transient. (authors)

  4. Analysis of the planning and scheduling functionality in APS systems

    Science.gov (United States)

    Steger-Jensen, Kenn; Hvolby, Hans-Henrik

    2001-10-01

    The paper discusses the basic functionality of planning and scheduling in Advanced Planning and Scheduling systems (APS). Three basic planning options - unconstrained planning, constrained planning and optimization are analyzed by use of theory and examples based on test of an APS system. Even though the planning functionality are radically improved compared to MRP and MRP II, the balance between the objectives are found to be too rigid. This conclusion is based on a number of examples, comparing the outcome of different objectives such as constraints based planning versus optimized planning.

  5. SN 2002ap, the hypernova of class Ic

    OpenAIRE

    Pandey, S. B.; Sahu, D. K.; Anupama, G. C.; Bhattacharya, D; Sagar, Ram

    2003-01-01

    The supernova SN 2002ap was discovered in the outer regions of the nearby spiral M74 on January 29.4 UT. Early photometric and spectroscopic observations indicate the supernova belongs to the class of Ic hypernova. Late time (After JD 2452500) light curve decay slopes are similar to that of the hypernovae SN 1997ef and SN 1998bw. We present here the $BVRI$ photometric light curves and colour evolutions of SN 2002ap to investigate the late time nature of the light curve.

  6. Status of the Advanced Photon Source (APS) linear accelerator

    International Nuclear Information System (INIS)

    A 2856-MHz S-band, electron-positron linear accelerator (linac) has been constructed at the Advanced Photon Source (APS). It is the source of particles and the injector for the other APS accelerators, and linac commissioning is well underway. The linac is operated 24 hours per day to support linac beam studies and rf conditioning, as well as positron accumulator ring and synchrotron commissioning studies. The design goal for accelerated positron current is 8-mA, and has been met. Maximum positron energy to date is 420-MeV, approaching the design goal of 450-MeV. The linac design and its performance are discussed

  7. Miniature Autonomous Star Tracker Based on CMOS APS

    OpenAIRE

    Ying, Dong; Zheng, You; Fei, Xing; Qin, Chou

    2006-01-01

    An APS (Active Pixel Sensor) based autonomous star tracker (AAST) has been proposed for small satellite and microsatellite attitude determination. A prototype of AAST has been developed. It has low mass of 1kg, low power of 3W, high rate up to 5Hz, and acquisition success rate of higher than 99.9%. The improvements in dimensions and performances are realized with the replacement of the CCD (Charge Coupled Device) by the APS. The optical design of the prototype is based on PSF (Point Spread Fu...

  8. Main technical topics in 1999

    International Nuclear Information System (INIS)

    This Safety Authority annual report strives to present current organizational provisions and future trends in nuclear safety supervision in France and to describe the most outstanding occurrences during the past year. A first part presents nine documents concerning the main topics of 1999: aging of nuclear installations, the Offsite Emergency Plans (PPI), the impact of nuclear activities on man and the environment, the criticality hazards, EDF in 1999, the EPR project, the Andra in 1999, the transport incidents, the nuclear safety in eastern Europe. The second part presents the missions and actions of the Nuclear Installations Safety in the domains of the liabilities, the organization of the nuclear safety control, the regulations of the INB, the public information, the international relations, the crisis management, the radioactive materials transportation, the radioactive wastes. The equipment, the radiation protection and the exploitation of the pressurized water reactors are also treated just as the experimental reactors, the fuel cycle installations and the the nuclear installations dismantling. (A.L.B.)

  9. Two Topics In String Theory

    CERN Document Server

    Cheung, Y E

    2000-01-01

    We study two topics in string theory: consistency of D- branes and their intersections in topologically nontrivial background, and Noncommutative Geometry and “Little String Theories.” When a D-brane wraps around a cycle of a curved manifold, the nontrivial topology of its normal bundle can induce chiral asymmetry in its worldvolume theory. We obtain the general form of the resulting anomalies for D-branes and their intersections. They are not cancelled among themselves, and the standard inflow mechanism does not apply at first sight because of their apparent lack of factorizability and the apparent vanishing of the corresponding inflow. We show, however, that after taking into consideration the effects of the twisting of the normal bundles, the anomalies can be transformed into factorized forms and precisely cancelled by finite inflow from the Chern-Simons actions for the D-branes as long as the latter are well defined. Such twisting of the normal bundle is shown to induce Ramond-Ramond c...

  10. Topics in Number Theory Conference

    CERN Document Server

    Andrews, George; Ono, Ken

    1999-01-01

    From July 31 through August 3,1997, the Pennsylvania State University hosted the Topics in Number Theory Conference. The conference was organized by Ken Ono and myself. By writing the preface, I am afforded the opportunity to express my gratitude to Ken for beng the inspiring and driving force behind the whole conference. Without his energy, enthusiasm and skill the entire event would never have occurred. We are extremely grateful to the sponsors of the conference: The National Sci­ ence Foundation, The Penn State Conference Center and the Penn State Depart­ ment of Mathematics. The object in this conference was to provide a variety of presentations giving a current picture of recent, significant work in number theory. There were eight plenary lectures: H. Darmon (McGill University), "Non-vanishing of L-functions and their derivatives modulo p. " A. Granville (University of Georgia), "Mean values of multiplicative functions. " C. Pomerance (University of Georgia), "Recent results in primality testing. " C. ...

  11. Decision Point 1 Topical Report

    Energy Technology Data Exchange (ETDEWEB)

    Yablonsky, Al; Barsoumian, Shant; Legere, David

    2013-05-01

    This Topical Report addresses accomplishments achieved during Phase 2a of the SkyMine® Carbon Mineralization Pilot Project. The primary objectives of this project are to design, construct, and operate a system to capture CO2 from a slipstream of flue gas from a commercial coal-fired cement kiln, convert that CO2 to products having commercial value (i.e., beneficial use), show the economic viability of the CO2 capture and conversion process, and thereby advance the technology to the point of readiness for commercial scale demonstration and proliferation. The overall process is carbon negative, resulting in mineralization of CO2 that would otherwise be released into the atmosphere. The project will also substantiate market opportunities for the technology by sales of chemicals into existing markets, and identify opportunities to improve technology performance and reduce costs at the commercial scale. The project is being conducted in two phases. The primary objectives of Phase 1 were to elaborate proven SkyMine® process chemistry to commercial pilot-scale operation and complete the preliminary design for the pilot plant to be built and operated in Phase 2, complete a NEPA evaluation, and develop a comprehensive carbon life cycle analysis. The objective of the current Phase (2a) is to complete the detailed design of the pilot plant to be built in Phase 2b.

  12. [Current topics in pediatric nutrition].

    Science.gov (United States)

    Morali, A; Vidailhet, M

    2002-07-01

    As main current topics in pediatric nutrition we have considered the results of the continuing research on the long term consequences of fetal malnutrition and intra-uterine growth retardation with the concept of metabolic imprinting leading to chronic disease in adulthood, the progresses of knowledge in the fields of iron metabolism and regulatory mechanisms of satiety, hunger and energetic balance, a better determination of recommended docosahexanoic and arachidonic acids intake in the first months of life for premature and term infants, and the studies on probiotics and prebiotics utilization for preventive and curative purposes. The concerns about vitamin D insufficiency in France have markedly decreased with the generalization ten years ago of cholecalciferol supplementation of infant formula, and more recently the authorization of dairy products supplementation. On the contrary the problem of iron deficiency in young children remains, as well as two major nutritional concerns: the very low percentage of breast-fed infants and the dramatic increase of childhood obesity which affects presently 14% of 10 year old children versus 5% in 1980. PMID:12162162

  13. Oxygen-regulated stimulons of Salmonella typhimurium identified by Mu d(Ap lac) operon fusions.

    OpenAIRE

    Aliabadi, Z; Warren, F; Mya, S; Foster, J. W.

    1986-01-01

    Using the technique of Mu d1(Ap lac)-directed lacZ operon fusions, several oxygen-regulated genetic loci were identified in Salmonella typhimurium. Thirteen anaerobically inducible and six aerobically inducible operon fusions were identified. Based on control by the oxrA and oxrB regulatory loci, the anti-lacZ fusions were grouped into three classes: class I loci were regulated by both oxr loci, class II genes were regulated by oxrA only, and class III loci were not affected by either regulat...

  14. Recent Advances In Topical Therapy In Dermatology

    Directory of Open Access Journals (Sweden)

    Mohan Thappa Devinder

    2003-01-01

    Full Text Available With changing times various newer topical agents are introduced in the field of dermatology. Tacrolimus and pimecrolimus are immunisuppressants, which are effective topically and are tried in the management of atopic dermatitis as well as other disorders including allergic contact dermatitis, atrophic lichen planus, pyoderma gangrenosum. Imiquimod, an immune response modifier, is presently in use for genital warts but has potentials as anti- tumour agent and in various other dermatological conditions when used topically. Tazarotene is a newer addition to the list of topical reginoids, which is effective in psoriasis and has better effect in combination with calcipotriene, phototherapy and topical costicosteroids. Tazarotene and adapelene are also effective in inflammatory acne. Calcipotriol, a vitamin D analogue has been introduced as a topical agent in the treatment of psoriasis. Steroid components are also developed recently which will be devoid of the side effects but having adequate anti-inflammatory effect. Topical photodynamic therapy has also a wide range of use in dermatology. Newer topical agents including cidofovir, capsaicin, topical sensitizers, topical antifungal agents for onychomycosis are also of use in clinical practice. Other promising developments include skin substitutes and growth factors for wound care.

  15. Genome-Wide Analysis of the AP2/ERF Gene Family in Physic Nut and Overexpression of the JcERF011 Gene in Rice Increased Its Sensitivity to Salinity Stress

    Science.gov (United States)

    Tang, Yuehui; Qin, Shanshan; Guo, Yali; Chen, Yanbo; Wu, Pingzhi; Chen, Yaping; Li, Meiru; Jiang, Huawu; Wu, Guojiang

    2016-01-01

    The AP2/ERF transcription factors play crucial roles in plant growth, development and responses to biotic and abiotic stresses. A total of 119 AP2/ERF genes (JcAP2/ERFs) have been identified in the physic nut genome; they include 16 AP2, 4 RAV, 1 Soloist, and 98 ERF genes. Phylogenetic analysis indicated that physic nut AP2 genes could be divided into 3 subgroups, while ERF genes could be classed into 11 groups or 43 subgroups. The AP2/ERF genes are non-randomly distributed across the 11 linkage groups of the physic nut genome and retain many duplicates which arose from ancient duplication events. The expression patterns of several JcAP2/ERF duplicates in the physic nut showed differences among four tissues (root, stem, leaf, and seed), and 38 JcAP2/ERF genes responded to at least one abiotic stressor (drought, salinity, phosphate starvation, and nitrogen starvation) in leaves and/or roots according to analysis of digital gene expression tag data. The expression of JcERF011 was downregulated by salinity stress in physic nut roots. Overexpression of the JcERF011 gene in rice plants increased its sensitivity to salinity stress. The increased expression levels of several salt tolerance-related genes were impaired in the JcERF011-overexpressing plants under salinity stress. PMID:26943337

  16. Topics in Probabilistic Judgment Aggregation

    Science.gov (United States)

    Wang, Guanchun

    2011-01-01

    This dissertation is a compilation of several studies that are united by their relevance to probabilistic judgment aggregation. In the face of complex and uncertain events, panels of judges are frequently consulted to provide probabilistic forecasts, and aggregation of such estimates in groups often yield better results than could have been made…

  17. Topical papers on raw materials

    International Nuclear Information System (INIS)

    In the papers of this working group, the availability of uranium and the long-term supply situation for this raw material are discussed. A problem closely connected with uranium supply are the commercial contracts and their particularities. The points of view of the reporting countries of Great Britain, South Africa, Switzerland, Australia, Japan, and Korea are made clear

  18. Selected topics of fluid mechanics

    Science.gov (United States)

    Kindsvater, Carl E.

