DELTA-DIESEL ENGINE LIGHT TRUCK APPLICATION Contract DE-FC05-97OR22606 Final Report
Energy Technology Data Exchange (ETDEWEB)
Hakim, Nabil Balnaves, Mike
2003-05-27
DELTA Diesel Engine Light Truck Application End of Contract Report DE-FC05-97-OR22606 EXECUTIVE SUMMARY This report is the final technical report of the Diesel Engine Light Truck Application (DELTA) program under contract DE-FC05-97-OR22606. During the course of this contract, Detroit Diesel Corporation analyzed, designed, tooled, developed and applied the ''Proof of Concept'' (Generation 0) 4.0L V-6 DELTA engine and designed the successor ''Production Technology Demonstration'' (Generation 1) 4.0L V-6 DELTA engine. The objectives of DELTA Program contract DE-FC05-97-OR22606 were to: Demonstrate production-viable diesel engine technologies, specifically intended for the North American LDT and SUV markets; Demonstrate emissions compliance with significant fuel economy advantages. With a clean sheet design, DDC produced the DELTA engine concept promising the following attributes: 30-50% improved fuel economy; Low cost; Good durability and reliability; Acceptable noise, vibration and harshness (NVH); State-of-the-art features; Even firing, 4 valves per cylinder; High pressure common rail fuel system; Electronically controlled; Turbocharged, intercooled, cooled EGR; Extremely low emissions via CLEAN Combustion{copyright} technology. To demonstrate the engine technology in the SUV market, DDC repowered a 1999 Dodge Durango with the DELTA Generation 0 engine. Fuel economy improvements were approximately 50% better than the gasoline engine replaced in the vehicle.
Diesel Engine Light Truck Application
Energy Technology Data Exchange (ETDEWEB)
None
2007-12-31
The Diesel Engine Light Truck Application (DELTA) program consists of two major contracts with the Department of Energy (DOE). The first one under DE-FC05-97-OR22606, starting from 1997, was completed in 2001, and consequently, a final report was submitted to DOE in 2003. The second part of the contract was under DE-FC05-02OR22909, covering the program progress from 2002 to 2007. This report is the final report of the second part of the program under contract DE-FC05-02OR22909. During the course of this contract, the program work scope and objectives were significantly changed. From 2002 to 2004, the DELTA program continued working on light-duty engine development with the 4.0L V6 DELTA engine, following the accomplishments made from the first part of the program under DE-FC05-97-OR22606. The program work scope in 2005-2007 was changed to the Diesel Particulate Filter (DPF) soot layer characterization and substrate material assessment. This final report will cover two major technical tasks. (1) Continuation of the DELTA engine development to demonstrate production-viable diesel engine technologies and to demonstrate emissions compliance with significant fuel economy advantages, covering progress made from 2002 to 2004. (2) DPF soot layer characterization and substrate material assessment from 2005-2007.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ
Final Technical Report for contract number DE-FG02-05ER15670
Energy Technology Data Exchange (ETDEWEB)
Glazebrook, Jane [Univ. of Minnesota, Minneapolis, MN (United States)
2016-02-29
This is the final technical report for contract number DE-FG02-05ER15670. The project is now complete, and results of the project have been published. Two papers were published based on work done in the last three-year funding period. The DOIs of these papers are included below. The abstracts of the papers, providing summaries of the work, are included in the body of the report.
46 CFR 97.05-5 - Charts and nautical publications.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 97.05-5 Section 97.05... OPERATIONS Notice to Mariners and Aids to Navigation § 97.05-5 Charts and nautical publications. As... tables; (g) Current tables; and (h) All other nautical publications necessary. 1 1 For United States...
46 CFR 24.05-5 - Specific application noted in text.
2010-10-01
..., and in many cases limits the application of the text to vessels contracted for before or after a... 46 Shipping 1 2010-10-01 2010-10-01 false Specific application noted in text. 24.05-5 Section 24... Application § 24.05-5 Specific application noted in text. (a) At the beginning of the various parts, subparts...
34 CFR 97.118 - Applications and proposals lacking definite plans for involvement of human subjects.
2010-07-01
... Education PROTECTION OF HUMAN SUBJECTS Federal Policy for the Protection of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.118 Applications and proposals lacking definite plans..., or contracts are submitted to departments or agencies with the knowledge that subjects may be...
Directory of Open Access Journals (Sweden)
John A. TKac
2015-06-01
Full Text Available Abstract: This paper looks at the role that bullfighting and FC Barcelona have played in the growing independence movement in Catalonia. This article will discuss nations, the importance of bullfighting and soccer to Iberian cultures, Catalan political parties and their role in the nationalist movement, the vote to prohibit bullfighting and FC Barcelona´s increasing political conscious. I conclude that bullfighting and soccer have been used by political parties and those associated with the nationalist movement to foster feelings of difference with Spain. These feelings have been passed from the top down to the Catalan people and risk alienating those who are not in agreement with the nationalist movement.Resumen: Este trabajo examina el papel que la corrida de toros y el equipo de fútbol FC Barcelona han hecho en el movimiento continuo hacia la independencia en Cataluña. Discute el concepto de la nación, la importancia de las corridas y el fútbol en culturas ibéricas, partidos políticos catalanes y su rol en el voto a favor de la prohibición de las corridas en Cataluña y la evolución de la conciencia política cada vez más evidente de FC Barcelona. Concluyo que los partidos políticos y otros asociados con el movimiento hacia la independencia se han aprovechado de las corridas y el fútbol para destacar diferencias culturales con España. Esta actitud de diferencia se ha trasladado de arriba-abajo al pueblo catalán y el movimiento nacionalista corre el riesgo de alienar a los que no comparten sus creencias.
Dufresne, Sébastien S; Boulanger-Piette, Antoine; Bossé, Sabrina; Argaw, Anteneh; Hamoudi, Dounia; Marcadet, Laetitia; Gamu, Daniel; Fajardo, Val A; Yagita, Hideo; Penninger, Josef M; Russell Tupling, A; Frenette, Jérôme
2018-04-24
Although there is a strong association between osteoporosis and skeletal muscle atrophy/dysfunction, the functional relevance of a particular biological pathway that regulates synchronously bone and skeletal muscle physiopathology is still elusive. Receptor-activator of nuclear factor κB (RANK), its ligand RANKL and the soluble decoy receptor osteoprotegerin (OPG) are the key regulators of osteoclast differentiation and bone remodelling. We thus hypothesized that RANK/RANKL/OPG, which is a key pathway for bone regulation, is involved in Duchenne muscular dystrophy (DMD) physiopathology. Our results show that muscle-specific RANK deletion (mdx-RANK mko ) in dystrophin deficient mdx mice improves significantly specific force [54% gain in force] of EDL muscles with no protective effect against eccentric contraction-induced muscle dysfunction. In contrast, full-length OPG-Fc injections restore the force of dystrophic EDL muscles [162% gain in force], protect against eccentric contraction-induced muscle dysfunction ex vivo and significantly improve functional performance on downhill treadmill and post-exercise physical activity. Since OPG serves a soluble receptor for RANKL and as a decoy receptor for TRAIL, mdx mice were injected with anti-RANKL and anti-TRAIL antibodies to decipher the dual function of OPG. Injections of anti-RANKL and/or anti-TRAIL increase significantly the force of dystrophic EDL muscle [45% and 17% gains in force, respectively]. In agreement, truncated OPG-Fc that contains only RANKL domains produces similar gains, in terms of force production, than anti-RANKL treatments. To corroborate that full-length OPG-Fc also acts independently of RANK/RANKL pathway, dystrophin/RANK double-deficient mice were treated with full-length OPG-Fc for 10 days. Dystrophic EDL muscles exhibited a significant gain in force relative to untreated dystrophin/RANK double-deficient mice, indicating that the effect of full-length OPG-Fc is in part independent of the RANKL
46 CFR 70.05-5 - Specific application noted in text.
2010-10-01
... the text pertains, and in many cases limits the application of the text to vessels contracted for... 46 Shipping 3 2010-10-01 2010-10-01 false Specific application noted in text. 70.05-5 Section 70... PROVISIONS Application § 70.05-5 Specific application noted in text. (a) At the beginning of the various...
46 CFR 188.05-5 - Specific application noted in text.
2010-10-01
... which the text pertains, and in many cases limits the application of the text to vessels contracted for... 46 Shipping 7 2010-10-01 2010-10-01 false Specific application noted in text. 188.05-5 Section 188... GENERAL PROVISIONS Application § 188.05-5 Specific application noted in text. (a) At the beginning of the...
Final Report - Advanced Cathode Catalysts and Supports for PEM Fuel Cells
Energy Technology Data Exchange (ETDEWEB)
Debe, Mark
2012-09-28
The principal objectives of the program were development of a durable, low cost, high performance cathode electrode (catalyst and support), that is fully integrated into a fuel cell membrane electrode assembly with gas diffusion media, fabricated by high volume capable processes, and is able to meet or exceed the 2015 DOE targets. Work completed in this contract was an extension of the developments under three preceding cooperative agreements/grants Nos. DE-FC-02-97EE50473, DE-FC-99EE50582 and DE-FC36- 02AL67621 which investigated catalyzed membrane electrode assemblies for PEM fuel cells based on a fundamentally new, nanostructured thin film catalyst and support system, and demonstrated the feasibility for high volume manufacturability.
7 CFR 97.100 - Examination of applications.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Examination of applications. 97.100 Section 97.100... PLANT VARIETY AND PROTECTION Examinations, Allowances, and Denials § 97.100 Examination of applications. (a) [Reserved] (b) Examinations of applications shall include a review of all available documents...
A new carbon additive compounded Li3V1.97Zn0.05(PO4)3/C cathode for plug-in hybrid electric vehicles
International Nuclear Information System (INIS)
Wang, Wenhui; Zhang, Jiaolong; Lin, Yue; Ding, Fei; Chen, Zhenyu; Dai, Changsong
2015-01-01
The application of lithium ion batteries in plug-in hybrid electric vehicles (PHEVs) requires safety, high energy density, high power density, excellent cyclability and good low temperature performance. On the basis of thermally stable Li 3 V 2 (PO 4 ) 3 /C and cost-effective performance carbon additives, we designed a Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) (PB stands for performance carbon additives PBX101) cathode that meets the above requirements for PHEVs battery. Firstly, its Ragone plot presents an excellent energy density retention at high power rates; secondly, the excellent capacity retention and high Coulombic efficiency of Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB)-Li half-cell clearly indicates a potential good cyclability of full cells based on Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) cathode. Finally, we believe the good low temperature performance of Li 3 V 1.97 Zn 0.05 (PO 4 ) 3 /(C+10PB) (i.e. retains 91.6% and 76.3% of its capacity at ∼25 °C, when cycled at 0 and -15 °C) is also beneficial to its application in PHEVs
Directory of Open Access Journals (Sweden)
H.G.O. Silva
2006-02-01
Full Text Available Avaliaram-se o efeito de dietas contendo farelo de cacau (FC ou torta de dendê (TD em substituição ao concentrado padrão, à base de milho e farelo de soja, sobre a composição físico-química e o resultado econômico da produção de leite. Foram utilizadas cinco cabras da raça Saanen com 41,66kg de peso e 60 dias de lactação, no delineamento experimental em quadrado latino 5×5. Os períodos experimentais foram de 14 dias, com 10 dias para adaptação e quatro para a coleta dos dados. As rações concentradas isoprotéicas (13,2% foram calculadas para uma produção de 2kg de leite/dia. As dietas constituíram-se de 36% de volumoso e 64% de concentrado. Utilizaram-se silagem de milho e concentrado-padrão (milho e farelo de soja com 0, 15 e 30% de substituição pelo FC ou TD. As dietas não influenciaram (P>0,05 as características físico-químicas do leite. A substituição reduziu o custo das dietas e apenas as com 15% de FC e 15% de TD apresentaram margem bruta superior à da dieta-controle.The effects of cocoa meal (FC or palm kernel cake (TD replacing corn and soybean meal standard concentrate on physical-chemical composition were evaluated and the economical analysis of milk production was performed. Five Saanen goats, with 41.66kg body weight and 60 days of lactation were used in a 5×5 latin square experimental design. The experimental periods of 14 days, had 10 days for adaptation and four days for data collection. The isoprotec diets (13.2%, were formulated to allow a milk production of 2kg/day. The diets were constituted of 36% roughage and 64% concentrate. The standard concentrate was replaced by 0, 15 and 30% of FC or TD. No effects of diets (P>0.05 on milk physical-chemical characteristics were observed. The inclusion of by-products reduced the cost of diets, however, only those with 15% FC and 15% TD showed gross margin higher than the one observed for the control diet.
El rendimiento en el fútbol. Una modelización de las variables determinantes para el F.C. Barcelona
Directory of Open Access Journals (Sweden)
Carlos Lago Peñas
2007-12-01
Full Text Available El objetivo del presente trabajo es explicar las variables que determinan el rendimiento que alcanza el F.C. Barcelona a lo largo de un partido de fútbol. Para ello se han analizado los 38 partidos disputados por el F.C. Barcelona en la Primera División de la Liga Española de Fútbol de la temporada 2004-2005. La variable que mide el rendimiento es la diferencia entre los lanzamientos a favor y los lanzamientos en contra en cada partido. Las variables explicativas que se manejan son: jugar en casa o fuera, posesión del balón, llegadas al área y equipo rival como determinantes del rendimiento. Los resultados de los análisis de regresión lineal permiten explicar el 68 % de la varianza del rendimiento. El segundo objetivo es valorar la homogeneidad del modelo anterior dependiendo del Episodio de Juego que caracteriza al partido en cada momento, esto es, si el F.C. Barcelona tiene la iniciativa o está a la expectativa en el juego. Los resultados indican que cuando el F.C. Barcelona tiene la iniciativa en el partido tiene un rendimiento mejor que cuando se encuentra a la expectativa y que las variables explicativas analizadas tienen diferente importancia bajo estos escenarios de competición.
Directory of Open Access Journals (Sweden)
Nuria Garatachea Vallejo
2005-01-01
Full Text Available Muchos son los estudios que demuestran el potencial de la frecuencia cardiaca (FC para estimar el coste energético de una actividad física, ya que se relaciona directamente con el consumo de oxígeno (V. O2. La mayoría de estudios describen la relación V. O2- FC como lineal para un amplio rango de esfuerzo, exceptuando los valores de reposo aunque se han propuesto diferentes funciones matemáticas continuas no lineales sin existir todavía un acuerdo en la ecuación más apropiada. También existen estudios que apuntan un cambio en la relación V. O2-FC en función de la intensidad del esfuerzo. Nuestro objetivo fue determinar cuál es la mejor función matemática que describe la relación entre la FC y el V. O2 y decidir cuál es la mejor función matemática para estimar el V. O2 a diferentes intensidades de esfuerzo. Participaron 14 sujetos que realizaron una prueba de esfuerzo máxima sobre cicloergómetro y una prueba que consistía en pedalear a 5 intensidades de esfuerzo (40, 50, 60, 70 y 80% del V. O2max durante 3 minutos. Durante ambas pruebas se midió V. O2 y frecuencia cardiaca. El modelo lineal y potencial fueron los modelos matemáticos más exactos para describir la relación V. O2-FC. El mayor error de estimación se produjo a bajas intensidades de esfuerzo. En conclusión, la elección de un tipo u otro de regresión influye en la exactitud del método de monitorización de la frecuencia cardiaca.
7 CFR 97.19 - Publication of pending applications.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Publication of pending applications. 97.19 Section 97... LABORATORY TESTING PROGRAMS PLANT VARIETY AND PROTECTION The Application § 97.19 Publication of pending applications. Information relating to pending applications shall be published in the Official Journal...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AA02 (Link to dictyBase) - - - Contig-U16527-1 FC-AA02Z (Li...nk to Original site) - - FC-AA02Z 458 - - - - Show FC-AA02 Library FC (Link to library) Clone ID FC-AA02 (Link to dic...linum small subunit ribosomal RNA gene, partial sequence. 149 2e-47 2 AY179984 |AY179984.1 Uncultured alveo... CP000930_2283( CP000930 |pid:none) Heliobacterium modesticaldum Ic... 33 2.3 AP009386_1894( AP009386 |pid:none) Burkholderia multi... EU955514 |pid:none) Zea mays clone 1535262 hypothetica... 50 2e-05 BA000023_1285
Qureshi, O S; Rowley, T F; Junker, F; Peters, S J; Crilly, S; Compson, J; Eddleston, A; Björkelund, H; Greenslade, K; Parkinson, M; Davies, N L; Griffin, R; Pither, T L; Cain, K; Christodoulou, L; Staelens, L; Ward, E; Tibbitts, J; Kiessling, A; Smith, B; Brennan, F R; Malmqvist, M; Fallah-Arani, F; Humphreys, D P
2017-12-06
Engagement of Fcγ-receptors triggers a range of downstream signalling events resulting in a diverse array of immune functions. As a result, blockade of Fc-mediated function is an important strategy for the control of several autoimmune and inflammatory conditions. We have generated a hexameric-Fc fusion protein (hexameric-Fc) and tested the consequences of multi-valent Fcγ-receptor engagement in in vitro and in vivo systems. In vitro engagement of hexameric-Fc with FcγRs showed complex binding interactions that altered with receptor density and triggered the internalisation and degradation of Fcγ-receptors. This caused a disruption of Fc-binding and phagocytosis. In vivo, in a mouse ITP model we observed a short half-life of hexameric-Fc but were nevertheless able to observe inhibition of platelet phagocytosis several days after hexameric-Fc dosing. In cynomolgus monkeys, we again observed a short half-life, but were able to demonstrate effective FcγR blockade. These findings demonstrate the ability of multi-valent Fc-based therapeutics to interfere with FcγR function and a potential mechanism through which they could have a sustained effect; the internalisation and degradation of FcγRs.
Final Report for DOE Project DE-FC07-99CH11010
Energy Technology Data Exchange (ETDEWEB)
Jed Randall; Robert Kean
2003-10-22
Department of Energy award number DE-FC07-99CH11010, Enhanced Utilization of Corn Based Biomaterials, supported a technology development program sponsored by Cargill Dow LLC from September 30, 1999 through June 30, 2003. The work involved fundamental scientific studies on poly lactic acid (PLA), a new environmentally benign plastic material from renewable resources. DOE funds supported academic research at the Colorado School of Mines and the National Renewable Energy Laboratory (NREL), and industry cost share was directed towards applied research into new product development utilizing the fundamental information generated by the academic partners. Under the arrangement of the grant, the fundamental information is published so that other companies can utilize it in evaluating the applicability of PLA in their own products. The overall project objective is to increase the utilization of PLA, a renewable resource based plastic, currently produced from fermented corn sugar.
2010-10-01
... of the Service Contract Act to Contracts for Maintenance, Calibration, or Repair of Certain Equipment....222-51 Exemption from Application of the Service Contract Act to Contracts for Maintenance... clause: Exemption From Application of the Service Contract Act to Contracts for Maintenance, Calibration...