    1958-01-01

    the Euler, Froude, Reynolds, Weber, and Cauchy numbers are defined as essential tools for interpreting and using experimental data. The derivations of the energy and momentum equations are treated in detail. One-dimensional equations for steady nonuniform flow are developed, and the restrictions applicable to the equations are emphasized. Conditions of uniform and gradually varied flow are discussed, and the origin of the Chezy equation is examined in relation to both the energy and the momentum equations. The inadequacy of all uniform-flow equations as a means of describing gradually varied flow is explained. Thus, one of the definitive problems of river hydraulics is analyzed in the light of present knowledge. This report is the outgrowth of a series of short schools conducted during the spring and summer of 1953 for engineers of the Surface Water Branch, Water Resources Division, U. S. Geological Survey. The topics considered are essentially the same as the topics selected for inclusion in the schools. However, in order that they might serve better as a guide and outline for informal study, the arrangement of the writer's original lecture notes has been considerably altered. The purpose of the report, like the purpose of the schools which inspired it, is to build a simple but strong framework of the fundamentals of fluid mechanics. It is believed that this framework is capable of supporting a detailed analysis of most of the practical problems met by the engineers of the Geological Survey. It is hoped that the least accomplishment of this work will be to inspire the reader with the confidence and desire to read more of the recent and current technical literature of modern fluid mechanics.

  19. Topics in topological band systems

    Science.gov (United States)

    Huang, Zhoushen

    The discovery of integer quantum Hall effect and its subsequent theoretical formulation heralded a new paradigm of thinking in condensed matter physics, which has by now blossomed into the rapidly growing field of topological phases. In this work we investigate several mutually related topics in the framework of topological band theory. In Chapter 2, we study solutions to boundary states on a lattice and see how they are related to the bulk topology. To elicit a real space manifestation of the non-trivial topology, the presence of a physical edge is not strictly necessary. We study two other possibilities, namely the entanglement spectrum associated with an imaginary spatial boundary, and the localization centers of Wannier functions, in Chapters 3,4, and 5. Topological classification through discrete indices is so far possible only for systems described by pure quantum states---in the existing scheme, quantization is lost for systems in mixed states. In Chapter 6, we present a program through which discrete topological indices can be defined for topological band systems at finite temperature, based on Uhlmann's parallel transport of density matrices. The potential of topologocal insulators in realistic applications lies in the existence of Dirac nodes on its surface spectrum. Dirac physics, however, is not exclusive to TI surfaces. In a recently discovered class of materials known as Weyl semimetals, energy nodes which emit linear dispersions also occur in the bulk material. In Chapter 7, we study the possibility of resonance states induced by localized impurities near the nodal energy in Weyl semimetals, which will help us in understanding the stability of density-of-state suppression at the energy nodes. Finally, in Chapter 8, we apply the topological characterization developed for noninteracting particles to a class of interacting spin models in 3D, which are generalizations of Kitaev's honeycomb model, and identify several exotic quantum phases such as spin

  20. "-ing" Project: Encouraging Cohesion in Small Groups

    Science.gov (United States)

    McBride, M. Chad

    2006-01-01

    Group cohesiveness is a topic addressed in most small group communication texts and courses and is often defined as the degree of attraction members feel towards one another, the degree of loyalty within a group, or the "groupness" felt among members. Further, groups which are cohesive tend to be happier and more productive. When working on…

  1. Intermediate-break LOCA analyses for the AP600 design

    International Nuclear Information System (INIS)

    A postulated double-ended guillotine break of a direct-vessel-injection line in an AP600 plant has been analyzed. This event is characterized as an intermediate break loss-of-coolant accident (IBLOCA). Most of the insights regarding the response of the AP600 safety systems to the postulated accident are derived from calculations performed with the TRAC-PFl/MOD2 code. However, complementary insights derived from a scaled experiment conducted in the ROSA facility, as well as insights based upon calculations by other codes, are also presented. The key processes occurring in an AP600 during a IBLOCA are primary coolant system depressurization, inventory depletion, inventory replacement via emergency core coolant injection, continuous core cooling, and long-term decay heat rejection to the atmosphere. Based upon the calculated and experimental results, the AP600 will not experience a core heat up and will reach a safe shutdown state using only safety-class equipment. Only the early part of the long-term cooling period initiated by In-containment Refueling Water Storage Tank injection was evaluated Thus, the observation that the core is continuously cooled should be verified for the latter phase of the long-term cooling period, the interval when sump injection and containment cooling processes are important

  2. Tank 241-AP-106 tank characterization plan: Revision 1

    International Nuclear Information System (INIS)

    Tank 241-AP-106 (AP-106) is a candidate feed tank which is expected to be processed at the 242-A Evaporator. Three issues related to the overall concern of the evaporator must be evaluated: compatibility of the candidate waste with respect to feed tank, slurry tank, and evaporator requirements; safety parameters of the candidate waste tank to avoid a facility condition which is outside the safety boundaries; and compliance of the waste as dictated by regulations from various government and environmental agencies. The characterization efforts of this Tank Characterization Plan are focused on the resolution of the issues above. To evaluate the potential for waste incompatibility with the feed tank, slurry tank, and evaporator, as well as relevant safety issues, analyses will be performed on the grab samples obtained from tank AP-106. These analyses are discussed in Section 4.0. Once the characterization of tank AP-106 has been performed, the waste compatibility and safety assessment shall be conducted. This effort is discussed elsewhere

  3. Time Trials--An AP Physics Challenge Lab

    Science.gov (United States)

    Jones, David

    2009-01-01

    I have come to the conclusion that for high school physics classroom and laboratory experiences, simpler is better! In this paper I describe a very simple and effective lab experience that my AP students have thoroughly enjoyed year after year. I call this lab exercise "Time Trials." The experiment is simple in design and it is a lot of fun for…

  4. The AP Lever for Boosting Access, Success, and Equity

    Science.gov (United States)

    Roegman, Rachel; Hatch, Thomas

    2016-01-01

    Four New Jersey school districts worked together to increase student achievement by applying a number of strategies focused on getting traditionally underrepresented students to take more AP courses. The districts are members of the New Jersey Network of Superintendents (NJNS), comprising 15 superintendents who work together to develop systemwide…

  5. The New AP Chemistry Exam: Its Rationale, Content, and Scoring

    Science.gov (United States)

    Price, Paul D.; Kugel, Roger W.

    2014-01-01

    The 2013-2014 academic year marks the rollout of the redesigned advanced placement (AP) chemistry course and exam. There have been many questions as to why the course was redesigned and how the new examination will differ from its legacy version. In this article we give a brief overview of the legacy course and examine why a redesign occurred in…

  6. Early Telegraphic News Dispatches: The Forerunner of the AP.

    Science.gov (United States)

    Schwarzlose, Richard A.

    The origin of the Associated Press (AP) lies in the early cooperative news gathering efforts of the editors of several New York newspapers. As early as May 1846, these editors were "pooling" their energies in response to newly developed modes of communication--the wire and wireless telegraph and the trans-oceanic steamship mail services. The…

  7. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses

    Science.gov (United States)

    Prilliman, Stephen G.

    2014-01-01

    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  8. A process definition repository based on step AP 213

    Energy Technology Data Exchange (ETDEWEB)

    Butler, J.W.

    1997-09-01

    Over the years, in the context of numerically controlled machined part manufacturing, the loss, misinterpretation, and redundancy of re-inputting manufacturing instructions and data during the evolution of a product design into the finished product has been a resource depleting and costly endeavor. It is the intent of this project to utilize the emerging standards from the International Standards Organization, ISO 10303 Standard for the Exchange of Product Model Data, commonly referred to as STEP, to store and retrieve process planning information for a set of production work instructions. The project focuses on the utilization of the 1995 version of the Draft International Standard ISO/DIS 10303-213:1995 (E) Application protocol: Numerical control process plans for machined parts (AP213). This project illustrates the methodologies used to build an object-oriented Process Definition Repository (PDR), describes both the benefits and shortcomings experienced in implementing AP213, and recommends enhancements to AP213 for process planning information. The deliverable will be a Part 21 data file, based on the application-interpreted model for AP213 and integrated with product design data.

  9. 76 FR 82079 - AP1000 Design Certification Amendment

    Science.gov (United States)

    2011-12-30

    ... Vessel (RPV) Support System. SFP Decay Heat Analysis and Associated Design Changes. Spent Fuel Rack... any person. The NRC originally approved the AP1000 design certification in a final rule in 2006 (71 FR... notice of acceptance (ADAMS Accession No. ML073600743) in the Federal Register (73 FR 4926; January...

  10. Tank 241AP104 Grab Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    TEMPLETON, A.M.

    2000-11-09

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AP-104. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AP-104 required to provide sample material to the Waste Treatment Contractor. Grab samples will be obtained from riser 001 to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives and ICD-23. The 222-S Laboratory will receive samples; composite the samples; perform chemical analyses on composite samples; and provide samples to the Waste Treatment Contractor and the Process Chemistry Laboratory. The Process Chemistry Laboratory at the 222-S Laboratory Complex will perform process tests to evaluate the behavior of the 241-AP-104 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. The Waste Treatment Contractor will perform process verification and waste form qualification tests. Requirements for analyses of samples originating in the L & H DQO process tests will be documented in the corresponding test plan (Person 2000) and are not within the scope of this SAP. This report provides the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from grab samples retrieved from tank 241-AP-104.

  11. Tracking topic birth and death in LDA.

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Andrew T.; Robinson, David Gerald

    2011-09-01

    Most topic modeling algorithms that address the evolution of documents over time use the same number of topics at all times. This obscures the common occurrence in the data where new subjects arise and old ones diminish or disappear entirely. We propose an algorithm to model the birth and death of topics within an LDA-like framework. The user selects an initial number of topics, after which new topics are created and retired without further supervision. Our approach also accommodates many of the acceleration and parallelization schemes developed in recent years for standard LDA. In recent years, topic modeling algorithms such as latent semantic analysis (LSA)[17], latent Dirichlet allocation (LDA)[10] and their descendants have offered a powerful way to explore and interrogate corpora far too large for any human to grasp without assistance. Using such algorithms we are able to search for similar documents, model and track the volume of topics over time, search for correlated topics or model them with a hierarchy. Most of these algorithms are intended for use with static corpora where the number of documents and the size of the vocabulary are known in advance. Moreover, almost all current topic modeling algorithms fix the number of topics as one of the input parameters and keep it fixed across the entire corpus. While this is appropriate for static corpora, it becomes a serious handicap when analyzing time-varying data sets where topics come and go as a matter of course. This is doubly true for online algorithms that may not have the option of revising earlier results in light of new data. To be sure, these algorithms will account for changing data one way or another, but without the ability to adapt to structural changes such as entirely new topics they may do so in counterintuitive ways.

  12. Towards Automatic Topical Classification of LOD Datasets.

    OpenAIRE

    Meusel, R, Spahiu, B, Bizer, C, Paulheim, H

    2015-01-01

    The datasets that are part of the Linking Open Data cloud diagram (LOD cloud) are classified into the following topical categories: media, government, publications, life sciences, geographic, social networking, user-generated content, and cross-domain. The topical categories were manually assigned to the datasets. In this paper, we investigate to which extent the topical classification of new LOD datasets can be automated using machine learning techniques and the existing annotations as super...

  13. A Topic Modeling Toolbox Using Belief Propagation

    OpenAIRE

    Zeng, Jia

    2012-01-01

    Latent Dirichlet allocation (LDA) is an important hierarchical Bayesian model for probabilistic topic modeling, which attracts worldwide interests and touches on many important applications in text mining, computer vision and computational biology. This paper introduces a topic modeling toolbox (TMBP) based on the belief propagation (BP) algorithms. TMBP toolbox is implemented by MEX C++/Matlab/Octave for either Windows 7 or Linux. Compared with existing topic modeling packages, the novelty o...

  14. Topical Products for the Aging Face.

    Science.gov (United States)

    McCook, John P

    2016-07-01

    This article focuses on nonprescription home-use topical treatment technologies for the aging face and is intended to serve as a guide for the core cosmeceutical technologies currently used and to help educate and assist the selection of topical antiaging products by the professional staff and their patients. Antiaging topical treatments for patient home use should be nonirritating, compatible with the patient skin type, effective, and complementary to surgical and minimally invasive office procedures, and aesthetically elegant. New topical antiaging technologies, formulated as monotherapy or as combinations with well-known cosmeceuticals, should present adequate clinical studies to support their selection for use. PMID:27363774

  15. The treatment of rosacea with topical ivermectin.

    Science.gov (United States)

    Ali, S T; Alinia, H; Feldman, S R

    2015-04-01

    The treatment of rosacea is challenging because several pathophysiologic processes may be involved, including neurovascular dysregulation and alterations in innate immune status. Demodex mites may play a role in the latter mechanism. Topical ivermectin is a new therapeutic modality which demonstrates antiparasitic and anti-inflammatory properties. This article reviews published evidence related to the efficacy and safety of topical ivermectin. PubMed was utilized to search for key words "topical ivermectin", "ivermectin cream" and "rosacea". Three clinical trials were found that studied topical ivermectin as a treatment option for rosacea. Ivermectin was effective, safe and well tolerated. PMID:26020066

  16. Updates of Topical and Local Anesthesia Agents.

    Science.gov (United States)

    Boyce, Ricardo A; Kirpalani, Tarun; Mohan, Naveen

    2016-04-01

    As described in this article, there are many advances in topical and local anesthesia. Topical and local anesthetics have played a great role in dentistry in alleviating the fears of patients, eliminating pain, and providing pain control. Many invasive procedures would not be performed without the use and advances of topical/local anesthetics. The modern-day dentist has the responsibility of knowing the variety of products on the market and should have at least references to access before, during, and after treatment. This practice ensures proper care with topical and local anesthetics for the masses of patients entering dental offices worldwide. PMID:27040295

  17. Is there a therapeutic window for pentoxifylline after the onset of acute pancreatitis? Existe uma janela terapêutica para a pentoxifilina após o início da pancreatite aguda?

    Directory of Open Access Journals (Sweden)

    Ana Maria Mendonça Coelho

    2012-07-01

    Full Text Available PURPOSE: To investigate the effects of pentoxifylline (PTX in experimental acute pancreatitis (AP starting drug administration after the induction of the disease. METHODS: One hundred male Wistar rats were submitted to taurocholate-induced AP and divided into three groups: Group Sham: sham-operated rats, Group Saline: AP plus saline solution, and Group PTX: AP plus PTX. Saline solution and PTX were administered 1 hour after induction of AP. At 3 hours after AP induction, peritoneal levels of tumor necrosis factor (TNF-α, and serum levels of interleukin (IL-6 and IL-10 levels were assayed by Enzyme-Linked Immunosorbent Assay (ELISA. Determinations of lung myeloperoxidase activity (MPO, histological analysis of lung and pancreas, and mortality study were performed. RESULTS: PTX administration 1 hour after induction of AP caused a significant decrease in peritoneal levels of TNF-α and in serum levels of IL-6 and IL-10 when compared to the saline group. There were no differences in lung MPO activity between the two groups with AP. A decrease in mortality was observed in the PTX treatment compared to the saline group. CONCLUSIONS: Administration of PTX after the onset of AP decreased the systemic levels of proinflammatory cytokines, raising the possibility that there is an early therapeutic window for PTX after the initiation of AP.OBJETIVO: Investigar os efeitos da pentoxifilina (PTX na pancreatite aguda (PA experimental administrando a droga após a indução da doença. MÉTODOS: Cem ratos machos Wistar foram submetidos à indução da PA através da infusão de taurocolato de sódio e divididos em três grupos: Grupo Sham: sham-operated ratos, Grupo Salina: AP e solução salina, e Grupo PTX: AP e PTX. Solução salina e PTX foram administradas 1 hora após a indução da PA. Três horas após indução da PA os níveis de fator de necrose tumoral (TNF-α no líquido peritoneal e os níveis séricos de interleucina (IL-6 e IL-10 foram

  18. Spatial distribution and compositional variation of APS minerals related to uranium deposits in the Kiggavik-Andrew Lake structural trend, Nunavut, Canada

    Science.gov (United States)

    Riegler, Thomas; Quirt, Dave; Beaufort, Daniel

    2016-02-01

    The Kiggavik-Andrew Lake structural trend consists of four mineralized zones, partially outcropping, lying 2 km south of the erosional contact with the unmetamorphosed sandstone and basal conglomerates of the Paleoproterozoic Thelon Formation. The mineralization is controlled by a major E-W fault system associated with illite and sudoite alteration halos developed in the Archean metagraywackes of the Woodburn Lake Group. Aluminum phosphate sulfate (APS) minerals from the alunite group crystallized in association with the clay minerals in the basement alteration halo as well as in the overlying sandstones, which underwent mostly diagenesis. APS minerals are Sr- and S-rich (svanbergite end-member) in the sedimentary cover overlying the unconformity, whereas they are light rare earth elements (LREE)-rich (florencite end-member) in the altered basement rocks below the unconformity. The geochemical signature of each group of APS minerals together with the petrography indicates three distinct generations of APS minerals related to the following: (1) paleoweathering of continental surfaces prior to the basin occurrence, (2) diagenetic processes during the burial history of the lower unit of the Thelon sandstones, and (3) hydrothermal alteration processes which accompanied the uranium deposition in the basement rocks and partially overlap the sedimentary-diagenetic mineral parageneses. In addition, the association of a first generation of APS minerals with both detrital cerium oxide and aluminum oxy-hydroxide highlights the fact that a part of the detrital material of the basal Thelon Formation originated from eroded paleolaterite (allochthonous regolith). The primary rare earth element (REE)-bearing minerals (e.g., monazite, REE carbonates, and allanite) of the host rocks were characterized to identify the potential sources of REE. The REE chemical composition highlights a local re-incorporation of the REE released from the alteration processes in the APS minerals of

  19. Group Formation in Economics

    Science.gov (United States)

    Demange, Gabrielle; Wooders, Myrna

    2005-01-01

    Broad and diverse ranges of activities are conducted within and by organized groups of individuals, including political, economic and social activities. These activities have recently become a subject of intense interest in economics and game theory. Some of the topics investigated in this collection are models of networks of power and privilege, trade networks, co-authorship networks, buyer-seller networks with differentiated products, and networks of medical innovation and the adaptation of new information. Other topics are social norms on punctuality, clubs and the provision of club goods and public goods, research and development and collusive alliances among corporations, and international alliances and trading agreements. While relatively recent, the literature on game theoretic studies of group formation in economics is already vast. This volume provides an introduction to this important literature on game-theoretic treatments of situations with networks, clubs, and coalitions, including some applications.

  20. AP1000 Features Prevent Potential Containment Recirculation Screen Plugging

    International Nuclear Information System (INIS)

    This paper presents the results of plant design development and evaluations that demonstrate that the AP1000 plant is not subject to potential containment recirculation screen plugging following a loss-of-coolant-accident (LOCA). Following a LOCA in a pressurized water reactor, it is necessary to recirculate water from the containment back into the reactor to maintain long term core cooling. The AP1000 utilizes passive safety systems to provide containment recirculation for long term core cooling following a LOCA. The AP1000 also has non-safety pumps which provide a backup means of providing recirculation. Screens are provided around the recirculation pipes to prevent debris from blocking recirculation flow and core cooling passages. Debris may be generated by the LOCA blowdown from insulation and coatings used inside containment. Even with effective cleanliness programs, there may be some resident debris such as dust and dirt. The potential for plugging the recirculation screens is a current PWR licensing issue. The AP1000 design provides inherent advantages with respect to the potential plugging of containment recirculation screens. These characteristics include prevention of fibrous debris generation, improved debris settling and improved recirculation screen design. Debris settling analysis demonstrates that failure of coatings does not result in debris being transported to the screens before it settles to the floor. Additional analysis also shows that the plant can tolerate conservative amounts of resident debris being transported to the screens. The AP1000 significantly reduces the probability of plugging the containment recirculation screens and significantly reduces inspection and maintenance of coatings used inside containment. (authors)

  1. Functional analysis of the two Brassica AP3 genes involved in apetalous and stamen carpelloid phenotypes.

    Directory of Open Access Journals (Sweden)

    Yanfeng Zhang

    Full Text Available The Arabidopsis homeotic genes APETALA3 (AP3 and PISTILLATA (PI are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8 residues in B.AP3.b led to the change of PI-derived motifs. Meanwhile, B.AP3.a specified petal and stamen development, whereas B.AP3.b only specified stamen development. In B. rapa, the mutations of both genes generated the SC mutant HGMS. In B. napus that contained two B.AP3.a and two B.AP3.b, loss of the two B.AP3.a functions was the key reason for the apetalous mutation, however, the loss-of-function in all four AP3 was related to the SC mutant AMS. We inferred that the 8 residues or the PI-derived motif in AP3 gene probably relates to petal formation.

  2. Availability analysis of the AP600 passive core cooling system

    International Nuclear Information System (INIS)

    The reliability analysis of the AP600 Passive Core Cooling System (PXS) has been done. The fault tree analysis method was used for the quantitative analysis. The PXS can be grouped to several sub-systems i.e.: Reactor Coolant System (RCS) Injection Subsystem, Emergency Core Decay Heat Removal Subsystem, and Containment Sump pH Control Subsystem. The quantitative analysis results indicates that the system unavailability is highly dependent on the valves configuration of the Automatic Depressurization System (ADS). If the ADS valves is arranged in Option-1, the system unavailability is 2.347E-03, this means that the yearly contribution to plant down time can be estimated to be about 20.56 hours per year. Whereas, by using Option-2 of fourth stage ADS valves, the system unavailability is reduced to be 9.877E-04 or 8.65 hours per year and this value is consistent with the allocated goal value (8.0 hours per year). The ADS contributes 66.89% to the system unavailability if it is arranged in Option-1, and will reduced to be about 21.21% if its fourth stages are arranged in Option-2. If the ADS is not included as a subsystem of the PXS (relocate to RCS as a subsystem of RCS), then the PXS unavailability will be reduced to about 7.784E-04 or 6.82 hours per year and this is less then the allocated goal value. The major contributors to the system unavailability are mostly dominated by Stage-4 ADS valves (air piston operated valves and squib valves), inservice testing valves of ADS (solenoid operated valves), solenoid valves of Nitrogen Supply to Accumulator, and Passive Residual Heat Removal actuation valves (air operated valves). Therefore, it is recommended that those valves be analyzed more detail to gain the improvement in its reliability. It is also recommended that the fourth stage of ADS valves should be arranged according to Option-2, i.e. one 10-inch normally open motor operated gate valve in series with one 10-inch normally closed squib valve. (author). 13 refs, 3

  3. Genome-wide identification, phylogeny, evolution and expression patterns of AP2/ERF genes and cytokinin response factors in Brassica rapa ssp. pekinensis.

    Directory of Open Access Journals (Sweden)

    Zhenning Liu

    Full Text Available The AP2/ERF transcription factor family is one of the largest families involved in growth and development, hormone responses, and biotic or abiotic stress responses in plants. In this study, 281 AP2/ERF transcription factor unigenes were identified in Chinese cabbage. These superfamily members were classified into three families (AP2, ERF, and RAV. The ERF family was subdivided into the DREB subfamily and the ERF subfamily with 13 groups (I- XI based on sequence similarity. Duplication, evolution and divergence of the AP2/ERF genes in B. rapa and Arabidopsis thaliana were investigated and estimated. Cytokinin response factors (CRFs, as a subclade of the AP2/ERF family, are important transcription factors that define a branch point in the cytokinin two-component signal (TCS transduction pathway. Up to 21 CRFs with a conserved CRF domain were retrieved and designated as BrCRFs. The amino acid sequences, conserved regions and motifs, phylogenetic relationships, and promoter regions of the 21 BrCRFs were analyzed in detail. The BrCRFs broadly expressed in various tissues and organs. The transcripts of BrCRFs were regulated by factors such as drought, high salinity, and exogenous 6-BA, NAA, and ABA, suggesting their involvement in abiotic stress conditions and regulatory mechanisms of plant hormone homeostasis. These results provide new insight into the divergence, variation, and evolution of AP2/ERF genes at the genome-level in Chinese cabbage.