2010-10-01
... of the Service Contract Act to Contracts for Maintenance, Calibration, or Repair of Certain Equipment....222-48 Exemption from Application of the Service Contract Act to Contracts for Maintenance... following provision: Exemption From Application of the Service Contract Act to Contracts for Maintenance...
Fc-fusion Proteins in Therapy: An Updated View.
Jafari, Reza; Zolbanin, Naime M; Rafatpanah, Houshang; Majidi, Jafar; Kazemi, Tohid
2017-01-01
Fc-fusion proteins are composed of Fc region of IgG antibody (Hinge-CH2-CH3) and a desired linked protein. Fc region of Fc-fusion proteins can bind to neonatal Fc receptor (FcRn) thereby rescuing it from degradation. The first therapeutic Fc-fusion protein was introduced for the treatment of AIDS. The molecular designing is the first stage in production of Fc-fusion proteins. The amino acid residues in the Fc region and linked protein are very important in the bioactivity and affinity of the fusion proteins. Although, therapeutic monoclonal antibodies are the top selling biologics but the application of therapeutic Fc-fusion proteins in clinic is in progress and among these medications Etanercept is the most effective in therapy. At present, eleven Fc-fusion proteins have been approved by FDA. There are novel Fc-fusion proteins which are in pre-clinical and clinical development. In this article, we review the molecular and biological characteristics of Fc-fusion proteins and then further discuss the features of novel therapeutic Fc-fusion proteins. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
2000-01-01
The five contracts for Temporary Labour assignments on the CERN site (L020/PE, L 021/PE, L 022/PE, L 023/PE and L 024/PE) approved by the Finance Committee in March 1996 (CERN/FC/3857) reached the end of their initial three-year contractual period at the end of December 1999. At CERN?s request, in September 1999 the Finance Committee approved an extension of these contracts for the year 2000 for a total amount not exceeding 6 000 000 Swiss francs (CERN/FC/4196). In December 1999, one of the five contractors, FIRCROFT, withdrew from its contract for 2000. Following the satisfactory execution of the four remaining contracts during 2000, CERN requests approval to extend them from January 2001 for the second of the two optional years provided for in the original adjudication. The Finance Committee is invited to approve the extension of the existing contracts until 31 December 2001 for a total amount not exceeding 6 000 000 Swiss francs at 2000 prices.
Thermal decomposition of FC(O)OCH3 and FC(O)OCH2CH3.
Berasategui, M; Argüello, G A; Burgos Paci, M A
2018-05-09
The thermal decomposition of methyl and ethyl formates has been extensively studied due to their importance in the oxidation of several fuels, pesticidal properties and their presence in interstellar space. We hitherto present the study of the thermal decomposition of methyl and ethyl fluoroformates, which could help in the elucidation of the reaction mechanisms. The reaction mechanisms were studied using FTIR spectroscopy in the temperature range of 453-733 K in the presence of different pressures of N2 as bath gas. For FC(O)OCH3 two different channels were observed; the unimolecular decomposition which is favored at higher temperatures and has a rate constant kFC(O)OCH3 = (5.3 ± 0.5) × 1015 exp[-(246 ± 10 kJ mol-1/RT)] (in units of s-1) and a bimolecular channel with a rate constant kFC(O)OCH3 = (1.6 ± 0.5) × 1011 exp[-(148 ± 10 kJ mol-1/RT)] (in units of s-1 (mol L)-1). However for ethyl formate, only direct elimination of CO2, HF and ethylene operates. The rate constants of the homogeneous first-order process fit the Arrhenius equation kFC(O)OCH2CH3 = (2.06 ± 0.09) × 1013 exp[-(169 ± 6 kJ mol-1/RT)] (in units of s-1). The difference between the mechanisms of the two fluoroformates relies on the stabilization of a six-centered transition state that only exists for ethyl formate. First principles calculations for the different channels were carried out to understand the dynamics of the decomposition.
Directory of Open Access Journals (Sweden)
Hye-Ji Choi
Full Text Available Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A with mutations in one CH3 domain (CH3A on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B with mutations in the other CH3 domain (CH3B. In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90% with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.
Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Clay, Corey D; Morris, Suzanne C; Finkelman, Fred D
2013-12-01
Stimulatory IgG receptors (FcγRs) on bone marrow-derived cells contribute to the pathogenesis of several autoimmune and inflammatory disorders. Monoclonal antibodies that block FcγRs might suppress these diseases, but they can induce anaphylaxis. We wanted to determine whether a rapid desensitization approach can safely suppress IgG/FcγR-mediated anaphylaxis. Mice were injected with serially increasing doses of 2.4G2, a rat mAb that blocks the inhibitory FcγR, FcγRIIb, and the stimulatory receptor, FcγRIII. Rectal temperature was used to detect the development of anaphylaxis. Passive and active IgG-mediated anaphylaxis were evaluated in mice that had been rapidly desensitized with 2.4G2 or mock-desensitized in mice in which monocyte/macrophages, basophils, or neutrophils had been depleted or desensitized and in mice in which FcγRI, FcγRIII, and/or FcγRIV had been deleted or blocked. Rapid desensitization with 2.4G2 prevented 2.4G2-induced shock and completely suppressed IgG-mediated anaphylaxis. Rapid desensitization of ovalbumin-sensitized mice with 2.4G2 was safer and more effective than rapid desensitization with ovalbumin. 2.4G2 treatment completely blocked FcγRIII and removed most FcγRI and FcγRIV from nucleated peripheral blood cells. Because IgG(2a)-mediated anaphylaxis was partially FcγRI and FcγRIV dependent, the effects of 2.4G2 on FcγRI and FcγRIV were probably crucial for its complete inhibition of IgG(2a)-mediated anaphylaxis. IgG(2a)-mediated anaphylaxis was partially inhibited by depletion or desensitization of monocyte/macrophages, basophils, or neutrophils. IgG-mediated anaphylaxis can be induced by ligation of FcγRI, FcγRIII, or FcγRIV on monocycte/macrophages, basophils, or neutrophils and can be safely suppressed by rapid desensitization with anti-FcγRII/RIII mAb. A similar approach may safely suppress other FcγR-dependent immunopathology. Published by Mosby, Inc.
Suzuki, Takuo; Ishii-Watabe, Akiko; Tada, Minoru; Kobayashi, Tetsu; Kanayasu-Toyoda, Toshie; Kawanishi, Toru; Yamaguchi, Teruhide
2010-02-15
The neonatal FcR (FcRn) binds to the Fc domain of IgG at acidic pH in the endosome and protects IgG from degradation, thereby contributing to the long serum half-life of IgG. To date, more than 20 mAb products and 5 Fc-fusion protein products have received marketing authorization approval in the United States, the European Union, or Japan. Many of these therapeutic proteins have the Fc domain of human IgG1; however, the serum half-lives differ in each protein. To elucidate the role of FcRn in the pharmacokinetics of Fc domain-containing therapeutic proteins, we evaluated the affinity of the clinically used human, humanized, chimeric, or mouse mAbs and Fc-fusion proteins to recombinant human FcRn by surface plasmon resonance analysis. The affinities of these therapeutic proteins to FcRn were found to be closely correlated with the serum half-lives reported from clinical studies, suggesting the important role of FcRn in regulating their serum half-lives. The relatively short serum half-life of Fc-fusion proteins was thought to arise from the low affinity to FcRn. The existence of some mAbs having high affinity to FcRn and a short serum half-life, however, suggested the involvement of other critical factor(s) in determining the serum half-life of such Abs. We further investigated the reason for the relatively low affinity of Fc-fusion proteins to FcRn and suggested the possibility that the receptor domain of Fc-fusion protein influences the structural environment of the FcRn binding region but not of the FcgammaRI binding region of the Fc domain.
7 CFR 97.104 - Application or certificate abandoned.
2010-01-01
... 97.104 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) COMMODITY... abandoned certificates shall be published in the Official Journal, indicating that the variety has become...
Directory of Open Access Journals (Sweden)
Gleidson Giordano Pinto de Carvalho
2008-10-01
Full Text Available Desenvolveu-se o experimento para determinar as frações que compõem as proteínas da silagem de capim-elefante (Pennisetum purpureum Schum. cv. Camaroon submetido ao emurchecimento ou à adição de diferentes níveis de farelo de cacau. O capim-elefante utilizado foi colhido aos 50 dias de rebrota após o corte de uniformização e submetido aos seguintes tratamentos: capim-elefante emurchecido ao sol por oito horas, e capim-elefante sem emurchecimento com níveis de 0 %, 7 %, 14%, 21 % e 28 % de farelo de cacau (FC (% da matéria natural. Acondicionou-se o material em silos de PVC com capacidade para 5,3 litros, que foram abertos após 45 dias. Para todas as frações de proteínas estimadas, o tratamento emurchecido apresentou valores semelhantes (P>0,05 ao do tratamento sem emurchecimento. As frações protéicas foram influenciadas pelas adições de FC, verificando-se redução dos teores das frações A e B1+B2 e aumentos das frações B3 e C, para os níveis crescentes de FC. PALAVRAS-CHAVES: Conservação de forragens, forrageira, Pennisetum purpureum Schum. cv. Cameroon, subproduto, Theobroma cacao L. The experiment was conducted to determine the fractions that compose the protein of silage on the submitted elephant grass forage to wilting under the sun light for eight hours. Other treatments involved the same elephant grass without exposing to sun light but with addition of 0, 7, 14, 21, and 28% of cocoa meal (CM at the ensilage processing. The PVC silos used in the experiment were 5.3 liters in capacity, and were opened in 45 days. To all protein-estimated fractions, the wilted treatment showed similar values (P>.05 to the treatment without wilting. The protein fractions were influenced by CM addictions, verifying reduction in contents of A and B1+B2 fractions and increase in B3 and C fractions, with CM increasing levels
Immunization with avian metapneumovirus harboring chicken Fc induces higher immune responses.
Paudel, Sarita; Easwaran, Maheswaran; Jang, Hyun; Jung, Ho-Kyoung; Kim, Joo-Hun; Shin, Hyun-Jin
2016-07-15
In this study, we evaluated the immune responses of avian metapneumovirus harboring chicken Fc molecule. Stable Vero cells expressing chicken Fc chimera on its surface (Vero-cFc) were established, and we confirmed that aMPV grown in Vero-cFc incorporated host derived chimera Fc into the aMPV virions. Immunization of chicken with aMPV-cFc induced higher level of antibodies and inflammatory cytokines; (Interferon (IFN)-γ and Interleukin (IL)-1β) compared to those of aMPV. The increased levels of antibodies and inflammatory cytokines in chicken immunized with aMPV-cFc were statistically significantly (p<0.05) to that of aMPV and control. The aMPV-cFc group also generated the highest neutralizing antibody response. After challenges, chickens immunized with aMPV-cFc showed much less pathological signs in nasal turbinates and trachea so that we could confirm aMPV-cFc induced higher protection than that of aMPV. The greater ability of aMPV harboring chicken Fc to that of aMPV presented it as a possible vaccine candidate. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Anna Christina Esper Amaro de Faria
2001-05-01
Full Text Available Com o objetivo de avaliar a substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC e farelo de algodão (FA, em dietas para alevinos de piavuçu, Leporinus macrocephalus (Characiformes, Anostomidae, realizou-se um experimento com duração de 60 dias, utilizando-se 300 alevinos, com peso inicial médio de 0,10 g distribuídos em um delineamento em blocos casualizados, com seis tratamentos e cinco repetições. As dietas isoprotéicas foram formuladas de forma a terem o FS, FC, FA, FS+FC, FS+FA e FC+FA como fonte protéica. Os alevinos, alimentados com dietas contendo FS e FS+FA, apresentaram valores de peso final e taxa de eficiência protéica superiores (p 0,05 pelo uso das diferentes dietas. Observou-se redução linear dos valores de peso final, da taxa de eficiência protéica e aumento linear (p The effects of soybean meal (SB protein replacement by canola meal (CN or cottonseed meal (CT protein in diets of Leporinus macrocephalus (Characiformes, Anostomidae fingerlings are provided. Assay was carried out during 60 days. Three hundred fingerlings with mean initial weight of 1.00g were distributed in a block randomized design with six treatments and five replicates. Isoprotein diets contained SB, CN, CT, SB+CN, SB+CT and CN+CT as protein source. Fingerlings fed on diets with SB, SB+CN, SB+CT showed better final mean weight and protein efficiency rate values (p 0.05 by different diets linear reduction (p macrocephalus fingerlings, replacing 50.00% of SB protein.
Effects of microparticle size and Fc density on macrophage phagocytosis.
Directory of Open Access Journals (Sweden)
Patricia Pacheco
Full Text Available Controlled induction of phagocytosis in macrophages offers the ability to therapeutically regulate the immune system as well as improve delivery of chemicals or biologicals for immune processing. Maximizing particle uptake by macrophages through Fc receptor-mediated phagocytosis could lead to new delivery mechanisms in drug or vaccine development. Fc ligand density and particle size were examined independently and in combination in order to optimize and tune the phagocytosis of opsonized microparticles. We show the internalization efficiency of small polystyrene particles (0.5 µm to 2 µm is significantly affected by changes in Fc ligand density, while particles greater than 2 µm show little correlation between internalization and Fc density. We found that while macrophages can efficiently phagocytose a large number of smaller particles, the total volume of phagocytosed particles is maximized through the non-specific uptake of larger microparticles. Therefore, larger microparticles may be more efficient at delivering a greater therapeutic payload to macrophages, but smaller opsonized microparticles can deliver bio-active substances to a greater percentage of the macrophage population. This study is the first to treat as independent variables the physical and biological properties of Fc density and microparticle size that initiate macrophage phagocytosis. Defining the physical and biological parameters that affect phagocytosis efficiency will lead to improved methods of microparticle delivery to macrophages.
Cyclotron production of ruthenium-97 for radiopharmaceutical applications
International Nuclear Information System (INIS)
Music, S.; Gessner, M.
1980-01-01
Ruthenium-97 is of interest for clinical practice in nuclear medicine. The combination of the excellent physical and chemical properties of Ruthenium-97 make this isotope worth evaluating. Ruthenium-97 has been prepared by irradiation of a sheet of molybdenum with the internal alpha-beam of the Ruthenium-97 as a function of the alpha particle energy has been measured. The radiochemical separation and its possible clinical applications have been discussed. (author)
Directory of Open Access Journals (Sweden)
Payá, J.
2008-12-01
Full Text Available This paper reports on a study of the corrosion levels in steel bars embedded in mortars made with a blend of Portland cement and (0-20% spent fluid catalytic cracking catalyst residue (FC3R, with a variable (0.3-0.7 water/binder (w/b ratio. The specimens were stored in the following conditions: relative humidity of 40, 80 or 100% and CO2 concentrations of 5 and 100%. The steel corrosion rate was measured with polarization resistance techniques. In the absence of aggressive agents, the steel was found to remain duly passivated in mortars with an FC3R content of up to 15% under all the conditions of relative humidity tested. The reinforcement corrosion level in mortars with a w/b ratio of 0.3 and 15% FC3R subjected to accelerated carbonation was similar to the level observed in the unblended Portland cement control mortar.En este trabajo se ha estudiado el nivel de corrosión de barras de acero embebidas en morteros de cemento Portland con relación agua/material cementante (a/mc variable (0,3-0,7, en los que parte del cemento (0-20% se sustituyó por catalizador de craqueo usado (FC3R. Las condiciones de conservación de las probetas elaboradas fueron las siguientes: distintas humedades relativas (40, 80 y 100% y dos concentraciones de CO2 (5 y 100%. La velocidad de corrosión de los aceros se midió mediante la técnica de resistencia de polarización. Se ha podido determinar que, bajo las distintas condiciones de humedad relativa y ausencia de agresivo, los aceros se mantuvieron correctamente pasivados en los morteros con contenidos de FC3R de hasta el 15%. El nivel de corrosión que presenta el refuerzo embebidos en morteros con sustitución de un 15% de cemento por FC3R y relación a/mc 0,3, al ser sometidos a un proceso de carbonatación acelerada, era muy similar al mostrado por el mortero patrón, sin FC3R.
The neonatal Fc receptor, FcRn, as a target for drug delivery and therapy.
Sockolosky, Jonathan T; Szoka, Francis C
2015-08-30
Immunoglobulin G (IgG)-based drugs are arguably the most successful class of protein therapeutics due in part to their remarkably long blood circulation. This arises from IgG interaction with the neonatal Fc receptor, FcRn. FcRn is the central regulator of IgG and albumin homeostasis throughout life and is increasingly being recognized as an important player in autoimmune disease, mucosal immunity, and tumor immune surveillance. Various engineering approaches that hijack or disrupt the FcRn-mediated transport pathway have been devised to develop long-lasting and non-invasive protein therapeutics, protein subunit vaccines, and therapeutics for treatment of autoimmune and infectious disease. In this review, we highlight the diverse biological functions of FcRn, emerging therapeutic opportunities, as well as the associated challenges of targeting FcRn for drug delivery and disease therapy. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Vilma Santana
2003-04-01
Full Text Available No Brasil, trabalhadores sem vínculo formal de trabalho representam mais da metade da força de trabalho, cuja maioria é composta por mulheres. Neste estudo, estima-se a incidência anual de acidentes ocupacionais não fatais, e a sua distribuição por gênero e tipo de contrato de trabalho, em uma área urbana do Brasil. Dados provêm de um inquérito de base comunitária conduzido com uma amostra aleatória dos habitantes de Salvador, capital do Estado da Bahia. A população deste estudo compreende o total de pessoas entre 18 e 65 anos que referiram trabalho remunerado (n = 2.947. A coleta de dados baseada em entrevistas domiciliares individuais. A incidência anual de acidentes foi estimada em 5,80%, discretamente maior entre os homens (6,05% do que entre as mulheres (5,53%, ou entre trabalhadores sem contrato formal de trabalho (5,92% do que no grupo de comparação (5,67%, diferenças não estatisticamente significantes. A semelhança entre as freqüências de acidentes de trabalho entre mulheres e homens independentemente do tipo de contrato de trabalho apontam para a necessidade de maior atenção a estes eventos no sexo feminino, e entre os trabalhadores informais, amplamente ignorados nas estatísticas oficiais do país.In Brazil, workers without a formal job contract comprise more than half of the labor force, a contingent formed mainly by women. This study presents estimates of the annual incidence of non-fatal work-related injuries and their distribution by gender and type of job contract in an urban area of Brazil. This was a community-based study with a random cluster area sample of the inhabitants from the city of Salvador, capital of the State of Bahia. The study population included all individuals from 18 to 65 years of age who reported having a paid job (n = 2,947. Data were obtained through individual household interviews. The overall estimated annual incidence rate was 5.80%, with a non-statistically significant
Directory of Open Access Journals (Sweden)
Francisco de Assis MANOEL
2015-09-01
Full Text Available ResumoO objetivo do estudo foi verificar a influência do nível de performance na estratégia de ritmo de corrida de corredores recreacionais. Adicionalmente, objetivou-se descrever o comportamento da frequência cardíaca (FC obtida em prova de 10 km em pista de atletismo. Participaram 39 corredores recreacionais (31,5 ± 6,7 anos, experientes em provas de 10 km que realizaram uma performance nesta distância em pista de atletismo (400 m. A FC foi constantemente monitorada (Polar RS800 e o tempo a cada 400 m foi registrado para determinação da velocidade média (VM, posteriormente analisada a cada 2 km. Os participantes foram divididos em dois grupos de acordo com a VM alcançada nos testes: G1 = VM 10 km ≤ 11,81 (n = 20 e G2 = VM 10 km > 11,81 (n = 19. A comparação entre os valores de VM e FC obtidos nos diferentes momentos da performance para os dois grupos foi realizada pela Anova mista, adotando-se nível de significância de p < 0,05. Os valores de VM foram diferentes entre os grupos em todos os momentos analisados, com aumento significante da VM do momento 6-8 km para 8-10 km para o mesmo grupo. Os valores de FC foram diferentes apenas intra-grupos. No G1, houve aumento significante da FC a cada 2 km de prova. Para o G2, a FC aumentou do 2º ao 4º km e permaneceu estável até o 8º km, aumentando novamente nos últimos 2 km da performance. Concluímos que o nível de performance não influencia a estratégia de corrida de corredores recreacionais.