  4. Multibunch working group

    International Nuclear Information System (INIS)

    The goal of this working group was to foment discussions about the use and limitations of multi-bunch, representatives from most operating or in-project synchrotron radiation sources (ALS, SPEAR, BESSY-2, SPRING-8, ANKA, DELTA, PEP-2, DIAMOND, ESRF...) have presented their experience. The discussions have been led around 3 topics: 1) resistive wall instabilities and ion instabilities, 2) higher harmonic cavities, and 3) multibunch feedback systems

  5. Mammalian Base Excision Repair: Functional Partnership between PARP-1 and APE1 in AP-Site Repair.

    Directory of Open Access Journals (Sweden)

    Rajendra Prasad

    Full Text Available The apurinic/apyrimidinic- (AP- site in genomic DNA arises through spontaneous base loss and base removal by DNA glycosylases and is considered an abundant DNA lesion in mammalian cells. The base excision repair (BER pathway repairs the AP-site lesion by excising and replacing the site with a normal nucleotide via template directed gap-filling DNA synthesis. The BER pathway is mediated by a specialized group of proteins, some of which can be found in multiprotein complexes in cultured mouse fibroblasts. Using a DNA polymerase (pol β immunoaffinity-capture technique to isolate such a complex, we identified five tightly associated and abundant BER factors in the complex: PARP-1, XRCC1, DNA ligase III, PNKP, and Tdp1. AP endonuclease 1 (APE1, however, was not present. Nevertheless, the complex was capable of BER activity, since repair was initiated by PARP-1's AP lyase strand incision activity. Addition of purified APE1 increased the BER activity of the pol β complex. Surprisingly, the pol β complex stimulated the strand incision activity of APE1. Our results suggested that PARP-1 was responsible for this effect, whereas other proteins in the complex had no effect on APE1 strand incision activity. Studies of purified PARP-1 and APE1 revealed that PARP-1 was able to stimulate APE1 strand incision activity. These results illustrate roles of PARP-1 in BER including a functional partnership with APE1.

  6. Topical Session on the Decommissioning and Dismantling Safety Case

    International Nuclear Information System (INIS)

    Set up by the Radioactive Waste Management Committee (RWMC), the WPDD brings together senior representatives of national organisations who have a broad overview of Decommissioning and Dismantling (D and D) issues through their work as regulators, implementers, R and D experts or policy makers. These include representatives from regulatory authorities, industrial decommissioners from the NEA Cooperative Programme on Exchange of Scientific and Technical Information on Nuclear Installation Decommissioning Projects (CPD), and cross-representation from the NEA Committee on Nuclear Regulatory Activities, the Committee on Radiation Protection and Public Health, and the RWMC. The EC is a member of the WPDD and the IAEA also participates. This ensures co-ordination amongst activities in these international programmes. Participation from civil society organisations is considered on a case by case basis, and has already taken place through the active involvement of the Group of Municipalities with Nuclear Installations at the first meeting of the WPDD At its second meeting, in Paris, 5-7 December 2001, the WPDD held two topical sessions on the D and D Safety Case and on the Management of Materials from D and D, respectively. This report documents the topical session on the safety case. The topical session was meant to provide an exchange of information and experience on the following issues: What topics should be included in a safety case? Of what should it consist? Is there sufficient and complete guidance nationally and internationally? How do practices differ internationally? Main boundary condition to this session was that it would deal with plants where spent fuel has been removed. Also the topical sessions was kept at a level that makes the most of the varied constituency of the WPDD. Namely, interface issues are important, and issue-identification and discussion was the immediate goal. There was less interest in examining areas where variability amongst national

  7. Topics in the structure of hadronic systems

    International Nuclear Information System (INIS)

    In this dissertation the author examines a variety of different problems in the physics of strongly-bound systems. Each is elucidated by a different standard method of analysis developed to probe the properties of such systems. He begins with an examination of the properties and consequences of the current algebra of weak currents in the limit of heavy quark spin-flavor symmetry. In particular, he examines the assumptions in the proof of the Ademollo-Gatto theorem in general and for spin-flavor symmetry, and exhibit the constraints imposed upon matrix elements by this theorem. Then he utilizes the renormalization-group method to create composite fermions in a three-generation electroweak model. Such a model is found to reproduce the same low energy behavior as the top-condensate electroweak model, although in general it may have strong constraints upon its Higgs sector. Next he uncovers subtleties in the nonrelativistic quark model that drastically alter the picture of the physical origins of meson electromagnetic and hyperfine mass splittings; in particular, the explicit contributions due to (md-mu) and electrostatic potentials may be overwhelmed by other effects. Such novel effects are used to explain the anomalous pattern of mass splittings recently measured in bottom mesons. Finally, he considers the topic of baryon masses in heavy fermion chiral perturbation theory, including both tree-level and loop effects

  8. PREFACE: Asia-Pacific Interdisciplinary Research Conference 2011 (AP-IRC 2011)

    Science.gov (United States)

    Sandhu, Adarsh; Okada, Hiroshi; Maekawa, Toru; Okano, Ken

    2012-03-01

    ; a novel method for the synthesis of graphene using bacteria extracted from a riverside in Toyohashi by Toyohashi Tech scientists; and ambitious plans to harvest energy by laying massive numbers of solar cells in North Africa as part of the 'Sahara Solar Breeder (SSB) Plan' for a global clean-energy superhighway, described by Hideomi Koinuma. In addition to the technical sessions, the conference banquet included a short session during which the invited speakers described notable trends in research and policy in their part of the world. The short speeches led to animated discussions between the delegates, particularly the young scientists and graduate students, who were able to talk directly with veteran researchers for a first-hand view of the issues raised during the day's presentations. In closing the conference, Professor Makoto Ishida, co-chair of the conference and vice-president of Toyohashi Tech announced that this conference will be held annually at the same time each year, with AP-IRC 2012 scheduled for 15-16 November 2012 at the Irago Sea-Park & Spa Hotel in Aichi Prefecture, Japan. AP-IRC group The PDF also contains lists of the Committees involved.

  9. Functional Analysis of the Two Brassica AP3 Genes Involved in Apetalous and Stamen Carpelloid Phenotypes

    OpenAIRE

    Zhang, Yanfeng; Wang, Xuefang; Zhang, Wenxue; Yu, Fei; Tian, Jianhua; Li, Dianrong; Guo, Aiguang

    2011-01-01

    The Arabidopsis homeotic genes APETALA3 (AP3) and PISTILLATA (PI) are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC) mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8...

  10. Introducing topics about combustion engine in tehnology education

    OpenAIRE

    Škrjanc, Sebastjan

    2013-01-01

    In the thesis we will briefly present internal combustion engines. We divided them into groups according to the number of cycles, according to the position of pistons, after cooling mode, etc.. We will also present advanced technology with which they are during the development of engines reduce their consumption. Everything will be linked to the primary school. Normaly, pupils, the engines meet in eighth grade. We will check how well these topics covered in elementary textbooks, and nat...

  11. Review of Topical Treatment of Upper Tract Urothelial Carcinoma

    Directory of Open Access Journals (Sweden)

    Kenneth G. Nepple

    2009-01-01

    Full Text Available A select group of patients with upper tract urothelial carcinoma may be appropriate candidates for minimally invasive management. Organ-preserving endoscopic procedures may be appropriate for patients with an inability to tolerate major surgery, solitary kidney, bilateral disease, poor renal function, small tumor burden, low-grade disease, or carcinoma in situ. We review the published literature on the use of topical treatment for upper tract urothelial carcinoma and provide our approach to treatment in the office setting.

  12. Treatment of Cutaneous Tumors with Topical 5% Imiquimod Cream

    OpenAIRE

    Sabrina Sisto Alessi; Jose Antonio Sanches; Walmar Roncalli de Oliveira; Maria Cristina Messina; Eugenio Raul de Almeida Pimentel; Cyro Festa Neto

    2009-01-01

    INTRODUCTION: There are various approaches to the treatment of cutaneous tumors; one of them is treatment with imiquimod, a synthetic toll-like receptor agonist with a low molecular weight that offers a topical, noninvasive, and non-surgical therapeutic option. The main objective of our study was to provide data on 89 patients who used a 5% imiquimod cream for the treatment of cutaneous tumors at the Cutaneous Oncology Group of the Dermatology Department of Hospital das Clinicas from 2003 to ...

  13. Development of a topic-related sentence corpus for speech perception research

    Science.gov (United States)

    Helfer, Karen S.; Freyman, Richard L.

    2001-05-01

    A large sentence corpus has been developed for use in speech recognition research. Sentences (n=881, three scoring words per sentence) were developed under 23 topics. In the first phase of development subjects rated each individual scoring word for relatedness to its given topic on a Likert scale. Next, two groups of young, normal-hearing listeners (n=16/group) listened and responded to the recordings of the sentences (spoken by a female talker) presented with one of two types of maskers: steady-state noise (S:N=-13 dB) or two other females speaking random sentences (S:N=-8 dB). Each subject responded to half of the sentences with topic supplied and half with no topic supplied. Data analyses focused on addressing two questions: whether supplementation of topic would be more important in the presence of the speech masker versus the noise masker, and how the degree of relatedness of each key word to the topic influenced the effect of topic on recognition. The data showed little difference in how beneficial the topic was for speech versus noise maskers. Moreover, there was a complex relationship between effect of topic, type of masker, and position of the word in the sentence. [Work supported by NIDCD DC01625.

  14. Installation Technology of AP1000 Steam Generator%AP1000蒸汽发生器安装技术

    Institute of Scientific and Technical Information of China (English)

    郑东宏; 王志强; 张明; 门昌华; 胡德全

    2013-01-01

    AP1000 nuclear power plant is a 3rd generation advanced passive 1000 MWe pressurized water reactor plant with two loops of reactor coolant systems .Compared with the conventional 2nd generation pressurized water reactor technology ,the steam generator ( SG) of AP1000 has many improved changes concerning SG property features and arrangement requirements for facilities within the nuclear island . Based on these improved changes and relevant installation practices ,the installation technology of AP 1000 SG has been introduced and analyzed including installation preparation ,transportation ,lifting,and instal-lation construction ,etc., with a view to provide a technical reference to the installation of main equip-ments in steam supply system of nuclear power plant .%AP1000是二环路的1000 MWe级压水堆三代核电厂,采用非能动安全设施,与传统的二代压水堆核电技术相比,蒸汽发生器本体特征和核岛内的就位要求均有较大的改进。根据AP1000蒸汽发生器自身的特点,并在实践的基础上,对蒸汽发生器的现场安装技术,包括安装准备、现场运输、吊装、核岛安装等进行了介绍和分析,为核电站核蒸汽供应系统主设备的现场运输、吊装和安装提供技术参考。

  15. Infantile generalized hypertrichosis caused by topical minoxidil*

    OpenAIRE

    Rampon, Greice; Henkin, Caroline; de Souza, Paulo Ricardo Martins; de Almeida Jr, Hiram Larangeira

    2016-01-01

    Rare cases of hypertrichosis have been associated with topically applied minoxidil. We present the first reported case in the Brazilian literature of generalized hypertrichosis affecting a 5-year-old child, following use of minoxidil 5%, 20 drops a day, for hair loss. The laboratory investigation excluded hyperandrogenism and thyroid dysfunction. Topical minoxidil should be used with caution in children.

  16. Fostering Topic Knowledge: Essential for Academic Writing

    Science.gov (United States)

    Proske, Antje; Kapp, Felix

    2013-01-01

    Several researchers emphasize the role of the writer's topic knowledge for writing. In academic writing topic knowledge is often constructed by studying source texts. One possibility to support that essential phase of the writing process is to provide interactive learning questions which facilitate the construction of an adequate situation…

  17. Aerodynamics of wind turbines emerging topics

    CERN Document Server

    Amano, R S

    2014-01-01

    Focusing on Aerodynamics of Wind Turbines with topics ranging from Fundamental to Application of horizontal axis wind turbines, this book presents advanced topics including: Basic Theory for Wind turbine Blade Aerodynamics, Computational Methods, and Special Structural Reinforcement Technique for Wind Turbine Blades.

  18. Severe photosensitivity reaction induced by topical diclofenac

    Directory of Open Access Journals (Sweden)

    Pramod B Akat

    2013-01-01

    Full Text Available Albeit uncommon, photosensitivity reaction induced by diclofenac can be an unfortunate adverse reaction complicating its use as a topical analgesic. We here present a case of a patient who suffered such a reaction as a result of exposure to diclofenac, employed as a topical analgesic for low backache. The lesions healed with conservative management without extensive scarring or other complications.

  19. Large scale topic modeling made practical

    DEFF Research Database (Denmark)

    Wahlgreen, Bjarne Ørum; Hansen, Lars Kai

    2011-01-01

    Topic models are of broad interest. They can be used for query expansion and result structuring in information retrieval and as an important component in services such as recommender systems and user adaptive advertising. In large scale applications both the size of the database (number of...... topics at par with a much larger case specific vocabulary....

  20. Topic Maps Based Project Knowledge Management

    Institute of Scientific and Technical Information of China (English)

    Wu Xiaofan; Zhou Liang; Zhang Lei; Li Lingzhi; Ding Qiulin

    2006-01-01

    Based on topic maps, a preprocessing scheme using similarity comparision is presented and applied in knowledge management.Topic and occurrence-oriented merging algorithm is also introduced to implement knowledge integration for the sub-system. An Omnigator-supported example from an aeroaustic institute is utilised to validate the preprocessing method and the result indicates it can speed up the research schedule.

  1. Topics on Electricity Transmission Pricing

    International Nuclear Information System (INIS)

    -subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. To start with, chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently coordinate the allocation of transmission

  2. Therapeutic Effects of Topical Minoxidil or Rosemary and the Combination of Both on the treatment of Alopecia areata

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Lohrasb

    2015-02-01

    Full Text Available Background & Objectives: Considering the prevalence of Alopecia areata, , failure of treatment, and the unknown pathogenesis of this illness, a comparative study was performed by using topical Minoxidil 2% and topical rosemary solution alone and in combination to treatment this disease. Materials & Methods: This study is a clinical trial performed on 200 patients with Alopecia areata referring to Hamzeh clinic of Fasa during the years 2012 and 2013. They were divided into four groups by random permutation, each group contained 50 patients. Group one received the combination of topical Minoxidil 2% and topical rosemary, group two received only topical Minoxidil 2% solution, group three received only topical rosemary solution and the fourth group, the case-control group, did not receive any medication and were just advised to rub the site of the disease for the same period of time. The patients were under observation for one year. Results: The Results of this investigation showed that the best remissions after treatments were as follow (respectively: combination of topical Minoxidil 2% and topical rosemary (27 patient=54 %, Minoxidil 2% solution (23 patients =46%, rosemary solution (21 patients =42%, and case- control group (9 patients =18%. These results showed that despite better response to the combination of rosemary and Minoxidil solutions in comparison to the two other treated groups, the changes were minimal and statistically insignificant (P-value =0.0411. Conclusion: Using the combination of both rosemary and Minoxidil is more effective than the individual one on treatment of Alopecia areata.

  3. Correlated Topic Model for Web Services Ranking

    Directory of Open Access Journals (Sweden)

    Mustapha AZNAG

    2013-07-01

    Full Text Available With the increasing number of published Web services providing similar functionalities, it’s very tedious for a service consumer to make decision to select the appropriate one according to her/his needs. In this paper, we explore several probabilistic topic models: Probabilistic Latent Semantic Analysis (PLSA, Latent Dirichlet Allocation (LDA and Correlated Topic Model (CTM to extract latent factors from web service descriptions. In our approach, topic models are used as efficient dimension reduction techniques, which are able to capture semantic relationships between word-topic and topic-service interpreted in terms of probability distributions. To address the limitation of keywords-based queries, we represent web service description as a vector space and we introduce a new approach for discovering and ranking web services using latent factors. In our experiment, we evaluated our Service Discovery and Ranking approach by calculating the precision (P@n and normalized discounted cumulative gain (NDCGn.

  4. Topic maps for custom viewing of data

    CERN Document Server

    Mahabal, A A; Williams, R E; Brunner, R J

    2002-01-01

    A Topic Map is a structured network of hyperlinks that points into an information pool. Topic Maps have an existence independent of the information pool and hence different Topic Maps can form different layers above the same information pool and provide us with different views of it. We explore the use of Topic Maps with the Unified Column Descriptor (UCD) scheme developed in the frame of the ESO-CDS data mining project. UCD, with its multi-tier hierarchical structure, categorizes parameters reported in tables and catalogs. By using Topic Maps we show how columns from different catalogs with similar but not identical descriptions could be combined. A direct application for the Virtual Observatory community is that of merging catalogs in order to generate customized views of data.

  5. Special topics in international adoption.

    Science.gov (United States)

    Jenista, Jerri Ann

    2005-10-01

    As international adoption has become more "mainstream," the issues recently addressed in domestic adoption have become more important in adoptions involving children originating in other countries. Certain groups of prospective adoptive parents, such as gay or lesbian couples, single parents, and parents with disabilities, have begun to apply to adopt in ever increasing numbers. Children who may have been considered unadoptable in the past are now routinely being offered to prospective adoptive parents. The numbers and ages of the children placed and the spacing between adoptions have come under scrutiny. The rates of adoption dissolutions and disruptions are being examined carefully by the receiving and sending countries. There is a pressing need for research into numerous social aspects of adoption. PMID:16154473

  6. Paquimetria esperada X obtida após LASIK para miopia Achieved X expected pachymetry after LASIK for myopia

    Directory of Open Access Journals (Sweden)

    Juliane de Freitas Santos Paranhos

    2001-06-01

    Full Text Available Objetivo: Comparar a paquimetria corneana encontrada (PEn com a esperada (PEs 3 meses após a cirurgia de LASIK para correção de miopia. Métodos: 77 olhos de 39 pacientes míopes foram incluídos neste estudo. A cirurgia foi realizada utilizando-se o excimer laser Technolas 217 e o microcerátomo automático da Chiron. Paquimetria foi realizada em todos os olhos antes e 3 meses após o LASIK. PEs foi obtida subtraindo-se a profundidade de ablação realizada pelo laser, da paquimetria pré-operatória. Os pacientes foram divididos em 3 grupos: grupo A (55 olhos com miopia variando de -1,00D a -5,75D; grupo B (14 olhos, de -6,00D a -10,00D e grupo C (8 olhos acima de -10,00D. Resultados: Houve uma diminuição da média do equivalente esférico de -2,71D para 0,00 no grupo A, -8,18D para 0,00 no grupo B e de -11,4D para -1,06D no grupo C. As médias das PEs foram 468 mim, 370 mim e 382 mim para os grupos A,B e C, respectivamente. As médias das PEn foram de 491 mim, 431 mim e 427 mim nos grupos A, B e C, respectivamente. Em 70 olhos (90,9 % a PEn foi superior a PEs, sendo esta diferença estatisticamente significativa (p=0,001. Conclusão: Apesar dos resultados mostrarem que a córnea encontrava-se mais espessa do que o esperado após a cirurgia de LASIK, não foi observada hipocorreção significativa. Após 3 meses a refração da maioria dos pacientes estava próxima da emetropia.Purpose: To compare the achieved corneal pachymetry (AP with the expected one (EP after 3 months of LASIK for myopia. Methods: 77 myopic eyes of 39 patients were included in this study. Surgery was performed with the Technolas 217 excimer laser and the Chiron automated corneal shaper microkeratome. Screening pachymetry was performed in all corneas before and 3 months after LASIK. EP was obtained by subtracting the ablation depth from the preoperative pachymetry. Patients were divided into 3 groups as follows: Group A (55 eyes, from -1.00 diopter (D to -5.75D; group

  7. Quantization on nilpotent Lie groups

    CERN Document Server

    Fischer, Veronique

    2016-01-01

    This book presents a consistent development of the Kohn-Nirenberg type global quantization theory in the setting of graded nilpotent Lie groups in terms of their representations. It contains a detailed exposition of related background topics on homogeneous Lie groups, nilpotent Lie groups, and the analysis of Rockland operators on graded Lie groups together with their associated Sobolev spaces. For the specific example of the Heisenberg group the theory is illustrated in detail. In addition, the book features a brief account of the corresponding quantization theory in the setting of compact Lie groups. The monograph is the winner of the 2014 Ferran Sunyer i Balaguer Prize.

  8. Talking topically to artificial dialog partners: Emulating humanlike topic awareness in a virtual agent

    OpenAIRE

    Breuing, Alexa; Wachsmuth, Ipke; Filipe, Joaquim; Fred, Ana

    2013-01-01

    During dialog, humans are able to track ongoing topics, to detect topical shifts, to refer to topics via labels, and to decide on the appropriateness of potential dialog topics. As a result, they interactionally produce coherent sequences of spoken utterances assigning a thematic structure to the whole conversation. Accordingly, an artificial agent that is intended to engage in natural and sophisticated human-agent dialogs should be endowed with similar conversational abilities. This paper pr...

  9. Effects of topical hypothermia on postoperative inflammatory markers in patients undergoing coronary artery bypass surgery

    OpenAIRE

    Kadan, Murat; Erol, Gokhan; Savas Oz, Bilgehan; Arslan, Mehmet

    2014-01-01

    Summary Background We aimed to examine the effects of topical hypothermia on inflammatory markers in patients undergoing coronary artery bypass surgery. Methods Fifty patients undergoing isolated coronary artery bypass surgery were included the study. They were randomised to two groups. Mild hypothermic cardiopulmonary bypass (28–32°C) was performed on both groups using standardised anaesthesiology and surgical techniques. Furthermore, topical cooling with 4°C saline was performed on patients...

  10. Roots of a compact Lie group

    CERN Document Server

    Tapp, Kristopher

    2009-01-01

    This expository article introduces the topic of roots in a compact Lie group. Compared to the many other treatments of this standard topic, I intended for mine to be relatively elementary, example-driven, and free of unnecessary abstractions. Some familiarity with matrix groups and with maximal tori is assumed. This article is self-contained, but is also intended to serve as a supplemental 10th chapter of an eventual new edition of my textbook, ``Matrix Groups for Undergraduates.''

  11. Topics in Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. To start with, chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently

  12. Topics on Electricity Transmission Pricing

    Energy Technology Data Exchange (ETDEWEB)

    Bjoerndal, Mette

    2000-02-01

    Directorate (NVE). To prevent cross-subsidization, the largest state-owned firm was split to form Statkraft SF, Norway's largest generation company, and Statnett SF, the major transmission company. Statnett is also the system operator of the entire Norwegian power system. Many distribution companies, usually publicly owned, are still part of vertically integrated companies, but there is strict separation of the financial accounts for transmission/distribution and generation/marketing. Trading is accomplished through several channels. The largest organized market is the common Norwegian-Swedish pool, NordPool. NordPool ASA is owned by Statnett Marked (which is a subsidiary of Statnett) and the Swedish grid-company, Svenska Kraftnaet. NordPool also supports the Finnish and Danish markets, thus through cooperation with the grid-companies of Denmark (Eltra) and Finland (Fingrid), locational markets are provided in these countries as well. Unlike England and Wales, only part of actual production is traded on this market. In addition, independent brokers offer various energy-contracts and facilitate bilateral contracts. In 1998 22% of the energy was traded on the hourly day-ahead (spot) market of NordPool. NordPool also organizes a forward and futures market and settles contracts from the regulation market organized by Statnett. The regulation market is a realtime market used to settle imbalances in real time. In total, close to 30% of the energy traded is organized through NordPool, and this share is increasing year by year. The efficiency of the market is heavily affected by the operation and pricing of the transmission system, and the topic of this thesis concerns the interaction of the transmission network and the energy markets. Throughout, the findings are illustrated by means of simple examples. This is to enhance readability and intuition. Chapter 2 is devoted to power flow models, whereas chapter 3 provides an overview of models developed to efficiently coordinate the

  13. Status of APS 1-Mwe Parabolic Trough Project

    Energy Technology Data Exchange (ETDEWEB)

    Canada, S.; Brosseau, D.; Kolb, G.; Moore, L.; Cable, R.; Price, H.