Directory of Open Access Journals (Sweden)
A.L.S. Lacerda
2003-12-01
Full Text Available Os objetivos deste trabalho foram avaliar a eficácia dos dessecantes e determinar a melhor época de aplicação na cultura de soja. O delineamento experimental utilizado foi em blocos casualizados, estando os tratamentos dispostos em esquema fatorial 3x3 e 4x4 de produtos (dessecantes e épocas de aplicação, nos anos agrícolas 1996/97 e 1997/98, respectivamente. Os dessecantes utilizados foram: paraquat, diquat e paraquat + diquat em 1996/97 e paraquat, diquat, paraquat + diquat e glufosinato de amônio em 1997/98, respectivamente nas dosagens de 0,4, 0,3 e 0,2 + 0,15; e 0,4, 0,3, 0,2 + 0,15 e 0,4 kg i.a. ha¹. Como épocas, foram realizadas três aplicações em 1996/97 e quatro em 1997/98, com intervalos de cinco dias a partir do estádio R6. Após análise e interpretação dos resultados, concluiu-se que os dessecantes foram eficazes na dessecação e que o teor de umidade das sementes entre 50 e 60%, as plantas com baixa incidência de vagens amarelas e marrons e a relação peso de biomassa verde de vagens/biomassa verde total de cerca de 0,5 foram características marcantes na determinação da melhor época de aplicação dos dessecantes.The objectives of this work were to evaluate dissecant efficiency and determine the best application time for soybean crop. The experimental design was randomized blocks in factorial schemes 3x3 and 4x4 (dissecants x application time, in 1996/1997 and 1997/1998, respectively. The dissecants applied were: paraquat, diquat and paraquat + diquat in 1996/97 and paraquat, diquat, paraquat + diquat and ammonium glufosinate in 1997/1998, respectively, in the following doses: 0.4; 0.3 and 0.2 + 0.15 and 0.4; 0.3; 0.2 + 0.15 and 0.4 kg a.i. ha-1 Three application times were used in 1996/1997 and four in 1997/1998, with intervals of five days starting from stage R6. Analysis and interpretation of the results allowed to conclude that the dissecants were efficient and that seed moisture between 50 and 60
International Nuclear Information System (INIS)
Jentoft, J.E.; Rayford, R.
1989-01-01
The Fc fragment of a human monoclonal IgG1 was compared with subfragments containing (a) the intact CH2 domain (CH2 fragment) or (b) the intact CH3 domain (pFc' and tFc' fragments). All fragments were reductively 13 C-methylated and their resulting dimethyllysyl resonances characterized in 0.1 M KCl as a function of pH by 13 C NMR spectroscopy. Seven resonances were characterized for the 18 lysine residues of the Fc fragment, eight for the 12 lysines of the CH2 fragment, and five each for the 9 lysines of the pFc' and the 6 lysines of the tFc' fragments, respectively. The multiplicity of resonances indicates that the lysine residues in each fragment exist in a variety of microenvironments and that the fragments are all highly structured. The correspondence between 6 of the 12 or 13 perturbed lysine residues in the Fc fragment and the smaller subfragments indicates that the conformation of the CH2 and CH3 domains is largely unchanged in the smaller fragments. However, in addition to three lysines at the CH2-CH3 domain interface, whose environments were known to be disrupted in the smaller fragments, three or four lysine residues have somewhat different properties in the Fc fragment and in the subfragments, indicating that some local perturbations are included in the domain structure in the subfragments
International Nuclear Information System (INIS)
Jouhara, Hussam; Robinson, Anthony J.
2010-01-01
An experimental investigation of the performance of thermosyphons charged with water as well as the dielectric heat transfer liquids FC-84, FC-77 and FC-3283 has been carried out. The copper thermosyphon was 200 mm long with an inner diameter of 6 mm, which can be considered quite small compared with the vast majority of thermosyphons reported in the open literature. The evaporator length was 40 mm and the condenser length was 60 mm which corresponds with what might be expected in compact heat exchangers. With water as the working fluid two fluid loadings were investigated, that being 0.6 ml and 1.8 ml, corresponding to approximately half filled and overfilled evaporator section in order to ensure combined pool boiling and thin film evaporation/boiling and pool boiling only conditions, respectively. For the Fluorinert TM liquids, only the higher fill volume was tested as the aim was to investigate pool boiling opposed to thin film evaporation. Generally, the water-charged thermosyphon evaporator and condenser heat transfer characteristics compared well with available predictive correlations and theories. The thermal performance of the water-charged thermosyphon also outperformed the other three working fluids in both the effective thermal resistance as well as maximum heat transport capabilities. Even so, FC-84, the lowest saturation temperature fluid tested, shows marginal improvement in the heat transfer at low operating temperatures. All of the tested Fluorinert TM liquids offer the advantage of being dielectric fluids, which may be better suited for sensitive electronics cooling applications and were all found to provide adequate thermal performance up to approximately 30-50 W after which liquid entrainment compromised their performance.
48 CFR 53.301-1437 - Settlement Proposal for Cost-Reimbursement Type Contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Settlement Proposal for Cost-Reimbursement Type Contracts. 53.301-1437 Section 53.301-1437 Federal Acquisition Regulations...-1437 Settlement Proposal for Cost-Reimbursement Type Contracts. ER09DE97.012 [62 FR 64951, Dec. 9, 1997] ...
Bigalke, Boris; Phinikaridou, Alkystis; Andia, Marcelo E; Cooper, Margaret S; Schuster, Andreas; Schönberger, Tanja; Griessinger, Christoph M; Wurster, Thomas; Onthank, David; Ungerer, Martin; Gawaz, Meinrad; Nagel, Eike; Botnar, Rene M
2013-11-01
Plaque erosion leads to exposure of subendothelial collagen, which may be targeted by glycoprotein VI (GPVI). We aimed to detect plaque erosion using (64)Cu-labeled GPVI-Fc (fragment crystallized). Four-week-old male apolipoprotein E-deficient (ApoE(-/-)) mice (n=6) were fed a high-fat diet for 12 weeks. C57BL/6J wild-type (WT) mice served as controls (n=6). Another group of WT mice received a ligation injury of the left carotid artery (n=6) or sham procedure (n=4). All mice received a total activity of ≈12 MBq (64)Cu-GPVI-Fc by tail vein injection followed by delayed (24 hours) positron emission tomography using a NanoPET/computed tomographic scanner (Mediso, Hungary; Bioscan, USA) with an acquisition time of 1800 seconds. Seventy-two hours after positron emission tomography/computed tomography, all mice were scanned 2 hours after intravenous administration of 0.2 mmol/kg body weight of a gadolinium-based elastin-specific MR contrast agent. MRI was performed on a 3-T clinical scanner (Philips Healthcare, Best, The Netherlands). In ApoE(-/-) mice, the (64)Cu-GPVI-Fc uptake in the aortic arch was significantly higher compared with WT mice (ApoE(-/-): 13.2±1.5 Bq/cm(3) versus WT mice: 5.1±0.5 Bq/cm(3); P=0.028). (64)Cu-GPVI-Fc uptake was also higher in the injured left carotid artery wall compared with the intact right carotid artery of WT mice and as a trend compared with sham procedure (injured: 20.7±1.3 Bq/cm(3) versus intact: 2.3±0.5 Bq/cm(3); P=0.028 versus sham: 12.7±1.7 Bq/cm(3); P=0.068). Results were confirmed by ex vivo histology and in vivo MRI with elastin-specific MR contrast agent that measures plaque burden and vessel wall remodeling. Higher R1 relaxation rates were found in the injured carotid wall with a T1 mapping sequence (injured: 1.44±0.08 s(-1) versus intact: 0.91±0.02 s(-1); P=0.028 versus sham: 0.97±0.05 s(-1); P=0.068) and in the aortic arch of ApoE(-/-) mice compared with WT mice (ApoE(-/-): 1.49±0.05 s(-1) versus WT: 0.92±0.04 s
A Scientific Calculator for Exact Real Number Computation Based on LRT, GMP and FC++
Directory of Open Access Journals (Sweden)
J. A. Hernández
2012-03-01
Full Text Available Language for Redundant Test (LRT is a programming language for exact real number computation. Its lazy evaluation mechanism (also called call-by-need and its infinite list requirement, make the language appropriate to be implemented in a functional programming language such as Haskell. However, a direction translation of the operational semantics of LRT into Haskell as well as the algorithms to implement basic operations (addition subtraction, multiplication, division and trigonometric functions (sin, cosine, tangent, etc. makes the resulting scientific calculator time consuming and so inefficient. In this paper, we present an alternative implementation of the scientific calculator using FC++ and GMP. FC++ is a functional C++ library while GMP is a GNU multiple presicion library. We show that a direct translation of LRT in FC++ results in a faster scientific calculator than the one presented in Haskell.El lenguaje de verificación redundante (LRT, por sus siglas en inglés es un lenguaje de programación para el cómputo con números reales exactos. Su método de evaluación lazy (o mejor conocido como llamada por necesidad y el manejo de listas infinitas requerido, hace que el lenguaje sea apropiado para su implementación en un lenguaje funcional como Haskell. Sin embargo, la implementación directa de la semántica operacional de LRT en Haskell así como los algoritmos para funciones básicas (suma, resta, multiplicación y división y funciones trigonométricas (seno, coseno, tangente, etc hace que la calculadora científica resultante sea ineficiente. En este artículo, presentamos una implementación alternativa de la calculadora científica usando FC++ y GMP. FC++ es una librería que utiliza el paradigma Funcional en C++ mientras que GMP es una librería GNU de múltiple precisión. En el artículo mostramos que la implementación directa de LRT en FC++ resulta en una librería más eficiente que la implementada en Haskell.
Directory of Open Access Journals (Sweden)
Wan X Yao
2016-11-01
Full Text Available Previous studies report greater activation in the cortical motor network in controlling eccentric contraction (EC than concentric contraction (CC of human skeletal muscles despite lower activation level of the muscle associated with EC. It is unknown, however, whether the strength of functional coupling between the primary motor cortex (M1 and other involved areas in the brain differs as voluntary movements are controlled by a network of regions in the primary, secondary and association cortices. Examining fMRI-based functional connectivity (FC offers an opportunity to measure strength of such coupling. To address the question, we examined functional MRI (fMRI data acquired during EC and CC (20 contractions each with similar movement distance and speed of the right first dorsal interosseous (FDI muscle in 11 young (20-32 years and healthy individuals and estimated FC between the M1 and a number of cortical regions in the motor control network. The major findings from the behavioral and fMRI-based FC analysis were that (1 no significant differences were seen in movement distance, speed and stability between the EC and CC; (2 significantly stronger mean FC was found for CC than EC. Our finding provides novel insights for a better understanding of the control mechanisms underlying voluntary movements produced by EC and CC. The finding is potentially helpful for guiding the development of targeted sport training and/or therapeutic programs for performance enhancement and injury prevention.
FcγRll: Characterisation of novel Fc receptor interactions and a new receptor form.
JESSICA CLAIRE ANANIA
2018-01-01
Leukocyte Fc receptors (FcR) bind to immunogloulins (Ig) to link the innate and humoral immune system to help balance the immune system and clear infections. We have characterised a novel FcR for IgG (FcγR) form, designated FcγRIIa3, which contains a 19 amino acid insert. This insert interacts with cytoskeletal structures allowing the receptor to be retained for longer periods of time at the cells surface upon activation, higher cell signalling which causes greater cellular activation. Theref...
Human FcγRIIA induces anaphylactic and allergic reactions.
Jönsson, Friederike; Mancardi, David A; Zhao, Wei; Kita, Yoshihiro; Iannascoli, Bruno; Khun, Huot; van Rooijen, Nico; Shimizu, Takao; Schwartz, Lawrence B; Daëron, Marc; Bruhns, Pierre
2012-03-15
IgE and IgE receptors (FcεRI) are well-known inducers of allergy. We recently found in mice that active systemic anaphylaxis depends on IgG and IgG receptors (FcγRIIIA and FcγRIV) expressed by neutrophils, rather than on IgE and FcεRI expressed by mast cells and basophils. In humans, neutrophils, mast cells, basophils, and eosinophils do not express FcγRIIIA or FcγRIV, but FcγRIIA. We therefore investigated the possible role of FcγRIIA in allergy by generating novel FcγRIIA-transgenic mice, in which various models of allergic reactions induced by IgG could be studied. In mice, FcγRIIA was sufficient to trigger active and passive anaphylaxis, and airway inflammation in vivo. Blocking FcγRIIA in vivo abolished these reactions. We identified mast cells to be responsible for FcγRIIA-dependent passive cutaneous anaphylaxis, and monocytes/macrophages and neutrophils to be responsible for FcγRIIA-dependent passive systemic anaphylaxis. Supporting these findings, human mast cells, monocytes and neutrophils produced anaphylactogenic mediators after FcγRIIA engagement. IgG and FcγRIIA may therefore contribute to allergic and anaphylactic reactions in humans.
FcεRI γ-Chain Negatively Modulates Dectin-1 Responses in Dendritic Cells
Directory of Open Access Journals (Sweden)
Yi-Gen Pan
2017-10-01
Full Text Available The inhibitory effect of immunoreceptor tyrosine-based activation motif (ITAM-containing adapters DAP12 and FcεRI γ-chain (FcRγ has been found in many immune functions. Herein, we have further explored the role of these adapters in C-type lectin receptors response. We identified that FcRγ, but not DAP12, could negatively regulate the Dectin-1 responses in dendritic cells (DCs. Loss of FcRγ or both DAP12 and FcRγ enhanced the maturation and cytokine production in DCs upon Dectin-1 activation compared to normal cells, whereas DCs lacking only DAP12 showed little changes. In addition, increments of T cell activation and T helper 17 polarization induced by FcRγ-deficient DCs were observed both in vitro and in vivo. Examining the Dectin-1 signaling, we revealed that the activations of several signaling molecules were augmented in FcRγ-deficient DCs stimulated with Dectin-1 ligands. Furthermore, we demonstrated that the association of phosphatases SHP-1 and PTEN with FcRγ may contribute to the negative regulation of FcRγ in Dectin-1 activation in DCs. These results extend the inhibitory effect of ITAM-containing adapters to Dectin-1 response in immune functions, even though Dectin-1 contains an ITAM-like intracellular domain. According to the role of Dectin-1 in responding to microbes and tumor cells, our finding may have applications in the development of vaccine and cancer therapy.
48 CFR 1819.7302 - NASA contract clauses.
2010-10-01
... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...
Types of contracts and contracting procedures
International Nuclear Information System (INIS)
Zijl, N.A. van
1977-01-01
Contracting for a nuclear power plant can be carried out in many different ways, from a bilateral agreement between two countries to an international open bidding competition. Also the kind of contracts (turnkey, split-package or multi-contract type) are discussed with their pros and cons as well as the contracting procedures which can be followed to come to the conclusion of a contract. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Triveno Rios, C., E-mail: carlos.triveno@ufabc.edu.br [Universidade Federal do ABC (CECS/UFABC), Santo Andre, SP (Brazil). Engenharia de Materiais; Lopes, E.S.N.; Caram, R. [Universidade Estadual de Campinas (FEM/DEMA/UNICAMP), Campinas, SP (Brazil); Kiminami, C.S. [Universidade Federal de Sao Carlos (DEMa/UFSCar), Sao Carlos, SP (Brazil). Departamento de Engenharia de Materiais
2014-07-01
The microstructure of high entropy alloys consists of solid solution phases with FC and BCC simple structures, contrary to classical metallurgy where they form complex structures of intermetallic compounds. Because of this they have several attractive properties for engineering applications. In this work the AlCoFeNiMnTi{sub 0,5} and AlCoFeNiVTi{sub 0,5} alloys were processed by melting arc. Since the main objective was the microstructural and mechanical characterization of ingots as-cast. The alloys were characterized by scanning electron microscopy, X-ray diffraction, microhardness and cold compression test. The results showed that the microstructure consists mainly of dendrites and interdendritic regions consisting of metastable crystalline phases. It was also observed that the AlCoFeNiVTi{sub 0,5} alloy showed better mechanical properties than the AlCoFeNiMnTi{sub 0,5} alloy. This may be associated with differences in the parameters of formation of simple solid solution phases between the two alloys. (author)
Fuel cell based integrated and distributed energy applications (FC-IDEA)
International Nuclear Information System (INIS)
Kotak, D.B.; Wu, S.; Fleetwood, M.S.; Tamoto, H.