    2005-11-01

    Arizona Public Service (APS) is currently installing new power facilities to generate a portion of its electricity from solar resources that will satisfy its obligation under the Arizona Environmental Portfolio Standard (EPS). During FY04, APS began construction on a 1-MWe parabolic trough concentrating solar power plant. This plant represents the first parabolic trough plant to begin construction since 1991. Site preparation and construction activities continued throughout much of FY05, and startup activities are planned for Fall 2005 (with completion early in FY06). The plant will be the first commercial deployment of the Solargenix parabolic trough collector technology developed under contract to the National Renewable Energy Laboratory. The plant will use an organic Rankine cycle (ORC) power plant, provided by Ormat. The ORC power plant is much simpler than the conventional steam Rankine cycle plant and allows unattended operation of the facility.

  14. Densification and microstructure development during HIPing of AP1

    International Nuclear Information System (INIS)

    The densification and the microstructural development during hot isostatic pressing of AP1 superalloy powder were compared with the predictions made from calculated HIP diagrams. Power law creep was found to dominate the densification of the Ni-base superalloy during HIPing. The densification was in accordance with calculated HIP maps at low pressures and annealing times, but at elevated pressures and prolonged HIPing times much faster than calculated. During HIPing some percent of the particles undergo minor deformation. It was found in AP1 that these particles showed coarse grains, whereas the more heavily deformed particles displayed a fine microstructure. The different degrees of deformation may arise from size differences of the particles. (orig.)

  15. Comparative advantages of AP1000 passive safety system

    International Nuclear Information System (INIS)

    With the increasing need of nuclear power, almost all countries who want to build new nuclear power plant take the generation Ⅲ technology as their first choice. The main reason is that the safety of generation Ⅲ technology has been improved greatly than generation Ⅱ and Ⅱ + technology. The passive safety technology is introduced by AP1000 and it is one of the best in generation Ⅲ technologies. The representative passive containment cooling system of AP1000 and containment spray system of generation Ⅱ nuclear power plant were compared in the paper and analyzed using probabilistic safety assessment method. The reasons of passive safety system possessing comparative advantages were obtained by the concrete calculation. (authors)

  16. Electron-cloud measurements and simulations for the APS

    International Nuclear Information System (INIS)

    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC

  17. QCD on the highly parallel computer AP1000

    International Nuclear Information System (INIS)

    We have been running quenched QCD simulations on 324 and 323 x 48 lattices using a 512 processor AP1000, which is a highly parallel computer with up to 1024 processing elements. We have developed programs for update, blocking and hadron propagator calculations. The pseudo heatbath and the overrelaxation algorithms were used for the update with performance of 2.6 and 2.0 μsec/link, respectively. (orig.)

  18. Thermal analysis of the beam missteering in APS storage ring

    International Nuclear Information System (INIS)

    Several bending magnet beam missteering cases have been investigated for the 7-GeV storage ring of the Advanced Photon Source (APS). One of the critical missteering events is presented in this paper. Finite element analyses are performed to solve for both temperature and stress fields. Thermally induced deflections are determined by using beam bending theory. A safe current limit is established for the storage ring chambers

  19. Electron-cloud measurements and simulations for the APS

    OpenAIRE

    Furman, M.A.; Pivi, M.; Harkay, K.C.; Rosenberg, R. A.

    2001-01-01

    We compare experimental results with simulations of the electron cloud effect induced by a positron beam at the APS synchrotron light source at ANL, where the electron cloud effect has been observed and measured with dedicated probes. We find good agreement between simulations and measurements for reasonable values of certain secondary electron yield (SEY) parameters, most of which were extracted from recent bench measurements at SLAC.

  20. The interaction between the adaptor protein APS and Enigma is involved in actin organisation

    DEFF Research Database (Denmark)

    Barres, Romain; Gonzalez, Teresa; Le Marchand-Brustel, Yannick; Tanti, Jean-François

    2005-01-01

    APS (adaptor protein with PH and SH2 domains) is an adaptor protein phosphorylated by several tyrosine kinase receptors including the insulin receptor. To identify novel binding partners of APS, we performed yeast two-hybrid screening. We identified Enigma, a PDZ and LIM domain-containing protein...... that was previously shown to be associated with the actin cytoskeleton. In HEK 293 cells, Enigma interacted specifically with APS, but not with the APS-related protein SH2-B. This interaction required the NPTY motif of APS and the LIM domains of Enigma. In NIH-3T3 cells that express the insulin...... receptor, Enigma and APS were partially co-localised with F-actin in small ruffling structures. Insulin increased the complex formation between APS and Enigma and their co-localisation in large F-actin containing ruffles. While in NIH-3T3 and HeLa cells the co-expression of both Enigma and APS did not...

  1. Work plan, AP-102 mixer pump removal and pump replacement

    International Nuclear Information System (INIS)

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  2. Alignment and commissioning of the APS beamline front ends

    International Nuclear Information System (INIS)

    Fifteen out of forty initial beamline front ends have been installed in the storage-ring tunnel at the 7-GeV Advanced Photon Source (APS). For the front-end installation, a four-step alignment process was designed and consists of (1) prealigning the front-end components with support tables in the preassembly area, (2) installing the components with tables in the storage-ring tunnel and aligning relative to the APS global telescope survey network, (3) confirming the alignment using a tooling laser alignment system, and (4) performing adjustments with the synchrotron-radiation beam during commissioning. The laser alignment system and the prealignment database have been of great importance for the expedient maintenance of front-end components. These tools are very important to a large synchrotron radiation facility, such as the APS, since they make a quick alignment setup possible and minimize alignment time inside the tunnel. This paper will present the four-step alignment process, the laser alignment system, and discuss the alignment confirmation results. copyright 1996 American Institute of Physics

  3. Finite element modeling of AP1000 nuclear island

    International Nuclear Information System (INIS)

    The AP1000 is a standard design developed by Westinghouse and its partners for an advanced nuclear power plant utilizing passive safety features. It is based on the certified design of the AP600 and has been uprated to 1000 MWe. The plant has five principal building structures; the nuclear island, the turbine building; the annex building; the diesel generator building and the radwaste building. The nuclear island consists of the containment building (the steel containment vessel and the containment internal structures), the shield building, and the auxiliary building. These structures are founded on a common basemat and are collectively known as the nuclear island. This paper describes use of the general purpose finite element program ANSYS [2] in structural analyses and qualification of the AP1000 nuclear island buildings. It describes the modeling of the shield building and the auxiliary building and the series of analyses and the flow of information from the global analyses to the detailed analyses and building qualification. (author)

  4. Standardized safety management of AP1000 nuclear power plant

    International Nuclear Information System (INIS)

    In 2002, China published and implemented the Law of the People's Republic of China on Work Safety and promulgated a series of guidelines and policies, which strengthened the safety management supervision. Standardization of safety, as another important step on safety supervision, comes after safety assesment and safety production licensing system, is also a permanent solution. Standardization of safety is a strategic, long term and fundamental work, which is also the basic access to achieving scientific safety management and increasing the inherent safety of an enterprise. Haiyang AP1000 nuclear power plant, adopting the modularized, 'open-top' and parallel construction means, overturned the traditional construction theory of installation work comes after the civil work and greatly shorten the construction period. At the same time, the notable increase of oversize module transportation and lifting and parallel construction raises higher demands for safety management. This article combines the characteristics and difficulties of safety management for Haiyang AP1000 nuclear power plant, puts forward ideas and methods for standardized safety management, and could also serve as reference to the safety management for other AP1000 projects. (authors)

  5. Long-term stability of the APS storage ring

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS), a third-generation synchrotrons light source, was commissioned in 1995 at Argonne ''National Laboratory and has been fully-operational for beamline users since 1997. The APS storage ring can accommodate up to 68 user beamlines; about 70% of the available beamlines are currently in use by various collaborative access teams (CATS). The 7-GeV synchrotrons light source produces light in the soft to hard x-ray range that is used for research in such areas as x-ray instrumentation; material, chemical and atomic sciences; biology; and geo/soil/ environmental sciences. For the successful operation of an x-ray light source such as the Advanced Photon Source, the long-term stability of the concrete floor supporting the beam components and user beamlines is crucial. Settlements impact the orbit and location of the x-ray source points as well as the position of the x-ray beamlines. This paper compares the results of two successive resurveys of the APS accelerator components performed in 1995 and 1998

  6. AP600-passive containment cooling system structure design and analysis

    International Nuclear Information System (INIS)

    The purpose of this paper is to present the design and analysis activities for the structures of AP 600 passive containment cooling system (PCCS). This design is being performed jointly by Ansaldo and Westinghouse as a part of the AP 600 program under the overall leadership of Westinghouse. The AP 600 is a 600 MWe advanced light water reactor that is being designed with passive safety features. The PCCS structures consist of the shield building roof which includes a 400,000 gallon water tank and the PCCS air baffles which direct air flow over the outside of a steel containment vessel to provide the passive cooling of the containment. Two different configurations have been investigated for the shield building roof. One is a flat roof with deep steel girders and a concrete slab with the water tank integral with the steel girders. Another is a conical concrete roof with a steel-lined reinforced concrete tank. Three different options for the water tank have been analyzed. The function of the air baffles is to provide a pathway for natural circulation in a postulated design basis event resulting in large energy release into a containment. (K.I.)

  7. Maternal AP determinants in the Drosophila oocyte and embryo.

    Science.gov (United States)

    Ma, Jun; He, Feng; Xie, Gengqiang; Deng, Wu-Min

    2016-09-01

    An animal embryo cannot initiate its journey of forming a new life on its own. It must rely on maternally provided resources and inputs to kick-start its developmental process. In Drosophila, the initial polarities of the embryo along both the anterior-posterior (AP) and dorsal-ventral (DV) axes are also specified by maternal determinants. Over the past several decades, genetic and molecular studies have identified and characterized such determinants, as well as the zygotic genetic regulatory networks that control patterning in the early embryo. Extensive studies of oogenesis have also led to a detailed knowledge of the cellular and molecular interactions that control the formation of a mature egg. Despite these efforts, oogenesis and embryogenesis have been studied largely as separate problems, except for qualitative aspects with regard to maternal regulation of the asymmetric localization of maternal determinants. Can oogenesis and embryogenesis be viewed from a unified perspective at a quantitative level, and can that improve our understanding of how robust embryonic patterning is achieved? Here, we discuss the basic knowledge of the regulatory mechanisms controlling oogenesis and embryonic patterning along the AP axis. We explore properties of the maternal Bicoid gradient in relation to embryo size in search for a unified framework for robust AP patterning. WIREs Dev Biol 2016, 5:562-581. doi: 10.1002/wdev.235 For further resources related to this article, please visit the WIREs website. PMID:27253156

  8. OLP embedment design method research for AP1000 nuclear plant

    International Nuclear Information System (INIS)

    Background: One of the most advanced nuclear power technology, the first AP1000 reactor is under construction in China. Modularization is one of the main characteristics for AP1000 nuclear plant building. Module wall with steel face plate is used instead of reinforced concrete structure wall. A number of OLP embedments need to be installed into the module wall to connect other structures such as pipes, equipment, operation platforms and any other component attached to the module wall. Therefore, the design of embedment is very important in AP1000 structural design. Purpose: A finite element analysis method and tool for embedment design is needed for convenience. Methods: This paper applies the self-developed GTStrudl command template and VBA macro program for embedment capacity calculation and evaluation based on Microsoft Excel to the embedment design. Results: A Microsoft Excel template for embedment design is developed. Conclusions: The analysis method and template brings reasonable results and may provide some help and use for reference for the engineering practice. (authors)

  9. Group cubization

    OpenAIRE

    Osajda, Damian

    2016-01-01

    We present a procedure of group cubization: It results in a group whose some features resemble the ones of a given group, and which acts without fixed points on a CAT(0) cubical complex. As a main application we establish lack of Kazhdan's property (T) for Burnside groups. Other applications include new constructions of non-exact groups.

  10. PolyADP-ribose polymerase is a coactivator for AP-2-mediated transcriptional activation.

    OpenAIRE

    Kannan, P; Yu, Y; Wankhade, S; Tainsky, M A

    1999-01-01

    Overexpression of transcription factor AP-2 has been implicated in the tumorigenicity of the human teratocarcinoma cell lines PA-1 that contain an activated ras oncogene. Here we show evidence that overexpression of AP-2 sequesters transcriptional coactivators which results in self-inhibition. We identified AP-2-interacting proteins and determined whether these proteins were coactivators for AP-2-mediated transcription. One such interacting protein is polyADP-ribose polymerase (PARP). PARP su...

  11. Analyses of Research Topics in the Field of Informetrics Based on the Method of Topic Modeling

    OpenAIRE

    Sung-Chien Lin

    2014-01-01

    In this study, we used the approach of topic modeling to uncover the possible structure of research topics in the field of Informetrics, to explore the distribution of the topics over years, and to compare the core journals. In order to infer the structure of the topics in the field, the data of the papers published in the Journal of Informetricsand Scientometrics during 2007 to 2013 are retrieved from the database of the Web of Science as input of the approach of topic modeling. The results ...

  12. Control of pain with topical plant medicines

    Institute of Scientific and Technical Information of China (English)

    James; David; Adams; Jr.; Xiaogang; Wang

    2015-01-01

    Pain is normally treated with oral nonsteroidal anti-inflammatory agents and opioids. These drugs are dangerous and are responsible for many hospitalizations and deaths. It is much safer to use topical preparations made from plants to treat pain, even severe pain. Topical preparations must contain compounds that penetrate the skin, inhibit pain receptors such as transient receptor potential cation channels and cyclooxygenase-2, to relieve pain. Inhibition of pain in the skin disrupts the pain cycle and avoids exposure of internal organs to large amounts of toxic compounds. Use of topical pain relievers has the potential to save many lives, decrease medical costs and improve therapy.

  13. Activities of the ESARDA Working Group on Integrated Safeguards

    International Nuclear Information System (INIS)

    Full text: ESARDA, the European Safeguards Research and Development Association, pursues as a main objective to assist the European safeguards community with advancing progress in safeguards and enhancing the efficiency of systems and measures. Key bodies of ESARDA are standing Working Groups dealing with various technical subjects. The ESARDA Working Group on Integrated Safeguards was created in 2000 with the objective to provide the Safeguards Community with expert advice on methodologies and approaches to integrate INFCIRC/153 and INFCIRC/540 measures and to present a forum for the exchange of information, views and experiences in that regard. Its members represent inspectorates, national authorities, operators and research centres active in the field of safeguards. The Working Group very soon realized that a first milestone on the road to Integrated Safeguards is the successful and functional implementation of the Additional Protocol. Discussions and activities concentrated on actions necessary to reach this end thereby taking into account the specific situation in European States. Among the topics discussed were issues of: - how to establish a functional site definition for different types of installations, ranging from small locations with very small amounts of nuclear material to complex installations with a complex history; - how to deal with different and even conflicting requirements in the context of unannounced inspections; and - how to interpret and handle the requirements for R and D declarations considering the needs and interests of all parties involved; etc. The IAEA participated in most of the meetings as an observer and provided the group with valuable background information on Additional Protocol questions and received in turn a deep insight into our considerations, motivations and concerns. This procedure contributed much to a better mutual understanding that is not least reflected in the revised draft of the AP implementation guidelines

  14. A novel AP4M1 mutation in autosomal recessive cerebral palsy syndrome and clinical expansion of AP-4 deficiency

    OpenAIRE

    Jameel, Muhammad; Klar, Joakim; Tariq, Muhammad; Moawia, Abubakar; Altaf Malik, Naveed; Seema Waseem, Syeda; Abdullah, Uzma; Naeem Khan, Tahir; Raininko, Raili; Baig, Shahid Mahmood; Dahl, Niklas

    2014-01-01

    BACKGROUND: Cerebral palsy (CP) is a heterogeneous neurodevelopmental disorder associated with intellectual disability in one-third of cases. Recent findings support Mendelian inheritance in subgroups of patients with the disease. The purpose of this study was to identify a novel genetic cause of paraplegic CP with intellectual disability in a consanguineous Pakistani family. METHODS: We performed whole-exome sequencing (WES) in two brothers with CP and intellectual disability. Analysis of AP...

  15. Working group report: Astroparticle and neutrino physics

    Indian Academy of Sciences (India)

    Raj Gandhi; Subhendra Mohanty; Tarun Souradeep; S Agarwalla; K Bhattacharya; B Brahmachari; R Crittenden; S Goswami; P Ghoshal; M Lindner; H S Mani; S Mitra; S Pascoli; S Panda; R Rangarajan; S Ray; T Roy Choudhury; R Saha; S Sarkar; A Srivastava; R Sheth; S Uma Sankar; U Yajnik

    2006-10-01

    The working group on astroparticle and neutrino physics at WHEPP-9 covered a wide range of topics. The main topics were neutrino physics at INO, neutrino astronomy and recent constraints on dark energy coming from cosmological observations of large scale structure and CMB anisotropy.

  16. The first clinical experience on efficacy of topical flutamide on melasma compared with topical hydroquinone: a randomized clinical trial

    Directory of Open Access Journals (Sweden)

    Adalatkhah H

    2015-08-01

    Full Text Available Hassan Adalatkhah,1 Homayoun Sadeghi-Bazargani2,3 1Department of Dermatology, Ardabil University of Medical Sciences, Ardabil, Iran; 2Road Traffic Injury Research Center, Department of Statistics and Epidemiology, Tabriz University of Medical Sciences, Tabriz, Iran; 3Department of Public Health Sciences, Karolinska Institute, Stockholm, Sweden Background: Treatment of melasma is unsatisfactory most of the times. Hormonal role is shown to exist in pathogenesis of the melasma, and sex-hormone related drugs may have an effect on melasma.Aim: To investigate efficacy of 1% flutamide cream versus 4% hydroquinone cream on melasma.Methods: In a parallel randomized clinical trial, 74 women with melasma were allocated to receive a sunscreen along with 4% hydroquinone cream or 1% flutamide cream. Melasma Area and Severity Index (MASI, mexameter melanin assay, and patient satisfaction were investigated.Results: Mean age of the participants was 33.8 years. Mean length of time suffering from Melasma was 96.3 months. The subjects reported in average 1.1 hours per day of exposure to sunlight. Mean standardized total patient satisfaction score was 28.8 (standard deviation [SD] 17.2 in flutamide group patients versus 18 (SD 15.5 in control group (P<0.01. Regardless of treatment group, the skin darkness assessed upon MASI scales was reduced over the treatment course (P<0.001. Using mixed effects, longitudinal modeling showed better treatment efficacy based on MASI scale for flutamide group compared to the hydroquinone group (P<0.05. However, longitudinal analysis of mexameter scores did not reveal any significant difference in melanin measurements between flutamide and hydroquinone.Conclusion: Topical flutamide appeared as effective as topical hydroquinone in treating melasma using mexameter assessment but with a better MASI improvement trend and higher patient satisfaction in flutamide treatment versus topical hydroquinone. As the present study is possibly the

  17. Doing focus group research

    DEFF Research Database (Denmark)

    Lindegaard, Laura Bang

    2014-01-01

    interview data can be of some use if the distinction between natural and contrived data is given up and replaced with a distinction between interview data as topic or as resource. In greater detail, such scholars argue that interview data are perfectly adequate if the researcher wants to study the topic of......Scholars of ethnomethodologically informed discourse studies are often sceptical of the use of interview data such as focus group data. Some scholars quite simply reject interview data with reference to a general preference for so-called naturally occurring data. Other scholars acknowledge that...... interview interaction, but inadequate as data for studying phenomena that go beyond the phenomenon of interview interaction. Neither of these more and less sceptical positions are, on the face of it, surprising due to the ethnomethodological commitment to study social order as accomplished in situ, not as...

  18. Role of the tryptophan residue in the vicinity of the catalytic center of exonuclease III family AP endonucleases: AP site recognition mechanism

    OpenAIRE

    Kaneda, Kohichi; Sekiguchi, Junichi; Shida, Toshio

    2006-01-01

    The mechanisms by which AP endonucleases recognize AP sites have not yet been determined. Based on our previous study with Escherichia coli exonuclease III (ExoIII), the ExoIII family AP endonucleases probably recognize the DNA-pocket formed at an AP site. The indole ring of a conserved tryptophan residue in the vicinity of the catalytic site presumably intercalates into this pocket. To test this hypothesis, we constructed a series of mutants of ExoIII and human APE1. Trp-212 of ExoIII and Tr...

  19. The AP-1 transcription factor homolog Pf-AP-1 activates transcription of multiple biomineral proteins and potentially participates in Pinctada fucata biomineralization

    OpenAIRE

    Xiangnan Zheng; Minzhang Cheng; Liang Xiang; Jian Liang; Liping Xie; Rongqing Zhang

    2015-01-01

    Activator protein-1 (AP-1) is an important bZIP transcription factor that regulates a series of physiological processes by specifically activating transcription of several genes, and one of its well-chartered functions in mammals is participating in bone mineralization. We isolated and cloned the complete cDNA of a Jun/AP-1 homolog from Pinctada fucata and called it Pf-AP-1. Pf-AP-1 had a highly conserved bZIP region and phosphorylation sites compared with those from mammals. A tissue distrib...

  20. NRC confirmatory AP600 safety system phase I testing in the ROSA/AP600 test facility

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, G.S.; Kukita, Yutaka; Schultz, R.R.

    1996-03-01

    The NRC confirmatory phase I testing for the AP600 safety systems has been completed in the modified ROSA (Rig of Safety Assessment) test facility located at the Japan Atomic Energy Research Institute (JAERI) campus in Tokai, Japan. The test matrix included a variety of accident scenarios covering both design and beyond-design basis accidents. The test results indicate the AP600 safety systems as reflected in ROSA appear to perform as designed and there is no danger of core heatup for the accident scenarios investigated. In addition, no detrimental system interactions nor adverse effects of non-safety systems on the safety system functions were identified. However, three phenomena of interest have been identified for further examination to determine whether they are relevant to the AP600 plant. Those three phenomena are: (1) a potential for water hammer caused by rapid condensation which may occur following the actuation of the automatic depressurization system (ADS), (2) a large thermal gradient in the cold leg pipe where cooled water returns from the passive residual heat removal system and forms a thermally stratified layer, and (3) system-wide oscillations initiating following the ADS stage 4 actuation and persisting until the liquid in the pressurizer drains and steam generation in the core becomes insignificant.

  1. Ultrasonic Examination of Double-Shell Tank 241-AP-107 Examination Completed February 2008

    Energy Technology Data Exchange (ETDEWEB)

    Pardini, Allan F.; Weier, Dennis R.; Anderson, Kevin K.

    2008-09-29

    AREVA Federal Services LLC (AFS), under a contract from CH2M HILL Hanford Group (CH2M HILL), has performed an ultrasonic examination of selected portions of Double-Shell Tank 241-AP-107. The purpose of this examination was to provide information that could be used to evaluate the integrity of the wall of the primary tank. The requirements for the ultrasonic examination of Tank 241-AP-107 were to detect, characterize (identify, size, and locate), and record measurements made of any wall thinning, pitting, or cracks that might be present in the wall of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plan (ETP), RPP-Plan-34301 (Castleberry 2007) and summarized on page 1 of this document, are to be reported to CH2M HILL and the Pacific Northwest National Laboratory (PNNL) for further evaluation. Under the contract with CH2M HILL, all data is to be recorded on electronic media and paper copies of all measurements are provided to PNNL for third-party evaluation. PNNL is responsible for preparing a report(s) that describes the results of the AFS ultrasonic examinations.