2004-01-01
'Full text:' The commercial success of fuel cells will depend upon their adaptation to mobile (e.g., cars, wheelchairs, mopeds, bicycles), stationary (e.g., remote or distributed power), and portable energy applications. Typically such applications are capital intensive and involve a lot of unknowns given that they use new and emergent technology. Also many applications (e.g., hydrogen fuelling station) can be achieved using different technologies and 'pathways'. Thus it is important that a full assessment of possible alternatives be carried out taking into consideration factors such as: capital, operating and maintenance costs; equipment performance, utilization, reliability and scalability; effectiveness to meet the energy demand. NRC is developing a generic software tool which industry experts can use to facilitate assessment of alternative solutions to fulfill the energy requirements for their specific application. We call this tool FC-IDEA (Fuel Cell-based Integrated and Distributed Energy Applications). The system has the following key components: - A Web-based Human-Machine Interface designed for the industry expert to configure and assess alternative designs and operational approaches to satisfy their energy needs (e.g., hydrogen demand profile for a fuelling station, electricity demand profile for a stationary power application); - A Comprehensive Database containing the performance characteristics of energy devices (e.g., electrolysers, hydrogen storage tanks, compressors, dispensers, fuel cells, reformers) that may be used to configure the required application; - A Simulation Model capable of representing the physical system in full 3D to enable ' what-if' analysis of design and operational alternatives and measuring such parameters as performance, utilization, failure and maintenance, shift schedules, and costs. Using this system the expert would be able to configure alternative energy nodes (e.g., remote power) consisting of energy devices. Similarly
Directory of Open Access Journals (Sweden)
José Correa de Lacerda Neto
2009-06-01
Full Text Available In order to study the endurance equine performance, experimental diets composed by five increasing soybean oil levels (control, 6, 12, 18, 24% of the concentrate were given. The following variables were analyzed: lactate concentration (LA, Glucose (GL, Cardiac frequency (FC and rectal temperature (TR. Twenty Arabian horses were used, 9.5 ±5.5 years old, weight 400 ± 30 kg, undergone to an 80 Km endurance race simulation in a treadmill. The endurance was divided in four rings (phases with 20 km each. There was no effect (p>0.05 of the oil addition but there was an effect (P<0.05 of distance on the LA, TR, GL variables. For the FC variable, we observed the effect (p<0.05 of the soybean addition and the distance. The soybean oil addition upper than 6% in the concentrate maintained lower the cardiac frequency, favoring the endurance horse performance. This lower cardiac frequency could suggest that animal lasted longer time in aerobic metabolism, situation that was confirmed by the non exponential increase in the lactate concentration and the increase in the glucose concentration. The oil favored the endurance horse performance.Com o objetivo de estudar o desempenho de cavalos de enduro, foram fornecidas dietas compostas por cinco níveis crescentes de óleo de soja (controle – sem adição de óleo, 6, 12, 18 e 24% do concentrado. As seguintes variáveis foram analisadas: concentração de lactato sangüíneo (LA, glicemia (GL, freqüência cardíaca (FC e temperatura retal (TR. Foram utilizados 20 eqüinos da raça Árabe, idades 9,5 ±5,5 anos, pesos de 400 ± 30 kg, submetidos à simulação de prova de enduro de 80 km em esteira rolante. O enduro foi dividido em quatro anéis (fases de 20 km cada. Não foi observado efeito (p>0,05 da adição de óleo de soja, porém observou-se efeito (p<0,05 da distância percorrida sobre as variáveis LA, TR e GL. Para a variável FC foi observado efeito (p<0,05 da distância percorrida bem como da adi
19 CFR 12.100 - Importations in good faith; common or contract carriage.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Importations in good faith; common or contract... Importations in good faith; common or contract carriage. (a) Exportation in lieu of seizure. Upon a claim that the importer acted in good faith without knowledge of applicable laws and regulations, Customs...
Fc-mediated immune precipitation. III. Visualization by electron microscopy
DEFF Research Database (Denmark)
Møller, NPH; Christiansen, Gunna
1983-01-01
with either rabbit anti-KLH IgG or anti-KLH F(ab')2 fragments. The Fc-Fc interactions were investigated by reacting these surface-adsorbed antibody-rich KLH immune complexes with soluble, antigen-rich ferritin-anti-ferritin complexes using either rabbit anti-ferritin IgG or the corresponding isomolar F(ab')2...... fragments as antibody. Fc-Fc interactions were indicated by the formation of clusters or ring structures of ferritin molecules, which were only seen when using KLH anti-KLH IgG and ferritin-anti-ferritin IgG complexes. When F(ab')2 fragments were used as antibody, no reaction between KLH anti-KLH complexes...
Directory of Open Access Journals (Sweden)
Jorge Marín Hernández
2001-12-01
Full Text Available La música ha sido ampliamente utilizada en la práctica de ejercicios aeróbicos en la industria deportiva. El propósito de este estudio fue comparar el efecto de diferentes intensidades de la música sobre la frecuencia cardiaca (FC y el esfuerzo percibido (EP durante ejercicio estandarizado en un cicloergómetro. 13 hombres y 5 mujeres voluntarios, físicamente activos (edad 20.6 ± 2.2 años realizaron una prueba bajo tres condiciones en diferentes días, asignadas en un diseño contrabalanceado de medidas repetidas: no música (NM, música a 70 dB, (M70 y música a 85 dB (M85. Ellos se ejercitaron por 20 min. con una carga de trabajo constante predeterminada y equivalente al 80% de su FCMax (kp = 1.47 ± 0.4, 90 rev/min. La música utilizada fue del tipo 'Merengue House' en español con un tempo de 131 ± 4.30 bpm, las diferentes intensidades fueron calibradas con un sonómetro. La FC y el EP fueron registrados a los 10 y 20 min. con un monitor de FC Polar y la escala EP-15 de Borg. Prueba FC 10 min. FC 20 min. EP 10 min. EP 20 min. NM 164.78 ± 8.37 172.11 ± 8.54 12.06 ±1.92 13.78 ±2.58 M70 165.11 ±11.16 173.00 ±12.05 12.00 ±2.11 13.56 ±2.89 M85 163.00 ± 7.58 170.17 ± 7.87 11.50 ±1.55 12.94 ±2.07 Tanto para FC como para EP un ANOVA 3 x 2 con medidas repetidas indicó que los promedios a los 20 min. fueron significativamente mayores que a los 10 min. (p<0.05. Las diferencias en FC y EP entre las tres condiciones no fueron significativas (p >0.05. Los resultados indican que los rangos de intensidades de música estudiados M70 y M85 no produjeron un efecto sobre el EP y la FC cuando se realizó ejercicio estandarizado en un cicloergómetro comparado con una condición sin música NM.
24 CFR 983.206 - HAP contract amendments (to add or substitute contract units).
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HAP contract amendments (to add or... Contract § 983.206 HAP contract amendments (to add or substitute contract units). (a) Amendment to substitute contract units. At the discretion of the PHA and subject to all PBV requirements, the HAP contract...
Directory of Open Access Journals (Sweden)
V. dos Santos
2008-12-01
Full Text Available O presente trabalho tem como objetivo descrever a síntese de óxido de zircônio, variando as condições de síntese com o uso de forno convencional (FC ou forno de microondas (FM, através do método Pechini. As características estruturais dos óxidos sintetizados foram determinadas por difração de raios X, infravermelho e análises térmicas. As propriedades morfológicas foram determinadas por microscopia eletrônica de varredura com emissão de campo e por isotermas de adsorção/desorção. O uso de FM ou FC, ou o uso de ambos para um mesmo óxido (FM + FC ou FC + FM apresentaram uma grande influência sobre o grau de cristalinidade dos materiais sintetizados.The present work deals with the synthesis of zirconium oxide under varying conditions of synthesis using conventional furnace (CF or microwave oven (MO, by the Pechini method. This study was carried out with the primary aim of studying the possible influence of the above parameters as synthesis variables on the structural and morphologic properties of ZrO2. The structural characteristics of the synthesized oxides were determined by X-ray diffractio, infrared and thermal analysis. The morphologic properties were determined by FEG-SEM and isothermal gas adsorption/desorption. The use of MO or CF, or both for the same oxide (MO+CF or CF+MO has great influence on the degree of crystallinity of the synthesized materials.
46 CFR 9.7 - Rate for Sunday or holiday services.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Rate for Sunday or holiday services. 9.7 Section 9.7... COMPENSATION FOR OVERTIME SERVICES § 9.7 Rate for Sunday or holiday services. The rate of extra compensation for Sunday or holiday services is hereby fixed at twice the gross daily rate of regular pay of the...
Pollastrini, Joey; Dillon, Thomas M; Bondarenko, Pavel; Chou, Robert Y-T
2011-07-01
Analysis of the strength and stoichiometry of immunoglobulin G (IgG) binding to neonatal Fc receptor (FcRn) and Fcγ receptor (FcγR) is important for evaluating the pharmacokinetics and effector functions of therapeutic monoclonal antibody (mAb) products, respectively. The current standard for assessing FcγR and FcRn binding is composed of cell-based and surface plasmon resonance (SPR) assays. In this work, asymmetrical flow field flow fractionation (AF4) was evaluated to establish the true stoichiometry of IgG binding in solution. AF4 and liquid chromatography-mass spectrometry (LC-MS) were applied to directly observe IgG/FcγR and IgG/FcRn complexes, which were not observed using nonequilibrium size exclusion chromatography (SEC) analysis. Human serum albumin (HSA), an abundant component of human blood and capable of binding FcRn, was studied in combination with FcRn and IgG. AF4 demonstrated that the majority of large complexes of IgG/FcRn/HSA were at an approximate 1:2:1 molar ratio. In addition, affinity measurements of the complex were performed in the sub-micromolar affinity range. A significant decrease in binding was detected for IgG molecules with increased oxidation in the Fc region. AF4 was useful in detecting weak binding between full-length IgG/Fc fragments and Fc receptors and the effect of chemical modifications on binding. AF4 is a useful technique in the assessment of mAb product quality attributes. Copyright © 2011 Elsevier Inc. All rights reserved.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS11 (Link to dictyBase) - - - Contig-U16517-1 FC-BS11Z (Li...nk to Original site) - - FC-BS11Z 683 - - - - Show FC-BS11 Library FC (Link to library) Clone ID FC-BS11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS11Q.Seq.d/ Representative seq. ID FC-BS...11Z (Link to Original site) Representative DNA sequence >FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS11Q.Seq....s producing significant alignments: (bits) Value FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS10 (Link to dictyBase) - - - Contig-U16283-1 FC-BS10Z (Li...nk to Original site) - - FC-BS10Z 720 - - - - Show FC-BS10 Library FC (Link to library) Clone ID FC-BS10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS10Q.Seq.d/ Representative seq. ID FC-BS...10Z (Link to Original site) Representative DNA sequence >FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq.d/
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS21 (Link to dictyBase) - - - Contig-U15764-1 FC-BS21Z (Li...nk to Original site) - - FC-BS21Z 723 - - - - Show FC-BS21 Library FC (Link to library) Clone ID FC-BS21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS21Q.Seq.d/ Representative seq. ID FC-BS...21Z (Link to Original site) Representative DNA sequence >FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.Seq.... Score E Sequences producing significant alignments: (bits) Value FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS...19E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS09 (Link to dictyBase) - - - Contig-U16215-1 FC-BS09Z (Li...nk to Original site) - - FC-BS09Z 626 - - - - Show FC-BS09 Library FC (Link to library) Clone ID FC-BS09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS09Q.Seq.d/ Representative seq. ID FC-BS...09Z (Link to Original site) Representative DNA sequence >FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS09Q.Seq....ignments: (bits) Value SSF360 (SSF360Q) /CSM/SS/SSF3-C/SSF360Q.Seq.d/ 854 0.0 FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)
46 CFR 190.05-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 190.05-1 Section 190.05-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS CONSTRUCTION AND ARRANGEMENT General Fire Protection § 190.05-1 Application. (a) The provisions of this subpart shall apply to...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS14 (Link to dictyBase) - - - Contig-U16399-1 FC-BS14E (Li...nk to Original site) - - - - - - FC-BS14E 534 Show FC-BS14 Library FC (Link to library) Clone ID FC-BS14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS14Q.Seq.d/ Representative seq. ID FC-BS...14E (Link to Original site) Representative DNA sequence >FC-BS14 (FC-BS14Q) /CSM/FC/FC-BS/FC-BS14Q.Seq.... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BS14 (FC-BS
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI
Gasoline Biodesulfurization DE-FC07-97ID13570 FINAL REPORT
Energy Technology Data Exchange (ETDEWEB)
Pienkos, Philip T.
2002-01-15
Nine strains were identified to grow with gasoline as sole sulfur source. Two different genes were cloned from Gordonia terrae KGB1 and tested for the ability to support gasoline BDS. The first of these, fmoA, was cloned by screening a KGB1 gene library for the ability to convert indole to indigo (a sulfur-regulated capability in KGB1). The fmoA gene was overexpressed in a gasoline tolerant strain of Pseudomonas putida PpG1 and the recombinant strain was shown to convert thiophene to a dimer of thiophene sulfoxide at rates nearly two orders of magnitude higher than KGB1 could catalyze the reaction. Despite this high activity the recombinant PpG1 was unable to demonstrate any activity against gasoline either in shake flask or in bench-scale gasoline BDS bioreactor. A second gene (toeA) was cloned from KGB1 and shown to support growth of Rhodococcus erythropolis JB55 on gasoline. The toeA gene was also identified in another gasoline strain T. wratislaviensis EMT4, and was identified as a homolog of dszA from R. erythropolis IGTS8. Expression of this gene in JB55 supported conversion of DBTO2 (the natural substrate for DszA) to HPBS, but activity against gasoline was low and BDS results were inconsistent. It appeared that activity was directed against C2- and C3-thiophenes. Efforts to increase gene expression by plasmid manipulation, by addition of flavin reductase genes, or by expression in PpG1 were unsuccessful. The DszC protein (DBT monooxygenase) from IGTS8 has very little activity against the sulfur compounds in gasoline, but a mutant enzyme with a substitution of phenylalanine for valine at position 261 was shown to have an altered substrate range. This alteration resulted in increased activity against gasoline, with activity towards mainly C3- and C4-thiophenes and benzothiophene. A mutant library of dszB was constructed by RACHITT (W. C. Coco et al., DNA shuffling method for generating highly recombined genes and evolved enzymes. 2001. Nature Biotech. 19
Directory of Open Access Journals (Sweden)
Theophilo Benedicto Ottoni Filho
2014-12-01
Full Text Available Taking into account the nature of the hydrological processes involved in in situ measurement of Field Capacity (FC, this study proposes a variation of the definition of FC aiming not only at minimizing the inadequacies of its determination, but also at maintaining its original, practical meaning. Analysis of FC data for 22 Brazilian soils and additional FC data from the literature, all measured according to the proposed definition, which is based on a 48-h drainage time after infiltration by shallow ponding, indicates a weak dependency on the amount of infiltrated water, antecedent moisture level, soil morphology, and the level of the groundwater table, but a strong dependency on basic soil properties. The dependence on basic soil properties allowed determination of FC of the 22 soil profiles by pedotransfer functions (PTFs using the input variables usually adopted in prediction of soil water retention. Among the input variables, soil moisture content θ (6 kPa had the greatest impact. Indeed, a linear PTF based only on it resulted in an FC with a root mean squared residue less than 0.04 m³ m-3 for most soils individually. Such a PTF proved to be a better FC predictor than the traditional method of using moisture content at an arbitrary suction. Our FC data were compatible with an equivalent and broader USA database found in the literature, mainly for medium-texture soil samples. One reason for differences between FCs of the two data sets of fine-textured soils is due to their different drainage times. Thus, a standardized procedure for in situ determination of FC is recommended.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki
Chang, Ling-Sai; Lo, Mao-Hung; Li, Sung-Chou; Yang, Ming-Yu; Hsieh, Kai-Sheng; Kuo, Ho-Chang
2017-01-01
Previous research has found patients with the FcγRIIIB NA1 variant having increased risk of intravenous immunoglobulin (IVIG) resistance in Kawasaki disease (KD). Our previous studies revealed that elevated FcγRIIA expression correlated with the susceptibility of KD patients. We conducted this research to determine whether and how Fcγ receptors affect the susceptibility, IVIG treatment response, and coronary artery lesions (CAL) of KD patients. The activating FcγRIIA and inhibitory FcγRIIB methylation levels of seven patients with KD and four control subjects were examined using HumanMethylation27 BeadChip. We enrolled a total of 44 KD patients and 10 control subjects with fevers. We performed real-time RT-PCR to determine the FcγRIIA and FcγRIIB expression levels, as well as a luciferase assay of FcγRIIA. We found a considerable increase in methylation of both FcγRIIA and FcγRIIB in KD patients undergoing IVIG treatment. Promoter methylation of FcγRIIA inhibited reporter activity in K562 cells using luciferase assay. The FcγRIIB mRNA expression levels were not found to increase susceptibility, CAL formation, or IVIG resistance. FcγRIIA mRNA expression levels were significantly higher in IVIG-resistant patients than in those that responded to IVIG during the pre-treatment period. Furthermore, the FcγRIIA/IIB mRNA expression ratio was considerably higher in KD patients with CAL than in those without CAL. FcγRIIA and FcγRIIB both demonstrated increased methylation levels in KD patients that underwent IVIG treatment. FcγRIIA expression influenced the IVIG treatment response of KD patients. The FcγRIIA/IIB mRNA expression ratio was greater in KD patients with CAL formation. PMID:27893416
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik
Directory of Open Access Journals (Sweden)
Mónica Andrea Arango Arango
2009-07-01
Full Text Available Este artículo es el resultado de una investigación que desarrolla un modelo para la determinación del canon de arrendamiento en un contrato de leasing sobre vehículos, incluyendo la valoración de la opción de compra implícita en éste. Para realizar esta valoración se utilizaron como base los modelos propuestos por Giaccotto et al. [1] y Gamba y Rigon [2] (en tres marcas de vehículos en Colombia para el período comprendido entre Enero de 2004 y Diciembre de 2007. Se identificó el proceso ARMA de las series de los retornos de los precios de los vehículos. Se realizaron pruebas para identificar posibles efectos ARCH en las series de los retornos de los precios de los vehículos analizados. La estimación del valor de la opción de compra del vehículo al finalizar el contrato de leasing se realiza mediante la implementación del modelo de black-scholes y de simulación Monte Carlo.This article is the result of a research that develops a model related to the determination of the rent on a leasing vehicle contract and the valuation of the call option that gives the lessee the right but not the obligation to buy the used car at the end of the contract at a specified price. We used models proposed by [1] and by [2] in three brands of vehicles in Colombia for the period between January of 2004 and December of 2007. The analysis of the time series of returns of the prices vehicles displayed an ARMA process. We also developed further tests to identify possible ARCH effects in the series of returns of prices of the vehicles analyzed. The estimation of the value of the option to purchase the vehicle at the end of the leasing contract is done by the implementation of the model of Black Scholes and Montecarlo Simulation.
Substratos renováveis na produção de mudas de Ficus enormis proveniente de jardim clonal
Directory of Open Access Journals (Sweden)
Rosimeri de Oliveira Fragoso
2017-01-01
Full Text Available Objetivou-se avaliar substratos renováveis à base de casca de arroz carbonizada (CAC e fibra de coco (FC sobre o enraizamento e qualidade final de mudas de Ficus enormis Mart. ex Miq. via estaquia caulinar de plantas provenientes de jardim clonal. Foram avaliados seis substratos: comercial (controle, composto por casca de arroz carbonizada (CAC, fibra de coco (FC e vermiculita (S1; 100% FC (S2; 100% CAC (S3; 50% FC e 50% CAC (S4; 30% (FC e 70% CAC (S5; 70% FC e 30% CAC (S6. O substrato comercial (S1 e as composições com maior proporção de FC apresentam qualificação superior para a produção de mudas de F. enormis.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA
Directory of Open Access Journals (Sweden)
Álvarez, M.
2005-12-01
Full Text Available The industrial applications of Carbon Fiber (CF have increased in the last years. Particularly, in the aerospace industry, these materials are usually drilled because of the assembly requirements of the structural elements of airships. However, drilling of CF can be accompanied of troubles such as delaminations, lost of surface quality and quick wear of cutting tool. In this work, a study on the surface quality of CF drilled samples as a function of the cutting parameters has been achieved.