  2. AP Theory III: Cone-like Graded SUSY, Dynamic Dark Energy and the YM Millenium Problem

    CERN Document Server

    Winkelnkemper, H E

    2010-01-01

    Artin Presentation Theory, (AP Theory), is a new, direct infusion, via pure braid theory, of discrete group theory, (i.e., symmetry in its purest form), into the theory of {\\it smooth} 4-manifolds, (i.e.,$(3+1)$-Quantum Gravity in its purest topological form), thus exhibiting the most basic, rigorous, universal, model-free intrinsic {\\it gauge-gravity} duality in a non-infinitesimal, cone-like graded, as holographic as possible, model-independent, non-perturbative, background-independent, parameter-free manner. {\\it In AP Theory even smooth topology change becomes gauge-theoretic, setting the stage for a rigorous smooth topological $(3+1)$-QFT of Dynamic Dark Energy.} In this theory, the rigid $\\infty$ of the dimension of classical Hilbert space is substituted by the dynamic $\\infty$ of the $\\infty$ generation at each stage of a cone-like graded subgroup of topology-changing transitions/interactions. As a corollary, the Cosmological Constant problem and the YM Millenium Mass Gap problem, two of the most perpl...

  3. MedlinePlus Health Topic XML Files

    Data.gov (United States)

    U.S. Department of Health & Human Services — XML files containing information resources on diseases, conditions and wellness issues. MedlinePlus produces three types of health topic XML files – MedlinePlus...

  4. Mining Concurrent Topical Activity in Microblog Streams

    CERN Document Server

    Panisson, A; Quaggiotto, M; Cattuto, C

    2014-01-01

    Streams of user-generated content in social media exhibit patterns of collective attention across diverse topics, with temporal structures determined both by exogenous factors and endogenous factors. Teasing apart different topics and resolving their individual, concurrent, activity timelines is a key challenge in extracting knowledge from microblog streams. Facing this challenge requires the use of methods that expose latent signals by using term correlations across posts and over time. Here we focus on content posted to Twitter during the London 2012 Olympics, for which a detailed schedule of events is independently available and can be used for reference. We mine the temporal structure of topical activity by using two methods based on non-negative matrix factorization. We show that for events in the Olympics schedule that can be semantically matched to Twitter topics, the extracted Twitter activity timeline closely matches the known timeline from the schedule. Our results show that, given appropriate techn...

  5. A Survey On Interactivity in Topic Models

    Directory of Open Access Journals (Sweden)

    Patrik Ehrencrona Kjellin

    2016-04-01

    Full Text Available Trying to make sense and gain deeper insight from large sets of data is becoming a task very central to computer science in general. Topic models, capable of uncovering the semantic themes pervading through large collections of documents, have seen a surge in popularity in recent years. However, topic models are high level statistical tools; their output is given in terms of probability distributions, suited neither for simple interpretation nor deep analysis. Interpreting the fitted topic models in an intuitive manner requires visual and interactive tools. Additionally, some measure of human interaction is typically required for refining the output offered by such models. In the research, this area remains relatively unexplored – only recently has this aspect been receiving more attention. In this paper, the literature is surveyed as it pertains to interactivity and visualisation within the context of topic models, with the goal of finding current research trends in this area.

  6. Neutron spectroscopy, nuclear structure, related topics. Abstracts

    International Nuclear Information System (INIS)

    Neutron spectroscopy, nuclear structure and related topics are considered. P, T-breaking, neutron beta decay, neutron radiative capture and neutron polarizability are discussed. Reaction with fast neutrons, methodical aspect low-energy fission are considered too

  7. MedlinePlus Health Topic Web Service

    Data.gov (United States)

    U.S. Department of Health & Human Services — A search-based Web service that provides access to disease, condition and wellness information via MedlinePlus health topic data in XML format. The service accepts...

  8. Environmental Health Topics from A to Z

    Science.gov (United States)

    ... Topics Environmental Agents Acrylamide Air Pollution Allergens & Irritants Aloe Vera Arsenic Bisphenol A (BPA) Cell Phones Climate ... Cigarette Smoke Cockroaches Dust Mites Pets & Animals Pollen Aloe Vera Alternatives to Animal Testing Arsenic Asthma Autism ...

  9. The rational design of topical formulations

    OpenAIRE

    Duszynska-Krupa, A. M.

    2015-01-01

    This thesis addresses the development of topical formulations designed to treat atopic dermatitis (AD) using nicotinamide (NA). A rational approach to the development of topical formulations based on the physical and chemical properties of the drug and vehicle components is studied. This approach is an alternative to the model of formulation development where the drug is added into an existing vehicle without optimisation of the formulation in terms of the active delivery to its site of actio...

  10. Topical and oral therapeutic approach to rosacea.

    Science.gov (United States)

    Helfrich, Yolanda R; Maier, Lisa M

    2016-06-01

    Rosacea is an inflammatory condition of the skin, primarily affecting the central convexities of the face. Various topical and oral therapeutic approaches exist. Most have been developed to treat the papulopustular subtype of rosacea; however, other approaches can be used to treat the erythematotelangiectatic, ocular, and phymatous subtypes. This review provides a summary of available topical and oral approaches for the treatment of rosacea. PMID:27416312

  11. Is topical haloperidol a useful glaucoma treatment?

    OpenAIRE

    Lavin, M J; Andrews, V.

    1986-01-01

    A randomised, double blind, single dose study of topical haloperidol, a dopamine receptor blocking drug, was performed on 20 healthy volunteers. After its administration a modest reduction in intraocular pressure was recorded over the six-hour study period, but the difference was not significant at the p less than 0.05 level. Although dopamine blocking agents are effective in reducing intraocular pressure in experimental animals, topical haloperidol appears unlikely to be clinically useful in...

  12. Materials to the topic 'nuclear power plants'

    International Nuclear Information System (INIS)

    The topic Nuclear Power Stations is becoming more and more important for the natural and social science subjects of school. The offers in traditional school books to the topic are insufficient, because of the actuality of the nuclear energy discussion. Therefore, instruction units are bieng produced at many places to fill the gap. This documentation gives a survey of the most important instruction units and a critical analysis of them. Furthermore a bibliography of journal essays, books and a filmography is offered. (orig.)

  13. Formulation, pharmacokinetics and pharmacodynamics of topical microbicides

    OpenAIRE

    Adams, Jessica L.; Kashuba, Angela D. M.

    2012-01-01

    The development of safe topical microbicides that effectively prevent human immunodeficiency virus (HIV) infection is a major goal in curbing the human immunodeficiency virus pandemic. A number of past failures resulting from mucosal toxicity or lack of efficacy have informed the field. Products that caused toxicity to the female genital tract mucosa, and thereby increased the likelihood of HIV acquisition, included nonoxynol 9, cellulose sulfate, and C31 G vaginal gel Savvy®. Topical product...

  14. Recent Advances In Topical Therapy In Dermatology

    OpenAIRE

    Mohan Thappa Devinder

    2003-01-01

    With changing times various newer topical agents are introduced in the field of dermatology. Tacrolimus and pimecrolimus are immunisuppressants, which are effective topically and are tried in the management of atopic dermatitis as well as other disorders including allergic contact dermatitis, atrophic lichen planus, pyoderma gangrenosum. Imiquimod, an immune response modifier, is presently in use for genital warts but has potentials as anti- tumour agent and in various other dermatological co...

  15. Topical calcineurin inhibitors in systemic lupus erythematosus

    OpenAIRE

    Lampropoulos, Christos

    2010-01-01

    Christos E Lampropoulos, David P D’CruzLupus Research Unit, Rayne Institute, St. Thomas’ Hospital, London, UKAbstract: Cutaneous lupus erythematosus (CLE) encompasses a variety of lesions that may be refractory to systemic or topical agents. Discoid lupus erythematosus (DLE) and subacute cutaneous lupus erythematosus (SCLE) are the most common lesions in clinical practice. The topical calcineurin inhibitors, tacrolimus and pimecrolimus, have been used to treat resistant cu...

  16. Pharmacogenetics of ophthalmic topical β-blockers

    OpenAIRE

    Sidjanin, Duska J; Catherine A McCarty; Patchett, Richard; Smith, Edward; Wilke, Russell A

    2008-01-01

    Glaucoma is the second leading cause of blindness worldwide. The primary glaucoma risk factor is elevated intraocular pressure. Topical β-blockers are affordable and widely used to lower intraocular pressure. Genetic variability has been postulated to contribute to interpersonal differences in efficacy and safety of topical β-blockers. This review summarizes clinically significant polymorphisms that have been identified in the β-adrenergic receptors (ADRB1, ADRB2 and ADRB3). The implications ...

  17. Ultrafilters and topologies on groups

    CERN Document Server

    Zelenyuk, Yevhen

    2011-01-01

    This book presents the relationship between ultrafilters and topologies on groups. It shows how ultrafilters are used in constructing topologies on groups with extremal properties and how topologies on groups serve in deriving algebraic results aboutultrafilters. Topics covered include: topological and left topological groups, ultrafilter semigroups, local homomorphisms and automorphisms, subgroups and ideal structure of ßG, almost maximal spaces and projectives of finite semigroups, resolvability of groups. This is a self-contained book aimed at graduate students and researchers working in to

  18. Topical calcineurin inhibitors in systemic lupus erythematosus

    Directory of Open Access Journals (Sweden)

    Christos E Lampropoulos

    2010-04-01

    Full Text Available Christos E Lampropoulos, David P D’CruzLupus Research Unit, Rayne Institute, St. Thomas’ Hospital, London, UKAbstract: Cutaneous lupus erythematosus (CLE encompasses a variety of lesions that may be refractory to systemic or topical agents. Discoid lupus erythematosus (DLE and subacute cutaneous lupus erythematosus (SCLE are the most common lesions in clinical practice. The topical calcineurin inhibitors, tacrolimus and pimecrolimus, have been used to treat resistant cutaneous lupus since 2002 and inhibit the proliferation and activation of T-cells and suppress immune-mediated cutaneous inflammation. This article reviews the mechanism of action, efficacy, adverse effects, and the recent concern about their possible carcinogenic effect. Although the total number of patients is small and there is only one relevant randomized controlled study, the data are encouraging. Many patients, previously resistant to systemic agents or topical steroids, improved after four weeks of treatment. DLE and SCLE lesions were less responsive, reflecting the chronicity of the lesions, although more than 50% of patients still showed improvement. Topical calcineurin inhibitors may be a safe and effective alternative to topical steroids for CLE although the only approved indication is for atopic dermatitis.Keywords: tacrolimus, pimecrolimus, cutaneous lupus erythematosus, topical calcineurin inhibitors

  19. A Topic Model Approach to Representing and Classifying Football Plays

    KAUST Repository

    Varadarajan, Jagannadan

    2013-09-09

    We address the problem of modeling and classifying American Football offense teams’ plays in video, a challenging example of group activity analysis. Automatic play classification will allow coaches to infer patterns and tendencies of opponents more ef- ficiently, resulting in better strategy planning in a game. We define a football play as a unique combination of player trajectories. To this end, we develop a framework that uses player trajectories as inputs to MedLDA, a supervised topic model. The joint maximiza- tion of both likelihood and inter-class margins of MedLDA in learning the topics allows us to learn semantically meaningful play type templates, as well as, classify different play types with 70% average accuracy. Furthermore, this method is extended to analyze individual player roles in classifying each play type. We validate our method on a large dataset comprising 271 play clips from real-world football games, which will be made publicly available for future comparisons.

  20. KSU KDD: Word Sense Induction by Clustering in Topic Space

    OpenAIRE

    Elshamy, Wesam; Caragea, Doina; Hsu, William

    2013-01-01

    We describe our language-independent unsupervised word sense induction system. This system only uses topic features to cluster different word senses in their global context topic space. Using unlabeled data, this system trains a latent Dirichlet allocation (LDA) topic model then uses it to infer the topics distribution of the test instances. By clustering these topics distributions in their topic space we cluster them into different senses. Our hypothesis is that closeness in topic space refl...