En los últimos años, la fibra de carbono (FC encuentra, cada vez, más aplicaciones en los distintos sectores industriales. En el caso particular de la industria aeronáutica, este tipo de materiales se somete frecuentemente a operaciones de taladrado formando parte de estructuras híbridas PC/substrato metálico, debido a las necesidades de montaje en los elementos estructurales de una aeronave. Sin embargo, en el taladrado de FC se puede presentar una serie de problemas como las delaminaciones, la pérdida de calidad en el acabado superficial o el desgaste rápido y excesivo de la herramienta de corte. En este trabajo se lleva a cabo un primer estudio de la calidad de acabado superficial obtenida en muestras de FC taladradas en función de las condiciones de corte impuestas.
Live visualization of genomic loci with BiFC-TALE.
Hu, Huan; Zhang, Hongmin; Wang, Sheng; Ding, Miao; An, Hui; Hou, Yingping; Yang, Xiaojing; Wei, Wensheng; Sun, Yujie; Tang, Chao
2017-01-11
Tracking the dynamics of genomic loci is important for understanding the mechanisms of fundamental intracellular processes. However, fluorescent labeling and imaging of such loci in live cells have been challenging. One of the major reasons is the low signal-to-background ratio (SBR) of images mainly caused by the background fluorescence from diffuse full-length fluorescent proteins (FPs) in the living nucleus, hampering the application of live cell genomic labeling methods. Here, combining bimolecular fluorescence complementation (BiFC) and transcription activator-like effector (TALE) technologies, we developed a novel method for labeling genomic loci (BiFC-TALE), which largely reduces the background fluorescence level. Using BiFC-TALE, we demonstrated a significantly improved SBR by imaging telomeres and centromeres in living cells in comparison with the methods using full-length FP.
Lent, P.L.E.M. van; Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Sloetjes, A.W.; Putte, L.B.A. van de; Verbeek, S.; Berg, W.B. van den
2001-01-01
IgG-containing immune complexes, which are found in most RA joints, communicate with hematopoietic cells using three classes of Fc receptors(Fc gamma RI, -II, -III). In a previous study we found that if a chronic T-cell-mediated antigen-induced arthritis (AIA) was elicited in knee joints of FcR
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BR21 (Link to dictyBase) - - - Contig-U15384-1 | Contig-U16443-1 FC-BR2...1P (Link to Original site) FC-BR21F 551 FC-BR21Z 122 FC-BR21P 673 - - Show FC-BR21 Library FC (L...ink to library) Clone ID FC-BR21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Cont...ig-U15384-1 | Contig-U16443-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR2...1Q.Seq.d/ Representative seq. ID FC-BR21P (Link to Original site) Representative DNA sequence >FC-BR21 (FC-BR2
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI
Okerson, Ann
1997-01-01
Most authors and publishers of electronic information believe that current copyright law does not address technical capabilities or reader uses and have turned to contracts or licenses to define the rights of owners and users. Discusses copyrights, fair use, and licenses and highlights licensing's unresolved issues: use and users; archiving;…
1999-01-01
The five contracts for Temporary Labour assignments on the CERN site (L020/PE, L021/PE, L022/PE, L023/PE and L024/PE) approved by the Finance Committee in March 1996 (CERN/FC/3857) will reach the end of their initial three-year contractual period at the end of December 1999. Following the satisfactory execution of these contracts during this period, CERN requests approval to extend them from January 2000 for the first of the two years foreseen in the original adjudication. The Finance Committee is invited: - to take note that the three-year expenditure for Temporary Labour contracts from 1997 to 1999 will not exceed 19 100 000 Swiss francs, compared to the 18 900 000 Swiss francs estimated at the time of the adjudication in March 1996; - to approve an extension of the present Temporary Labour contracts for the year 2000 for a total amount not exceeding 6 000 000 Swiss francs.
Directory of Open Access Journals (Sweden)
Janina Jamasbi, RPh
2016-04-01
Full Text Available To enhance the antithrombotic properties of recombinant glycoprotein VI fragment crystallizable (GPVI-Fc, the authors incubated GPVI-Fc with anti-human Fc antibodies to cross-link the Fc tails of GPVI-Fc. Cross-linking potentiated the inhibition of human plaque- and collagen-induced platelet aggregation by GPVI-Fc under static and flow conditions without increasing bleeding time in vitro. Cross-linking with anti-human-Fc Fab2 was even superior to anti-human-Fc immunoglobulin G (IgG. Advanced optical imaging revealed a continuous sheath-like coverage of collagen fibers by cross-linked GPVI-Fc complexes. Cross-linking of GPVI into oligomeric complexes provides a new, highly effective, and probably safe antithrombotic treatment as it suppresses platelet GPVI-plaque interaction selectively at the site of acute atherothrombosis.
Abdiche, Yasmina Noubia; Yeung, Yik Andy; Chaparro-Riggers, Javier; Barman, Ishita; Strop, Pavel; Chin, Sherman Michael; Pham, Amber; Bolton, Gary; McDonough, Dan; Lindquist, Kevin; Pons, Jaume; Rajpal, Arvind
2015-01-01
The neonatal Fc receptor (FcRn) is expressed by cells of epithelial, endothelial and myeloid lineages and performs multiple roles in adaptive immunity. Characterizing the FcRn/IgG interaction is fundamental to designing therapeutic antibodies because IgGs with moderately increased binding affinities for FcRn exhibit superior serum half-lives and efficacy. It has been hypothesized that 2 FcRn molecules bind an IgG homodimer with disparate affinities, yet their affinity constants are inconsistent across the literature. Using surface plasmon resonance biosensor assays that eliminated confounding experimental artifacts, we present data supporting an alternate hypothesis: 2 FcRn molecules saturate an IgG homodimer with identical affinities at independent sites, consistent with the symmetrical arrangement of the FcRn/Fc complex observed in the crystal structure published by Burmeister et al. in 1994. We find that human FcRn binds human IgG1 with an equilibrium dissociation constant (KD) of 760 ± 60 nM (N = 14) at 25°C and pH 5.8, and shows less than 25% variation across the other human subtypes. Human IgG1 binds cynomolgus monkey FcRn with a 2-fold higher affinity than human FcRn, and binds both mouse and rat FcRn with a 10-fold higher affinity than human FcRn. FcRn/IgG interactions from multiple species show less than a 2-fold weaker affinity at 37°C than at 25°C and appear independent of an IgG's variable region. Our in vivo data in mouse and rat models demonstrate that both affinity and avidity influence an IgG's serum half-life, which should be considered when choosing animals, especially transgenic systems, as surrogates.
Directory of Open Access Journals (Sweden)
Gleidson Giordano Pinto de Carvalho
2007-10-01
Full Text Available O experimento foi conduzido para avaliar o valor nutritivo da silagem de capim-elefante produzida com o capim emurchecido ou adicionada de diferentes níveis de farelo de cacau. O capim-elefante foi colhido aos 50 dias de rebrota após o corte de uniformização e submetido aos seguintes tratamentos na ensilagem: capim-elefante emurchecido ao sol por 8 horas, e capim-elefante sem emurchecimento com 0, 7, 14, 21 e 28% de farelo de cacau (FC (% da matéria natural. Foram utilizadas quatro repetições por tratamento; o material foi acondicionado em silos de PVC com 0,15 m de diâmetro e 0,3 m de altura, adotando-se compactação de 500 kg/m³. A inclusão do farelo de cacau na ensilagem do capim-elefante mostrou-se eficiente em aumentar o teor de MS da silagem. A inclusão de FC no nível de 7% permitiu produção de silagem com teor de MS semelhante ao da silagem de capim emurchecido. As silagens com FC apresentaram maiores teores de NT, EE, lignina, NIDN e NIDA, no entanto, os teores de FDN, FDA CEL, HEM, cinzas e NDT e a DIVMS diminuíram com a adição de farelo de cacau. O NDT estimado para a silagem de capim emurchecido foi superior ao obtido nas demais silagens, com e sem farelo de cacau. Embora o FC tenha promovido redução da DIVMS, sua inclusão nos níveis de 7 e 14% proporcionou boa digestibilidade das silagens (acima de 60%. O emurchecimento do capim-elefante e a adição de FC podem ser alternativas para aumentar o teor de MS da silagem e garantir a produção de silagens de bom valor nutritivo.The experiment was carried out to evaluate the nutritive value of elephant grass silage wilted under the sun light for eight hours. Other treatments involved the same elephant grass without exposing to sun light but with addition of 0, 7, 14, 21, and 28% of cocoa meal (CM at the ensilage process. The PVC silos used in the experiment measured 0.15 m of diameter and 0.30 m of height. During the ensiling process the forage was compressed until
2010-10-01
... of the Service Contract Act to Contracts for Certain Services-Certification. 52.222-52 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Certification. As... Contract Act to Contracts for Certain Services—Certification (NOV 2007) (a) The offeror shall check the...
2010-10-01
... of the Service Contract Act to Contracts for Certain Services-Requirements. 52.222-53 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Requirements. As... Act to Contracts for Certain Services—Requirements (FEB 2009) (a) The services under this contract are...
Directory of Open Access Journals (Sweden)
Benito VEGA
1999-05-01
Full Text Available Staphylococcus aureus binds Immunoglobulin G (IgG on its external surface due to the presence of specific receptors for the Fc domain of this immunoglobulin. This mechanism represents a kind of camouflage against phagocytic cells. In order to confirm that possibility an in vitro evaluation of the phagocytic activity of leukocytes polymorpho-nuclear (PMN against strains of Staphylococcus aureus was done, comparing 18 strains isolated from clinical samples and 16 from healthy individuals. The presence of Fc receptors was evaluated by haemagglutination (HA with erythrocytes group A after incubation of the strains with IgG anti blood group A. Phagocytosis of S. aureus was carried out by mixing live bacteria with a suspension of human PMN and incubating at 37 °C for 1 h; survivors were counted as colony forming units by plating. The strains from clinical specimens showed higher HA than those from healthy individuals (p = 0.01; but the former were killed more efficiently than the latter (80-90% and 40%, respectively. It is may be possible that S. aureus showed different behavior in vivo, where could express other virulence factors to prevent the action of phagocytes.Staphylococcus aureus liga inmunoglobulinas G (IgG a su superficie externa debido a la presencia de receptores para el dominio Fc de esas inmunoglobulinas. Este mecanismo representa una clase de camuflage contra células fagocíticas. Para confirmar tal posibilidad se realizó una evaluación in vitro de la actividad fagocítica de leucocitos polimorfonucleares (PMN contra cepas de Staphylococcus aureus, comparando 18 cepas aisladas de casos clínicos y 16 de individuos sanos. La presencia de receptores fue evaluada por hemaglutinación (HA con eritrocitos grupo A luego que las cepas fueron incubadas con IgG anti grupo sanguíneo A. La fagocitosis de S. aureus fue realizada mezclando células vivas con una suspensión de PMN e incubada a 37 °C por una hora; las bacterias sobrevivientes
Condutividade e teste quantitativo coulométrico na triagem neonatal para fibrose cística
Directory of Open Access Journals (Sweden)
Mouseline Torquato Domingos
2015-12-01
Full Text Available Resumo Objetivo Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém0nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos O teste do suor foi feito simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60 mmol/L. Resultados Fizeram o teste do suor por condutividade e dosagem coulométrica simultaneamente 444 RN sem FC (185 do sexo masculino, 234 do feminino e 24 não informado e obtiveram resultado mediano de 32 mmol/L e 12 mmol/L respectivamente. Para os noventa RN com FC os valores medianos de condutividade e dosagem coulométrica foram 108 mmol/L e 97 mmol/L respectivamente. O índice de falso positivo para condutividade foi de 16,7% e em todos os pacientes FC foi superior a 50 mmol/L, o que confere ao método 100% de sensibilidade (IC 95% = 93,8 a 97,8, especificidade de 96,2% (IC 95% = 93,8 a 97,8, valor preditivo positivo 83,3 (IC 95% = 74,4 a 91,1, valor preditivo negativo 100% (IC 95% = 90,5 a 109,4 e acurácia 9,8%. A correlação entre os métodos foi de r = 0,97 (p > 0,001.O melhor valor de corte sugerido foi de 69,0 mmol/L, coeficiente de kappa = 0,89. Conclusão O teste da condutividade apresentou excelente correlação com o quantitativo coulométrico, alta sensibilidade e especificidade e pode ser usado no diagnóstico da FC em crianças detectadas pela triagem neonatal.
Directory of Open Access Journals (Sweden)
Andrea Silveira da Fontoura
2004-08-01
Full Text Available A treinabilidade da força em crianças tem sido bem explorada, mas ainda existe um questionamento a respeito de como a força diminui quando elas param de treinar. O objetivo deste estudo foi avaliar o efeito de 12 semanas de destreino na força muscular de meninos treinados por 12 semanas. Sete meninos pré-púberes (EX, 9,4 ± 1,6 anos treinaram três séries de 15 repetições, três vezes por semana, por 12 semanas. O treinamento foi supervisionado e desenvolvido em equipamentos; consistiu de oito exercícios, incluindo extensão de joelhos (EJ e flexão de cotovelos (FC. O teste de 1-RM de EJ e FC foi feito antes e após o treinamento e após 12 semanas de destreinamento. Um grupo similar de meninos (n = 7, 9,7 ± 1,7 anos, que não treinou, serviu como grupo controle (CO. Após o treinamento o grupo EX aumentou (p 0,05. Quando corrigida pelo peso corporal e pela massa corporal magra (MCM, 1-RM de EJ diminuiu significativamente (p El entrenamiento de la fuerza en niños ha sido bien explorada, mas existe en la actualidad un cuestionamiento al respecto de como la fuerza disminuye cuando los mismos paran de entrenar. El objetivo de este estudio fue evaluar el efecto del desentrenamiento de 12 semanas sobre la fuerza muscular en niños entrenados por 12 semanas. Siete niños pre-púberes (EX, 9,4 ± 1,6 años entrenaron tres series de 15 repeticiones, tres veces por semana, por 12 semanas. El entrenamiento fué supervisado y desarrollado en equipamientos, consistió de ocho ejercicios, incluyendo extensión de los codos (EJ y la flexión de las rodillas (FC. El test de 1-RM de EJ y FC fué hecho antes y después del entrenamiento y después de 12 semanas de desentrenamiento. Un grupo similar de niños (n = 7, 9,7 ± 1,7 años, que no entrenó sirvió como grupo control (CO. Después del entrenamiento el grupo EX aumentó (p 0,05. Cuando fue corregido por el peso corporal y por la masa corporal magra (MCM, 1-RM de EJ disminuy
FC-TLBO: fully constrained meta-heuristic algorithm for abundance ...
Indian Academy of Sciences (India)
Omprakash Tembhurne
hyperspectral unmixing; meta-heuristic approach; teaching-learning-based optimisation (TLBO). 1. ... area of research due to its real-time applications. Satellite .... describes the detailed methodology of proposed FC-TLBO. Section 4 contains ...
26 CFR 1.471-10 - Applicability of long-term contract methods.
2010-04-01
... 26 Internal Revenue 6 2010-04-01 2010-04-01 false Applicability of long-term contract methods. 1... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Inventories § 1.471-10 Applicability of long-term contract methods. See § 1.460-2 for rules providing for the application of the long-term contract methods to...
Optimization on Fc for Improvement of Stability and Aggregation Resistance.
Chen, Xiaobo; Zeng, Fang; Huang, Tao; Cheng, Liang; Liu, Huan; Gong, Rui
2016-01-01
Fc-based therapeutics including therapeutic full-size monoclonal antibodies (mAbs) and Fcfusion proteins represent fastest-growing market in biopharmaceutical industrial. However, one major challenge during development of Fc-based therapeutics is how to maintain their efficacy in clinic use. Many factors may lead to failure in final marketing. For example, the stability and aggregation resistance might not be high enough for bearing the disadvantages during fermentation, purification, formulation, storage, shipment and other steps in manufacture and sale. Low stability and high aggregation tendency lead to decreased bioactivity and increased risk of immunogenicity resulting in serious side effect. Because Fc is one of the major parts in monoclonal antibodies and Fc-fusion proteins, engineering of Fc to increase its stability and reduce or eliminate aggregation due to incorrect association are of great importance and could further extend the potential of Fc-based therapeutics. Lots of studies focus on Fc optimization for better physical and chemical characteristics and function by structured-based computer-aid rational design, high-throughput screening expression system selection and other methods. The identification of optimized Fc mutants increases the clinic potential of currently existed therapeutics mAbs and Fc-fusion proteins, and accelerates the development of new Fc-based therapeutics. Here we provide an overview of the related field, and discuss recent advances and future directions in optimization of Fc-based therapeutics with modified stability and aggregation resistance. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Fc-Binding Ligands of Immunoglobulin G: An Overview of High Affinity Proteins and Peptides
Directory of Open Access Journals (Sweden)
Weonu Choe
2016-12-01
Full Text Available The rapidly increasing application of antibodies has inspired the development of several novel methods to isolate and target antibodies using smart biomaterials that mimic the binding of Fc-receptors to antibodies. The Fc-binding domain of antibodies is the primary binding site for e.g., effector proteins and secondary antibodies, whereas antigens bind to the Fab region. Protein A, G, and L, surface proteins expressed by pathogenic bacteria, are well known to bind immunoglobulin and have been widely exploited in antibody purification strategies. Several difficulties are encountered when bacterial proteins are used in antibody research and application. One of the major obstacles hampering the use of bacterial proteins is sample contamination with trace amounts of these proteins, which can invoke an immune response in the host. Many research groups actively develop synthetic ligands that are able to selectively and strongly bind to antibodies. Among the reported ligands, peptides that bind to the Fc-domain of antibodies are attractive tools in antibody research. Besides their use as high affinity ligands in antibody purification chromatography, Fc-binding peptides are applied e.g., to localize antibodies on nanomaterials and to increase the half-life of proteins in serum. In this review, recent developments of Fc-binding peptides are presented and their binding characteristics and diverse applications are discussed.
Directory of Open Access Journals (Sweden)
Janio Morais Santurio
1998-03-01
Full Text Available Este trabalho foi realizado durante o verão de 1995/96 com o objetivo de determinar o nível de aflatoxinas (AFL capaz de causar prejuízos no desempenho de perus de corte criados sob condições ambientais de baixo desafio, bem como avaliar a eficácia da adição de bentonita sódica natural (BSN como um adsorvente. Foram utilizados 1008 perus de corte, alojados em 84 boxes seguindo um delineamento experimental de blocos casualizados com 14 tratamentos distribuídos em um arranjo fatorial 7x2, sendo 7 níveis de adição de AFL, (0, 10, 50, 100, 500, 1000 e 2000ppb e 2 níveis de adição de BSN (0 e 0,5%. Aos 21 dias de idade, as aves alimentadas com as dietas sem adição de BSN mostraram uma redução significativa (PThis experiment was carried out in the 1995/96 summer to determine the aflatoxin (AFL levels ability to decrease turkey performance raised under excellent environmental conditions and also to avaluate a natural sodium bentonite (NSB efficiency as an adsorbent. One thousand and eight poults were housed in 84 floor pens following a randomized complete block design with 14 treatments arranged in a 7x2 factorial, with 7 AFL levels (0, 10, 50, 100, 500, 1000 and 2000ppb and 2 NSB levels (0 and 0.5%. At 21 days of age the birds fed without NSB showed body weight gain (BWG and feed intake (FI reduction (P<0.05 from 500ppb or more of AFL, whereas the birds fed with NSB showed BWG and FI reduction (P<0.05 only from 1000ppb or more of AFL. These same results were observed at 40 days of age, but at 70 days, the BWG and FI reduction was statistically significant (P<0.05 from 500ppb or more of AFL, with or without NSB inclusion. In general, birds fed with NSB had about 15 to 20% less BWG and FI reduction than birds fed without NSB. The feed conversion (FC was less affected by AFL levels, although it worsened with increasing AFL levels. AFL have greatly affected the mortality rate. At 21 days of age the birds fed with 1000 and 2000pbb of
Quantitative application study on the control system of contract progress
International Nuclear Information System (INIS)
Hu Xiaocong; Kang Rujie; Zhan Li
2012-01-01
Quantitative application study on the control system of contract progress, which is based on project management theory and PDCA cycle methods, provides a new way for the contract business management of enterprise, in line with the current situation and the nuclear power enterprise performance management needs. The concept of the system, system development, program design and development of ERP (VBA design) which come from the work experience summary of business managers are convenient and feasible in practical applications. By way of the applications in 2009, 2010, 2011 three-year overhaul contract management and continuous adjustment it has become an important business management tool, which not only effectively guaranteed the contract time and efficiency, but also combines the performance management and contract progress management. This study has provided useful reference for the enterprise management. (authors)
International Nuclear Information System (INIS)
Fink-Bennett, D.; De Ridder, P.; Kolozsi, W.; Gordon, R.; Rapp, J.
1984-01-01
To determine if CCK FC can aid in the diagnosis (Dx.) of ABD, the authors retrospectively analyzed the max. gallbladder (GB) ejection fraction response (EFR) to CCK in 240 patients (pts.) with persistent symptoms of biliary colic, a normal GB Ultrasound exam and/or OCG. Each pt. (NPO after 12 A.M.) received 5 mCi of technetium (Tc)-99 Hepatolite. After max GB filling, .02 μg/kg CCK was administered (1-3 minutes) I.V. Background corrected GB EFs were determined q.5 min x4 by ratioing the pre-CCK GB cts. minus post-CCK GB cts. to pre-CCK GB cts. In 131/240 pts. the max. GBEFR was 35%. Eleven underwent surgery, 98 medical Rx. 4/11 Cx. apts had CAC, 7 were normal. Of the 98 medical Rx. pts. 21 lack followup, 71 are clinically felt not to have ABD; 6 are felt to have ABD. CCK FC appears to be a useful test for the detection of ABD. Its predictive value (GBEF <35%) in Cx. pts. is 97%; in all pts. (assuming medical Rx. correct), 94% (sensitivity - 91%, specificity - 93%)
Generation and Characterization of an IgG4 Monomeric Fc Platform.
Directory of Open Access Journals (Sweden)
Lu Shan
Full Text Available The immunoglobulin Fc region is a homodimer consisted of two sets of CH2 and CH3 domains and has been exploited to generate two-arm protein fusions with high expression yields, simplified purification processes and extended serum half-life. However, attempts to generate one-arm fusion proteins with monomeric Fc, with one set of CH2 and CH3 domains, are often plagued with challenges such as weakened binding to FcRn or partial monomer formation. Here, we demonstrate the generation of a stable IgG4 Fc monomer with a unique combination of mutations at the CH3-CH3 interface using rational design combined with in vitro evolution methodologies. In addition to size-exclusion chromatography and analytical ultracentrifugation, we used multi-angle light scattering (MALS to show that the engineered Fc monomer exhibits excellent monodispersity. Furthermore, crystal structure analysis (PDB ID: 5HVW reveals monomeric properties supported by disrupted interactions at the CH3-CH3 interface. Monomeric Fc fusions with Fab or scFv achieved FcRn binding and serum half-life comparable to wildtype IgG. These results demonstrate that this monomeric IgG4 Fc is a promising therapeutic platform to extend the serum half-life of proteins in a monovalent format.
Directory of Open Access Journals (Sweden)
Peter Bitencourt Faria
2008-02-01
Full Text Available O total de 20 carcaças resfriadas (10 Marrecos Pequim Branco e 10 de frangos de corte foi submetido às análises de composição centesimal, colesterol, cor (sistema CIE L*a*b*, perda de peso por cozimento (PPC e força de cisalhamento (FC. A carne de marreco apresenta (PTwenty refrigerated carcasses (10 Peking mallard and 10 broiler chicken were submitted to analyses of chemical composition, cholesterol, colour (CIE L*a*b* system, weight loss by cooking (PPC and shear force (FC. Mallard meat had lower (P<0.05 humidity in both leg and breast (71.77 and 74.53%, respectively when compared with chicken meat (74.73 and 76.07%, respectively. When different cuts were compared, the breast had a higher (P<0.05 humidity and protein content than the leg in both species. Mallard leg and breast had lower (P<0.05 lightness (37.59 and 35.75, respectively and higher red content (18.48 and 20.67, respectively, than the lightness (40.98 and 45.18, respectively and red content (10.02 and 5.52, respectively observed in chicken. The FC was higher (P<0.05 in mallard breast (4.90 kgf than in chicken breast (2.63 kgf. Meat from White Peking mallard is darker and with a stronger red pigment than meat from broiler chicken. Even though it is less tender than meat from broiler chicken, mallard meat still has an acceptable tenderness.
High Efficiency Advanced Lightweight Fuel Cell (HEAL-FC), Phase I
National Aeronautics and Space Administration — Infinity's High Efficiency Advanced Lightweight Fuel Cell (HEAL FC) is an improved version of its current fuel cell technology developed for space applications. The...
Analytical FcRn affinity chromatography for functional characterization of monoclonal antibodies
Schlothauer, Tilman; Rueger, Petra; Stracke, Jan Olaf; Hertenberger, Hubert; Fingas, Felix; Kling, Lothar; Emrich, Thomas; Drabner, Georg; Seeber, Stefan; Auer, Johannes; Koch, Stefan; Papadimitriou, Apollon
2013-01-01
The neonatal Fc receptor (FcRn) is important for the metabolic fate of IgG antibodies in vivo. Analysis of the interaction between FcRn and IgG in vitro might provide insight into the structural and functional integrity of therapeutic IgG that may affect pharmacokinetics (PK) in vivo. We developed a standardized pH gradient FcRn affinity liquid chromatography method with conditions closely resembling the physiological mechanism of interaction between IgG and FcRn. This method allows the separation of molecular IgG isoforms, degradation products and engineered molecules based on their affinity to FcRn. Human FcRn was immobilized on the column and a linear pH gradient from pH 5.5 to 8.8 was applied. FcRn chromatography was used in comparison to surface plasmon resonance to characterize different monoclonal IgG preparations, e.g., oxidized or aggregated species. Wild-type and engineered IgGs were compared in vitro by FcRn chromatography and in vivo by PK studies in huFcRn transgenic mice. Analytical FcRn chromatography allows differentiation of IgG samples and variants by peak pattern and retention time profile. The method can distinguish: 1) IgGs with different Fabs, 2) oxidized from native IgG, 3) aggregates from monomer and 4) antibodies with mutations in the Fc part from wild-type IgGs. Changes in the FcRn chromatographic behavior of mutant IgGs relative to the wild-type IgG correlate to changes in the PK profile in the FcRn transgenic mice. These results demonstrate that FcRn affinity chromatography is a useful new method for the assessment of IgG integrity. PMID:23765230
International Nuclear Information System (INIS)
Yang, Hong-Ming; Bao, Ru-Meng; Yu, Chang-Mei; Lv, Yan-Na; Zhang, Wei-Fen; Tang, Jin-Bao
2017-01-01
The development of a site-specific and covalent attachment methodology is crucial for antibody–biotin conjugates to preserve the antigen-binding ability of antibodies and yield homogeneous products. In this study, an engineered photoactivatable Z-domain variant [an UV-active amino acid benzoylphenylalanine (Bpa) was genetically incorporated into the Z-domain] carrying one biotin molecule (Z_B_p_a–Biotin) was prepared by employing aminoacyl-tRNA synthetase/suppressor tRNA and Avitag/BirA techniques. The site-specific and covalent attachment of IgG–biotin conjugates, viz. photo-biotinylated IgG, was successfully achieved after UV exposure by combining the inherent Fc-binding capability of the Z-domain with the formation of covalent bond by the photo-crosslinker. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis assay showed that more than 90% of IgGs conjugated with Z_B_p_a–Biotin molecules suffered 3 h UV irradiation. Further pepsin digestion analysis confirmed that the Z_B_p_a–Biotin was conjugated to the Fc fragment of IgG without interference. We took the tumor biomarker carcinoembryoic antigen (CEA) as model to evaluate the detection efficiency of the site-specific photo-biotinylated IgG in biosensing application using surface plasmon resonance (SPR) technology. The photo-biotinylated IgG coated surface gave a limit of detection (LOD) of 2 ng mL"-"1, is 5-fold lower than that of the randomly NHS-biotinylated IgG (10 ng mL"-"1). Given that the (strept)avidin–biotin complex is extensively used in immunoassays, the proposed method for biotinylated IgG provides a powerful approach to further expand related applications. - Highlights: • A photoactivable Z_B_p_a–Biotin was fabricated by aaRS/tRNA and Avitag/BirA techniques. • A approach for Fc-specific photo-biotinylated IgG via Z_B_p_a–Biotin was proposed. • The photo-biotinylated IgG was used to fabricate an immunosensor for detecting CEA. • It gave a LOD of 2 ng mL"-"1 CEA
Energy Technology Data Exchange (ETDEWEB)
Yang, Hong-Ming; Bao, Ru-Meng; Yu, Chang-Mei; Lv, Yan-Na; Zhang, Wei-Fen; Tang, Jin-Bao, E-mail: tangjb@wfmc.edu.cn
2017-01-01
The development of a site-specific and covalent attachment methodology is crucial for antibody–biotin conjugates to preserve the antigen-binding ability of antibodies and yield homogeneous products. In this study, an engineered photoactivatable Z-domain variant [an UV-active amino acid benzoylphenylalanine (Bpa) was genetically incorporated into the Z-domain] carrying one biotin molecule (Z{sub Bpa}–Biotin) was prepared by employing aminoacyl-tRNA synthetase/suppressor tRNA and Avitag/BirA techniques. The site-specific and covalent attachment of IgG–biotin conjugates, viz. photo-biotinylated IgG, was successfully achieved after UV exposure by combining the inherent Fc-binding capability of the Z-domain with the formation of covalent bond by the photo-crosslinker. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis assay showed that more than 90% of IgGs conjugated with Z{sub Bpa}–Biotin molecules suffered 3 h UV irradiation. Further pepsin digestion analysis confirmed that the Z{sub Bpa}–Biotin was conjugated to the Fc fragment of IgG without interference. We took the tumor biomarker carcinoembryoic antigen (CEA) as model to evaluate the detection efficiency of the site-specific photo-biotinylated IgG in biosensing application using surface plasmon resonance (SPR) technology. The photo-biotinylated IgG coated surface gave a limit of detection (LOD) of 2 ng mL{sup -1}, is 5-fold lower than that of the randomly NHS-biotinylated IgG (10 ng mL{sup -1}). Given that the (strept)avidin–biotin complex is extensively used in immunoassays, the proposed method for biotinylated IgG provides a powerful approach to further expand related applications. - Highlights: • A photoactivable Z{sub Bpa}–Biotin was fabricated by aaRS/tRNA and Avitag/BirA techniques. • A approach for Fc-specific photo-biotinylated IgG via Z{sub Bpa}–Biotin was proposed. • The photo-biotinylated IgG was used to fabricate an immunosensor for detecting CEA. • It gave a LOD
Uso de óleo essencial de orégano, salinomicina e bacitracina de zinco na dieta de frangos de corte
Directory of Open Access Journals (Sweden)
Patricia Maria Meneghetti Pulici
2014-09-01
Full Text Available O presente trabalho teve como objetivo avaliar dietas com óleo essencial de orégano, associado ou não com salinomicina, como alternativa à bacitracina de zinco sobre o desempenho zootécnico de frangos de corte. Foram utilizados 600 pintos de um dia de idade, machos, da linhagem Cobb® 500, criados até 42 dias de idade em boxes com cama de casca de arroz providos de comedouros tubulares e bebedouros nipple. O delineamento foi inteiramente casualizado, com seis dietas e 10 repetições de 10 aves cada. As dietas experimentais à base de milho e farelo de soja foram: controle positivo – antibiótico (bacitracina de zinco + 0,05% de anticoccidiano (salinomicina, controle negativo – dieta basal (DB sem aditivos, DB + 0,05% de salinomicina e 0,03% de óleo essencial de orégano (Orego-Stim®, DB + 0,03% de óleo essencial de orégano, DB + 0,05% de salinomicina e 0,05% de óleo essencial de orégano, DB + 0,05% de óleo essencial de orégano. Não foi encontrado efeito da utilização do óleo de orégano até 21 dias no desempenho das aves. Nos demais períodos, aos 35 e 42 dias, o desempenho das aves tratadas com 0,03% de óleo essencial de orégano + salinomicina apresentou resultados semelhantes ao controle positivo, levando à conclusão de que a dose de 0,03% de óleo essencial de orégano + salinomicina pode substituir a bacitracina de zinco + salinomicina em dietas para frangos de corte.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Modulating Cytotoxic Effector Functions by Fc Engineering to Improve Cancer Therapy.
Kellner, Christian; Otte, Anna; Cappuzzello, Elisa; Klausz, Katja; Peipp, Matthias
2017-09-01
In the last two decades, monoclonal antibodies have revolutionized the therapy of cancer patients. Although antibody therapy has continuously been improved, still a significant number of patients do not benefit from antibody therapy. Therefore, rational optimization of the antibody molecule by Fc engineering represents a major area of translational research to further improve this potent therapeutic option. Monoclonal antibodies are able to trigger a variety of effector mechanisms. Especially Fc-mediated effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement- dependent cytotoxicity (CDC) are considered important in antibody therapy of cancer. Novel mechanistic insights into the action of monoclonal antibodies allowed the development of various Fc engineering approaches to modulate antibodies' effector functions. Strategies in modifying the Fc glycosylation profile (Fc glyco-engineering) or approaches in engineering the protein backbone (Fc protein engineering) have been intensively evaluated. In the current review, Fc engineering strategies resulting in improved ADCC, ADCP and CDC activity are summarized and discussed.
Comparative studies on Fc receptors for IgG on resting and activated T lymphocytes
International Nuclear Information System (INIS)
Hueckel, C.; Jensen, H.L.; Rychly, J.; Sandor, M.; Erdei, A.; Gergely, J.
1986-01-01
Fc-receptors for IgG (FcγR) on resting (i.e. freshly prepared) and mitogen (Con A) or alloantigen-activated mouse spleen T cells were compared using binding of different markers such as 125 I-labelled immune complexes, 125 I-labelled anti FcγR monoclonal antibody, FITC-labelled aggr. IgG and sheep erythrocytes covered with specific antibody (EA rosetting). C3b receptors were detected by rosetting with sheep erythrocytes covered with antibody and complement (EAC rosetting). The electrophoretic mobility of the cells without or after binding of aggr. IgG was also tested. Differences between resting and activated T cells were found: (1) After activation of T cells by mitogen or alloantigen, a proportion of FcγR-positive cells increased two to four times. (2) FcγR number per FcγR-positive cell seemed to be higher on activated then on resting cells. (3) FcγR-positive resting cells did not shed their FcγR upon incubation at 4 0 C followed by incubation at 37 0 C, but FcγR-positive activated cells shed a remarkable proportion of their FcγR on the same conditions. (4) Binding of aggr. IgG caused a decrease of electrophoretic mobility of activated but not resting cells. (5) FcγR-positive resting cells were also C3b receptor-positive, whereas FcγR-positive activated cells had no detectable C3b receptors. (author)
29 CFR 785.4 - Application to Walsh-Healey Public Contracts Act.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Application to Walsh-Healey Public Contracts Act. 785.4... Considerations § 785.4 Application to Walsh-Healey Public Contracts Act. The principles set forth in this part... employees performing work subject to the provisions of the Walsh-Healey Public Contracts Act. [35 FR 15289...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AY04 (Link to dictyBase) - - - Contig-U16521-1 FC-AY04Z (Li...nk to Original site) - - FC-AY04Z 583 - - - - Show FC-AY04 Library FC (Link to library) Clone ID FC-AY04 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16521-1 Original site URL http://dict...10 4 CA753827 |AF402814_1 ( AF402814 ) 40S ribosomal protein S6 [Ictalurus puncta...0.00 m_ : 1.00 92.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-AY04 is cyt 5' e
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AK01 (Link to dictyBase) - - - Contig-U15038-1 FC-AK01E (Li...nk to Original site) - - - - - - FC-AK01E 996 Show FC-AK01 Library FC (Link to library) Clone ID FC-AK01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15038-1 Original site URL http://dict...s clone omyk-evn... 172 6e-79 AF401557_1( AF401557 |pid:none) Ictalurus punctatus...reticulum 4.0 %: vacuolar >> prediction for FC-AK01 is mit 5' end seq. ID - 5' end seq. - Length of 5' end s
Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective
Directory of Open Access Journals (Sweden)
Younes Soualhi
2015-12-01
Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.
Gasoline Biodesulfurization DE-FC07-97ID13570 FINAL REPORT; FINAL
International Nuclear Information System (INIS)
Pienkos, Philip T.
2002-01-01
Nine strains were identified to grow with gasoline as sole sulfur source. Two different genes were cloned from Gordonia terrae KGB1 and tested for the ability to support gasoline BDS. The first of these, fmoA, was cloned by screening a KGB1 gene library for the ability to convert indole to indigo (a sulfur-regulated capability in KGB1). The fmoA gene was overexpressed in a gasoline tolerant strain of Pseudomonas putida PpG1 and the recombinant strain was shown to convert thiophene to a dimer of thiophene sulfoxide at rates nearly two orders of magnitude higher than KGB1 could catalyze the reaction. Despite this high activity the recombinant PpG1 was unable to demonstrate any activity against gasoline either in shake flask or in bench-scale gasoline BDS bioreactor. A second gene (toeA) was cloned from KGB1 and shown to support growth of Rhodococcus erythropolis JB55 on gasoline. The toeA gene was also identified in another gasoline strain T. wratislaviensis EMT4, and was identified as a homolog of dszA from R. erythropolis IGTS8. Expression of this gene in JB55 supported conversion of DBTO2 (the natural substrate for DszA) to HPBS, but activity against gasoline was low and BDS results were inconsistent. It appeared that activity was directed against C2- and C3-thiophenes. Efforts to increase gene expression by plasmid manipulation, by addition of flavin reductase genes, or by expression in PpG1 were unsuccessful. The DszC protein (DBT monooxygenase) from IGTS8 has very little activity against the sulfur compounds in gasoline, but a mutant enzyme with a substitution of phenylalanine for valine at position 261 was shown to have an altered substrate range. This alteration resulted in increased activity against gasoline, with activity towards mainly C3- and C4-thiophenes and benzothiophene. A mutant library of dszB was constructed by RACHITT (W. C. Coco et al., DNA shuffling method for generating highly recombined genes and evolved enzymes. 2001. Nature Biotech. 19
Screening of cardiomyocyte fluorescence during cell contraction by multi-dimensional TCSPC
Chorvat, D., Jr.; Abdulla, S.; Elzwiei, F.; Mateasik, A.; Chorvatova, A.
2008-02-01
Autofluorescence is one of the most versatile non-invasive tools for mapping the metabolic state of living tissues, such as the heart. We present a new approach to the investigation of changes in endogenous fluorescence during cardiomyocyte contraction - by spectrally-resolved, time correlated, single photon counting (TCSPC). Cell contraction is stimulated by external platinum electrodes, incorporated in a home-made bath and triggered by a pulse generator at a frequency of 0.5 Hz (to stabilize sarcoplasmic reticulum loading), or 5 Hz (the rat heart rate). Cell illumination by the laser is synchronized with cell contraction, using TTL logic pulses operated by a stimulator and delayed to study mitochondrial metabolism at maximum contraction (10-110 ms) and/or at steady state (1000-1100 ms at 0.5 Hz). To test the setup, we recorded calcium transients in cells loaded with the Fluo-3 fluorescent probe (excited by 475 nm pulsed picosecond diode laser). We then evaluated recordings of flavin AF (excited by 438 nm pulsed laser) at room and physiological temperatures. Application of the presented approach will shed new insight into metabolic changes in living, contracting myocytes and, therefore, regulation of excitation-contraction coupling and/or ionic homeostasis and, thus, heart excitability.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BF01 (Link to dictyBase) - - - Contig-U15105-1 FC-BF01Z (Li...nk to Original site) - - FC-BF01Z 674 - - - - Show FC-BF01 Library FC (Link to library) Clone ID FC-BF01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 260 3e-68 AJ783868_1( AJ783868 |pid:none...lasmic 8.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-BF01 is cyt 5' end seq. ID - 5' end seq. - L
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BC16 (Link to dictyBase) - - - Contig-U15105-1 FC-BC16Z (Li...nk to Original site) - - FC-BC16Z 620 - - - - Show FC-BC16 Library FC (Link to library) Clone ID FC-BC16 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...4 2e-66 AY961522_1( AY961522 |pid:none) Lysiphlebus testaceipes ribosomal ... 254 2e-66 AF402813_1( AF402813 |pid:none) Ict...hondrial 4.0 %: nuclear >> prediction for FC-BC16 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq
Energy Technology Data Exchange (ETDEWEB)
Picasso B, Cuitlahuac [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Astorga Q, Clemente [Luz y Fuerza del Centro (Mexico)
2003-07-01
In order to increase the services quality in the electrical energy, to improve the process of identification of energy losses, to increase the equipment efficiency, to count on more complete statistics of profiles of load consumptions, among other applications, the Compania de Luz y Fuerza del Centro (LyFC) carries out the modernization in automatization of substations and regional operation centers of distribution networks. The technological base to make these programs requires automating the operative schemes of the substation and distribution centers that supervise the events of the electrical process. In this article the main results of the development and integration of master stations based on PC, that were made in the Instituto de Investigaciones Electricas (IIE) and that have been integrated in the electrical company LyFC are presented. [Spanish] Con el proposito de incrementar la calidad de los servicios en la energia electrica, mejorar el proceso de identificacion de perdidas de energia, aumentar la eficiencia de los equipos, contar con estadisticas mas completas de perfiles de consumos de carga, entre otras aplicaciones, la Compania de Luz y Fuerza del Centro (LyFC) lleva a cabo la modernizacion en automatizacion de subestaciones y centros de operacion regional de redes electricas de distribucion. La base tecnologica para realizar estos programas, requiere de automatizar los esquemas operativos de la subestacion y centros de distribucion que supervisan los eventos del proceso electrico. En este articulo se presentan los principales resultados del desarrollo e integracion de estaciones maestras basadas en PC, que se realizaron en el Instituto de Investigaciones Electricas (IIE) y que se han integrado en la compania electrica LyFC.
Fibrose Cística: Análise da Coorte de 10 Anos de um Programa para Adultos
Directory of Open Access Journals (Sweden)
Paulo de Tarso Roth Dalcin
2011-07-01
Full Text Available Introdução: A fibrose cística (FC que já foi considerada doença da criança é agora doença do adulto e requer programa para adultos. Objetivo: definir características clínicas de uma coorte de 10 anos de um programa para adultos com FC e determinar as características associadas com desfechos clínicos. Métodos: coorte retrospectiva de pacientes com FC (idade ≥ 10 anos atendida pelo Programa para Adultos do Hospital de Clínicas de Porto Alegre, de outubro de 1998 a outubro de 2008. Foram coletados dados demográficos, dados clínicos, status nutricional, função pulmonar, testes laboratoriais e microbiologia do escarro. Foram definidos como desfechos clínicos: sobrevivência, sobrevivência com transplante pulmonar e óbito. Resultados: foram atendidos 94 pacientes pelo programa para adultos. A média de idade foi 24,0±7,4 anos e a média do volume expiratório forçado no primeiro segundo (VEF1 foi 56,4±28,8%. Setenta e sete pacientes foram sobreviventes, 6 sobreviventes com transplante pulmonar e 11 morreram. Na análise univariada, etnia caucasiana (p=0,016, mutação F508del (p=0,04, escore clínico (p<0,001, índice de massa corporal (p<0,001, oxigenoterapia (p<0,001, capacidade vital forçada (p=0,023 e VEF1 (p<0,001 se associaram com os desfechos clínicos. A análise de regressão logística identificou fatores associados com desfecho precário: VEF1 (RC=0,.72, ICI=0,54-0,94, p=0,017 e escore clínico (RC = 0,70, IC=0,50-0,97, p = 0,034. Insuficiência respiratória crônica exacerbada por infecção respiratória aguda foi causa imediata de morte na maioria dos casos. Conclusão: Este estudo descreveu uma coorte de 94 pacientes com FC atendidos por um programa de adultos. VEF1 e escore clinico se associaram com os desfechos clínicos.
Directory of Open Access Journals (Sweden)
Oscar Rodríguez
2012-07-01
Full Text Available En este trabajo se investiga la influencia del espesor de la capa de FeSe0,5Te0,5 en las propiedades cristalinas y superconductoras de las películas depositadas sobre una capa buffer de hierro (Fe en sustratos de MgAl2O4, por el método de deposición por láser pulsado (PLD. El espesor de las capas superconductoras producidas son ~55nm y ~134nm. La película con menor espesor presenta mejores propiedades de textura (crecimiento orientado y una menor rugosidad superficial (RMS; verificadas por difracción de rayos X y AFM respectivamente. Esta misma película presenta una transición marcada al estado superconductor y una mayor temperatura crítica a diferencia de la película de mayor espesor. Se discute el efecto del espesor en las tensiones de la red superconductora.
Directory of Open Access Journals (Sweden)
Vernor Mesén Figueroa
2012-12-01
Full Text Available Un entorno cada vez más dinámico y evolutivo ha dado paso al surgimiento y, por ende, al uso cada vez más frecuente de instrumentos financieros cuya flexibilidad y capacidad de ajuste a las condiciones de mercado permitan a las personas y empresas lograr sus objetivos de operación, inversión y financiamiento. En el contexto antes descrito, los contratos de futuros, opciones, forwards y swaps representan mecanismos cuyas características operativas permiten a sus tenedores el logro de objetivos alternativos tales como la cobertura eficaz de diferentes tipos de riesgos o la obtención de ganancias o pérdidas derivadas de la especulación. El presente artículo pretende reseñar, en forma breve, los mecanismos de operación de los contratos de futuros, opciones, forwards y swaps, para luego enfatizar en los criterios de contabilización que toda entidad o intermediario financiero debe seguir para reconocer los efectos que dichos tipos de contratos tienen sobre su posición financiera, resultados de operación y flujos de efectivo. ABSTRACT A rapidly changing and evolving environment has given rise and increased the use of financial tools whose flexibility and adjusting capabilities to variable market conditions allow individuals and companies to achieve their operating, investment and financial goals. Within this framework, contracts for futures, options, forwards and swaps provide mechanisms with operating characteristics that allow their tenants to achieve alternative objectives such as the effective coverage of different risks or the attaining of profits or losses as a result of speculation. This article attempts to resume the operating mechanisms of futures, options, forwards and swap contracts and then concentrates into the accounting criteria that must be followed by financial intermediaries or entities to recognize the effects such contracts have on their financial position, operational results and cash flow.
HAL/S-FC compiler system specifications
1976-01-01
This document specifies the informational interfaces within the HAL/S-FC compiler, and between the compiler and the external environment. This Compiler System Specification is for the HAL/S-FC compiler and its associated run time facilities which implement the full HAL/S language. The HAL/S-FC compiler is designed to operate stand-alone on any compatible IBM 360/370 computer and within the Software Development Laboratory (SDL) at NASA/JSC, Houston, Texas.
Directory of Open Access Journals (Sweden)
Regynaldo A Sampaio
2008-12-01
Full Text Available Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC e pó de rocha de granito (RG como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC e pó de rocha de granito (RG: T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. O cultivo foi feito em bandeja de poliestireno expandido com células de 3,5 x 3,5 x 5,0 cm. Foram avaliados o diâmetro do coleto, a altura da planta, o índice de velocidade de emergência, a percentagem de emergência e a massa fresca e seca da parte aérea e da raiz. Em praticamente todas as características avaliadas o substrato comercial foi superior aos substratos contendo fibra de coco e pó de rocha. Considerando-se apenas os substratos contendo fibra de coco e pó de rocha, as mudas com melhores características foram obtidas com a mistura de aproximadamente 70% em volume de fibra de coco.A greenhouse experiment was carried out to evaluate the ratio of coconut fiber and rock waste, in the tomato seedling production (cultivar Kada Gigante, in Montes Claros, Brazil. The experimental design was of randomized complete blocks with four replicates. The treatments were composed of a control and six ratios of coconut fiber (FC and rock waste (RG: T1 - Commercial Substrate Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. The cultivation was done in polystyrene trays with cells of 3.5 x 3.5 x 5,0 cm. Stem diameter, seedling height, emergency speed index, emergency percentage, root and aerial part of fresh and dry matter were evaluated. In
2010-08-26
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER10-2268-000] FC Landfill Energy, LLC; Supplemental Notice That Initial Market- Based Rate Filing Includes Request for Blanket... proceeding, of FC Landfill Energy, LLC's application for market-based rate authority, with an accompanying...
Dicty_cDB: FC-IC0102 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available FC-IC (Link to library) FC-IC0102 (Link to dictyBase) - - - Contig-U16527-1 FC-IC01...02F (Link to Original site) FC-IC0102F 434 - - - - - - Show FC-IC0102 Library FC-IC (Link to library) Clone ...ID FC-IC0102 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dict... (bits) Value N AB088483 |AB088483.1 Dictyostelium discoideum gene for gamete and mating-type specific prote...oducing significant alignments: (bits) Value AB088483_1( AB088483 |pid:none) Dictyostelium discoideum gmsA g
Kiyoshi, Masato; Caaveiro, Jose M M; Tada, Minoru; Tamura, Hiroko; Tanaka, Toru; Terao, Yosuke; Morante, Koldo; Harazono, Akira; Hashii, Noritaka; Shibata, Hiroko; Kuroda, Daisuke; Nagatoishi, Satoru; Oe, Seigo; Ide, Teruhiko; Tsumoto, Kouhei; Ishii-Watabe, Akiko
2018-03-02
The N-glycan moiety of IgG-Fc has a significant impact on multifaceted properties of antibodies such as in their effector function, structure, and stability. Numerous studies have been devoted to understanding its biological effect since the exact composition of the Fc N-glycan modulates the magnitude of effector functions such as the antibody-dependent cell mediated cytotoxicity (ADCC), and the complement-dependent cytotoxicity (CDC). To date, systematic analyses of the properties and influence of glycan variants have been of great interest. Understanding the principles on how N-glycosylation modulates those properties is important for the molecular design, manufacturing, process optimization, and quality control of therapeutic antibodies. In this study, we have separated a model therapeutic antibody into three fractions according to the composition of the N-glycan by using a novel FcγRIIIa chromatography column. Notably, Fc galactosylation was a major factor influencing the affinity of IgG-Fc to the FcγRIIIa immobilized on the column. Each antibody fraction was employed for structural, biological, and physicochemical analysis, illustrating the mechanism by which galactose modulates the affinity to FcγRIIIa. In addition, we discuss the benefits of the FcγRIIIa chromatography column to assess the heterogeneity of the N-glycan.
Directory of Open Access Journals (Sweden)
Ary José Rocco Júnior
2015-01-01
Full Text Available 800x600 Em todo o mundo, a chamada Indústria do Esporte vêm experimentando vertiginoso crescimento financeiro. Com isso, o papel das agremiações esportivas adquiriu especial importância dentro da sociedade contemporânea global. A relevância do planejamento estratégico dessas organizações fez crescer a necessidade dos clubes esportivos investirem em estratégias que permitam o seu correto posicionamento no mercado e as suas conquistas no campo esportivo. A implantação e o desenvolvimento de uma cultura organizacional que permita o desenvolvimento de uma identidade do clube que agregue todos os seus stakeholders – atletas, torcedores, patrocinadores, marcas, investidores e outros -, é uma dessas estratégias. A criação estratégica e planejada de valores e princípios organizacionais que equilibrem resultados econômicos, mercadológicos e financeiros, com a performance esportiva, colabora para o desenvolvimento e implantação de uma cultura, que gera receita e traz conquistas no campo esportivo. O objetivo deste artigo é analisar três casos de sucesso – FC Barcelona, da Espanha; Sporting Club de Portugal; e, AFC Ajax, da Holanda -, de organizações esportivas que implantaram estratégias dessa natureza na Europa. Pretendemos, com isso, estimular agremiações esportivas do Brasil a adotarem estratégias semelhantes. Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS24 (Link to dictyBase) - - - Contig-U16209-1 FC-BS24Z (Li...nk to Original site) - - FC-BS24Z 721 - - - - Show FC-BS24 Library FC (Link to library) Clone ID FC-BS24 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...nce. 52 9e-12 4 BQ096846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ict...N SA ;, mRNA sequence. 44 1e-10 4 BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDN
Directory of Open Access Journals (Sweden)
Geon A. Kim
2017-01-01
Full Text Available Soluble human tumor necrosis factor (shTNFRI-Fc and human heme oxygenase 1 (hHO-1 are key regulators for protection against oxidative and inflammatory injury for xenotransplantation. Somatic cells with more than 10 copy numbers of shTNFRI-Fc and hHO-1 were employed in somatic cell nuclear transfer to generate cloned pigs, thereby resulting in seven cloned piglets. However, produced piglets were all dead within 24 hours after birth. Obviously, postnatal death with liver apoptosis was reported in the higher copy number of shTNFRI-Fc and hHO-1 piglets. In liver, the transcript levels of ferritin heavy chain, light chain, transferrin, and inducible nitric oxide synthase were significantly highly expressed compared to those of lower copy number of shTNFRI-Fc and hHO-1 piglets (P<0.05. Also, H2O2 contents were increased, and superoxide dismutase was significantly lower in the higher copy number of shTNFRI-Fc and hHO-1 piglets (P<0.05. These results indicate that TNFRI-Fc and hHO-1 overexpression may apparently induce free iron in the liver and exert oxidative stress by enhancing reactive oxygen species production and block normal postneonatal liver metabolism.
Yang, Hong-Ming; Bao, Ru-Meng; Yu, Chang-Mei; Lv, Yan-Na; Zhang, Wei-Fen; Tang, Jin-Bao
2017-01-01
The development of a site-specific and covalent attachment methodology is crucial for antibody-biotin conjugates to preserve the antigen-binding ability of antibodies and yield homogeneous products. In this study, an engineered photoactivatable Z-domain variant [an UV-active amino acid benzoylphenylalanine (Bpa) was genetically incorporated into the Z-domain] carrying one biotin molecule (Z Bpa -Biotin) was prepared by employing aminoacyl-tRNA synthetase/suppressor tRNA and Avitag/BirA techniques. The site-specific and covalent attachment of IgG-biotin conjugates, viz. photo-biotinylated IgG, was successfully achieved after UV exposure by combining the inherent Fc-binding capability of the Z-domain with the formation of covalent bond by the photo-crosslinker. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis assay showed that more than 90% of IgGs conjugated with Z Bpa -Biotin molecules suffered 3 h UV irradiation. Further pepsin digestion analysis confirmed that the Z Bpa -Biotin was conjugated to the Fc fragment of IgG without interference. We took the tumor biomarker carcinoembryoic antigen (CEA) as model to evaluate the detection efficiency of the site-specific photo-biotinylated IgG in biosensing application using surface plasmon resonance (SPR) technology. The photo-biotinylated IgG coated surface gave a limit of detection (LOD) of 2 ng mL -1 , is 5-fold lower than that of the randomly NHS-biotinylated IgG (10 ng mL -1 ). Given that the (strept)avidin-biotin complex is extensively used in immunoassays, the proposed method for biotinylated IgG provides a powerful approach to further expand related applications. Copyright © 2016 Elsevier B.V. All rights reserved.
Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha
Sampaio,Regynaldo A; Ramos,Sílvio J; Guilherme,Denílson O; Costa,Cândido A da; Fernandes,Luiz Arnaldo
2008-01-01
Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC) e pó de rocha de granito (RG) como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC) e pó de rocha de granito (RG): T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% ...
Directory of Open Access Journals (Sweden)
Robie Allan Bombardelli
2005-03-01
Full Text Available O experimento avaliou o efeito de diferentes graus de moagem dos alimentos sobre o desempenho de larvas de tilápia do Nilo no período de reversão sexual. O delineamento experimental foi inteiramente casualizado com 4 tratamentos e 6 repetições. Os tratamentos foram os graus de moagem dos alimentos em peneira de malhas de 0,25; 0,50; 0,70 e 1,00 mm. Utilizou-se uma ração de modo a atender às necessidades nutricionais da espécie. Foram avaliados peso (PFM, comprimento (CFM, ganho de peso diário (GPD, fator de condição (FC e sobrevivência (S. Os dados foram submetidos à ANOVA e, à análise de regressão em caso de evidência de diferença significativa (P = 0,05. Apenas PFM, GPD e FC apresentaram efeito dos tratamentos, mostrando efeito quadrático (P This work evaluated the effect of different milling degree of feeds on Nile tilapia performance during sex reversal period. A completely randomized design with four treatments and six replicates was utilized. The treatments were the milling degree of feed by 0.25, 0.50, 0.70, and 1.00 mm screen. The diets used fulfilled larvae necessity. Data of weight (W, length (L, daily gain weight (DGW, factor condition (FC and survival (S were evaluated. Data were submitted to ANOVA and regression analysis in case of significant difference were detected (P = 0.05. Only W, DGW and FC presented significant difference between treatments, showing a quadratic effect (P < 0.05 and better results to 0.60, 0.60 and 0.63 mm of feed milling degree, respectively. Diet with milling degree of 0.60 mm screen was recommended to Nile tilapia reversion phase
Discussion on the tropospheric concentrations of FC21
Energy Technology Data Exchange (ETDEWEB)
Crescentini, G.; Mangani, F.; Mastrogiamcomo, A.R.; Cappiello, A.; Bruner, F.
1986-01-01
FC21 tropospheric mixing ratios measured in air samples collected at different locations in the world are presented. Results of a campaign carried out at two locations in the Sahara desert where FC21 and FC11 mixing ratios were simultaneously determined in 180 samples are also shown. Though scattered high values have been found, the average background concentration of FC21 ranged between 0 and 1 pptv. 9 references, 1 figure, 2 tables.
Advanced power conversion based on the Aerocapacitor{trademark}. Final report
Energy Technology Data Exchange (ETDEWEB)
Roark, D.
1997-03-05
This report summarizes work performed under contract No. DE-FC07-94ID13283, {open_quotes}Advanced Power Conversion Based on the Aerocapacitors{trademark}.{close_quotes} Under this contract high power density, high energy density, organic electrolyte Aerocapacitors{trademark} were developed and characterized for power conversion applications. Pilot facilities for manufacturing prototype AA-size Aerocapacitors{trademark} were put in place. The low ESR and good frequency response of these devices show that they are ideal components for high discharge rate and low to moderate frequency (< 10 kHz) applications such as power conversion.
Chung, Amy W; Crispin, Max; Pritchard, Laura; Robinson, Hannah; Gorny, Miroslaw K; Yu, Xiaojie; Bailey-Kellogg, Chris; Ackerman, Margaret E; Scanlan, Chris; Zolla-Pazner, Susan; Alter, Galit
2014-11-13
To determine monoclonal antibody (mAb) features that predict fragment crystalizable (Fc)-mediated effector functions against HIV. Monoclonal antibodies, derived from Chinese hamster ovary cells or Epstein-Barr virus-immortalized mouse heteromyelomas, with specificity to key regions of the HIV envelope including gp120-V2, gp120-V3 loop, gp120-CD4(+) binding site, and gp41-specific antibodies, were functionally profiled to determine the relative contribution of the variable and constant domain features of the antibodies in driving robust Fc-effector functions. Each mAb was assayed for antibody-binding affinity to gp140(SR162), antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP) and for the ability to bind to FcγRIIa, FcγRIIb and FcγRIIIa receptors. Antibody glycan profiles were determined by HPLC. Neither the specificity nor the affinity of the mAbs determined the potency of Fc-effector function. FcγRIIIa binding strongly predicted ADCC and decreased galactose content inversely correlated with ADCP, whereas N-glycolylneuraminic acid-containing structures exhibited enhanced ADCP. Additionally, the bi-antenary glycan arm onto which galactose was added predicted enhanced binding to FcγRIIIa and ADCC activity, independent of the specificity of the mAb. Our studies point to the specific Fc-glycan structures that can selectively promote Fc-effector functions independently of the antibody specificity. Furthermore, we demonstrated antibody glycan structures associated with enhanced ADCP activity, an emerging Fc-effector function that may aid in the control and clearance of HIV infection.
Debt renegotiation with incomplete contract
Directory of Open Access Journals (Sweden)
Paulo de Melo Jorge Neto
2005-09-01
Full Text Available A debt contract usually does not include a provision about renegotiation. The right to seize the borrower’s asset and the rules of this process are usually stipulated in the contract. Such a promise not to renegotiate is not credible since renegotiation can mitigate the dead-weight loss of liquidating insolvent borrowers. Once the initial contract may not consider the renegotiation procedure and renegotiation may occur, this paper investigates why a complete contract is not offered. It shows that the lender does not need to stipulate the renegotiation procedure on the initial contract because he is indifferent about committing or not to the terms of a contract. This indicates that a complete contract gives the lender the same expected return as an incomplete contract, in which the renegotiation process is determined after the occurrence of default.Um contrato de débito geralmente não inclui uma cláusula sobre renegociação. O direito de liquidar os ativos do tomador e as regras do processo são habitualmente estipuladas no contrato. Tal promessa de não renegociar não é crível, já que a renegociação pode mitigar a perda bruta de se liquidar tomadores insolventes. Uma vez que o contrato inicial pode não considerar os procedimentos de renegociação, e esta pode, de fato, vir a ocorrer, este artigo investiga a razão de um contrato completo não ser ofertado. Mostra-se que o emprestador não precisa estipular os procedimentos de renegociação no contrato inicial porque ele é indiferente entre se comprometer ou não aos termos do contrato. Isto indica que um contrato completo dá ao emprestador o mesmo retorno esperado de um contrato incompleto, no qual os procedimentos de renegociação são determinados após a declaração de default.
Traces of pFc' in IVIG interact with human IgG Fc domains and counteract aggregation
Rispens, Theo; Himly, Martin; Ooievaar-de Heer, Pleuni; den Bleker, Tamara H.; Aalberse, Rob C.
2010-01-01
To prevent multimer formation, intravenous immunoglobulin (IVIG) is often treated with traces of pepsin. So far, the mechanism behind this treatment has been unclear. Recently, we reported that human IgG4 binds other IgG molecules via Fc-Fc interactions. Here we show that IVIG treated with traces of
Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge
Konduru, Krishnamurthy; Shurtleff, Amy C.; Bradfute, Steven B.; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo
2016-01-01
Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105−106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support
Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.
Konduru, Krishnamurthy; Shurtleff, Amy C; Bradfute, Steven B; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo
2016-01-01
Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support
Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.
Directory of Open Access Journals (Sweden)
Krishnamurthy Konduru
Full Text Available Ebola virus (EBOV, a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data
Contract Attorneys Course Deskbook. Volume 1
2007-06-21
included in a contract in violation of statutory or regulatory criteria will be read out of a contract. Empresa de Viacao Terceirense, ASBCA No. 49827...for upward and downward revision of the stated contract price upon the occurrence of specified contingencies. See Transportes Especiales de ...4th Infantry Division, Fort Hood Texas, 2002-2005; Assistant Operations Officer/Test Control Officer, Military Entrance Processing Station, Des
Chicken IgY Fc expressed by Eimeria mitis enhances the immunogenicity of E. mitis.
Qin, Mei; Tang, Xinming; Yin, Guangwen; Liu, Xianyong; Suo, Jingxia; Tao, Geru; Ei-Ashram, Saeed; Li, Yuan; Suo, Xun
2016-03-21
Eimeria species are obligate intracellular apicomplexan parasites, causing great economic losses in the poultry industry. Currently wild-and attenuated- type anticoccidial vaccines are used to control coccidiosis. However, their use in fast growing broilers is limited by vaccination side effects caused by medium and/or low immunogenic Eimeria spp. There is, therefore, a need for a vaccine with high immunogenicity for broilers. The avian yolk sac IgY Fc is the avian counterpart of the mammalian IgG Fc, which enhances immunogenicity of Fc-fusion proteins. Here, we developed a stable transgenic Eimeria mitis expressing IgY Fc (Emi.chFc) and investigated whether the avian IgY Fc fragment enhances the immunogenicity of E. mitis. Two-week-old broilers were immunized with either Emi.chFc or wild type Eimeria and challenged with wild type E. mitis to analyze the protective properties of transgenic Emi.chFc. Chickens immunized with Emi.chFc had significantly lower oocyst output, in comparison with PBS, mock control (transgenic E. mitis expressing HA1 from H9N2 avian influenza virus) and wildtype E. mitis immunized groups after challenge, indicating that IgY Fc enhanced the immunogenicity of E. mitis. Our findings suggest that IgY Fc-expressing Eimeria may be a better coccidiosis vaccine, and transgenic Eimeria expressing Fc-fused exogenous antigens may be used as a novel vaccine-delivery vehicle against a wide variety of pathogens.
Directory of Open Access Journals (Sweden)
Xavier Planes i Fontestad
2015-08-01
Full Text Available El estudio se centra en la relevancia de las fases dinámicas y estáticas en los rendimientos del FC Barcelona y Real Madrid. Utilizamos la metodología observacional con el fin de tratar de asociar los diferentes Momentos o Fases del juego (MJ y las Acciones a Balón Parado (ABP con la obtención de cada uno de los goles. Para conseguirlo, hemos creado un instrumento de observación ad hoc (IOX y hemos utilizado dos instrumentos de registro (LINCE y MOTS. Para el análisis de los datos del registro y la obtención de resultados, hemos utilizado las técnicas de comparación de proporciones con el software Statgraphics, habiendo encontrado, inicialmente, diferencias significativas entre los dos equipos únicamente en la fase defensiva.
On the application of copula in modeling maintenance contract
International Nuclear Information System (INIS)
Iskandar, B P; Husniah, H
2016-01-01
This paper deals with the application of copula in maintenance contracts for a nonrepayable item. Failures of the item are modeled using a two dimensional approach where age and usage of the item and this requires a bi-variate distribution to modelling failures. When the item fails then corrective maintenance (CM) is minimally repaired. CM can be outsourced to an external agent or done in house. The decision problem for the owner is to find the maximum total profit whilst for the agent is to determine the optimal price of the contract. We obtain the mathematical models of the decision problems for the owner as well as the agent using a Nash game theory formulation. (paper)
Rapid polyclonal desensitization with antibodies to IgE and FcεRIα.
Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Lewkowich, Ian; Morris, Suzanne C; Finkelman, Fred D
2013-06-01
Rapid desensitization, a procedure in which persons allergic to an antigen are treated at short intervals with increasing doses of that antigen until they tolerate a large dose, is an effective, but risky, way to induce temporary tolerance. We wanted to determine whether this approach can be adapted to suppress all IgE-mediated allergies in mice by injecting serially increasing doses of monoclonal antibodies (mAbs) to IgE or FcεRIα. Active and passive models of antigen- and anti-IgE mAb-induced IgE-mediated anaphylaxis were used. Mice were desensitized with serially increasing doses of anti-IgE mAb, anti-FcεRIα mAb, or antigen. Development of shock (hypothermia), histamine and mast cell protease release, cytokine secretion, calcium flux, and changes in cell number and FcεRI and IgE expression were evaluated. Rapid desensitization with anti-IgE mAb suppressed IgE-mediated immediate hypersensitivity; however, some mice developed mild anaphylaxis during desensitization. Rapid desensitization with anti-FcεRIα mAb that only binds FcεRI that is not occupied by IgE suppressed both active and passive IgE-mediated anaphylaxis without inducing disease. It quickly, but temporarily, suppressed IgE-mediated anaphylaxis by decreasing mast cell signaling through FcεRI, then slowly induced longer lasting mast cell unresponsiveness by removing membrane FcεRI. Rapid desensitization with anti-FcεRIα mAb was safer and longer lasting than rapid desensitization with antigen. A rapid desensitization approach with anti-FcεRIα mAb safely desensitizes mice to IgE-mediated anaphylaxis by inducing mast cell anergy and later removing all mast cell IgE. Rapid desensitization with an anti-human FcεRIα mAb may be able to prevent human IgE-mediated anaphylaxis. Copyright © 2013 American Academy of Allergy, Asthma & Immunology. Published by Mosby, Inc. All rights reserved.
48 CFR 52.233-4 - Applicable Law for Breach of Contract Claim.
2010-10-01
... Provisions and Clauses 52.233-4 Applicable Law for Breach of Contract Claim. As prescribed in 33.215(b), insert the following clause: Applicable Law for Breach of Contract Claim (OCT 2004) United States law... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Applicable Law for Breach...
CONSIDERATION ON THE LEGAL REGIME APPLICABLE TO INTERNATIONAL TOURISM CONTRACTS
Directory of Open Access Journals (Sweden)
Serban-Alexandru STANESCU
2017-07-01
Full Text Available Upon conclusion of an international tourism contract, the contracting parties - one of which (the beneficiary acts as the consumer – are facing legal difficulties, which are addressed by this study from the perspective of the interference between the national law and the European Union law. Thus, one of the primary issues considered herein is that concerning the determination of the applicable law based on which the rights and obligations of the contracting parties are to be established. Secondly, this study examines the applicable procedural rules in the case where a Romanian court is requested to settle a dispute arising from an international tourism contract. Finally, the study deals with the hypothesis where a dispute arising from such a contract is settled by a foreign court, and in particular with the effects of the judgment given by the foreign court on the territory of Romania. The above mentioned issues are the grounds behind this research on the legal status of international tourism contracts, in addition to the fact that, despite the rich contractual practice in the field under consideration, the amount of specialized literature on this subject is rather limited.
Firm Reorganization : Social Control or Social Contract?
Aalbers, Hendrik Leendert; Dolfsma, Wilfred; Blinde-Leerentveld, Rowan
Firm reorganizations deeply affect employees. Management can reorganize in different ways, focusing on costs or acknowledging the involvement of employees. The latter implies following a social contract that complements incomplete (formal) labor contracts. Little is known about how the way in which
Andreu Alemany, Josep Miquel
2016-01-01
El present treball final de màster realitza una introducció als smart contracts. El treball introdueix el concepte de contracte intel·ligent, els seus usos i alguns exemples existents. Seguidament proporciona les nocions necessàries de les transaccions del protocol Bitcoin per poder implementar un contracte intel·ligent, usant la blockchain que ofereix el protocol. Per últim, s'explica la implementació d'un contracte intel·ligent usant bitcoin: un canal de micropagaments. El presente traba...
Directory of Open Access Journals (Sweden)
Bingchun Zhao
2018-05-01
Full Text Available Epstein–Barr virus (EBV was the first human virus proved to be closely associated with tumor development, such as lymphoma, nasopharyngeal carcinoma, and EBV-associated gastric carcinoma. Despite many efforts to develop prophylactic vaccines against EBV infection and diseases, no candidates have succeeded in effectively blocking EBV infection in clinical trials. Previous investigations showed that EBV gp350 plays a pivotal role in the infection of B-lymphocytes. Nevertheless, using monomeric gp350 proteins as antigens has not been effective in preventing infection. Multimeric forms of the antigen are more potently immunogenic than monomers; however, the multimerization elements used in previous constructs are not approved for human clinical trials. To prepare a much-needed EBV prophylactic vaccine that is potent, safe, and applicable, we constructed an Fc-based form of gp350 to serve as a dimeric antigen. Here, we show that the Fc-based gp350 antigen exhibits dramatically enhanced immunogenicity compared with wild-type gp350 protein. The complete or partial gp350 ectodomain was fused with the mouse IgG2a Fc domain. Fusion with the Fc domain did not impair gp350 folding, binding to a conformation-dependent neutralizing antibody (nAb and binding to its receptor by enzyme-linked immunosorbent assay and surface plasmon resonance. Specific antibody titers against gp350 were notably enhanced by immunization with gp350-Fc dimers compared with gp350 monomers. Furthermore, immunization with gp350-Fc fusion proteins elicited potent nAbs against EBV. Our data strongly suggest that an EBV gp350 vaccine based on Fc fusion proteins may be an efficient candidate to prevent EBV infection in clinical applications.
Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F; Mo, Xiaokui; Byrd, John C; Carson, William E; Butchar, Jonathan P; Tridandapani, Susheela
2016-02-05
The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. © 2016 by The American Society for Biochemistry
Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F.; Mo, Xiaokui; Byrd, John C.; Carson, William E.; Butchar, Jonathan P.; Tridandapani, Susheela
2016-01-01
The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N′,N′-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. PMID:26627823
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT
2010-04-01
...-DETERMINATION AND EDUCATION ASSISTANCE ACT Construction § 900.133 Does the declination process or the Contract... 25 Indians 2 2010-04-01 2010-04-01 false Does the declination process or the Contract Dispute Act apply to construction contract amendments proposed either by an Indian tribe or tribal organization or...
24 CFR 891.595 - HAP contract extension or renewal.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HAP contract extension or renewal... Handicapped-Section 8 Assistance § 891.595 HAP contract extension or renewal. Upon expiration of the term of the HAP contract, HUD and the Borrower may agree (subject to available funds) to extend the term of...
Directory of Open Access Journals (Sweden)
Markus Roucka
2016-12-01
Full Text Available Lectin microarray technology was applied to compare the glycosylation pattern of the monoclonal antibody MB311 expressed in SP2.0 cells to an antibody-dependent cellular cytotoxic effector function (ADCC-optimized variant (MB314. MB314 was generated by a plant expression system that uses genetically modified moss protoplasts (Physcomitrella patens to generate a de-fucosylated version of MB311. In contrast to MB311, no or very low interactions of MB314 with lectins Aspergillus oryzae l-fucose (AOL, Pisum sativum agglutinin (PSA, Lens culinaris agglutinin (LCA, and Aleuria aurantia lectin (AAL were observed. These lectins are specific for mono-/biantennary N-glycans containing a core fucose residue. Importantly, this fucose indicative lectin-binding pattern correlated with increased MB314 binding to CD16 (FcγRIII; receptor for the constant region of an antibody—whose affinity is mediated through core fucosylation—and stronger ADCC. In summary, these results demonstrate that lectin microarrays are useful orthogonal methods during antibody development and for characterization.
Bacteria and viruses modulate FcεRI-dependent mast cell activity
Directory of Open Access Journals (Sweden)
Aleksandra Słodka
2013-03-01
Full Text Available Undoubtedly, mast cells play a central role in allergic processes. Specific allergen cross-linking of IgE bound to the high affinity receptors (FcεRI on the mast cell surface leads to the release of preformed mediators and newly synthesized mediators, i.e. metabolites of arachidonic acid and cytokines. More and more data indicate that bacteria and viruses can influence FcεRI-dependent mast cell activation. Some bacterial and viral components can reduce the surface expression of FcεRI. There are also findings that ligation of Toll-like receptors (TLRs by bacterial or viral antigens can affect IgE-dependent mast cell degranulation and preformed mediator release as well as eicosanoid production. The synergistic interaction of TLR ligands and allergen can also modify cytokine synthesis by mast cells stimulated via FcεRI. Moreover, data suggest that specific IgE for bacterial or viral antigens can influence mast cell activity. What is more, some bacterial and viral components or some endogenous proteins produced during viral infection can act as superantigens by interacting with the VH3 domain of IgE. All these observations indicate that bacterial and viral infections modify the course of allergic diseases by affecting FcεRI-dependent mast cell activation.
Directory of Open Access Journals (Sweden)
Lúcia Beato
2005-08-01
, scheduled for shoulder, clavicle and proximal humerus surgery, who were submitted to posterior brachial plexus block with the aid of a nerve stimulator starting at 1 mA. When adequate muscle contraction was obtained, the current was decreased to 0.5 mA. If the response persisted, 40 mL of 0.5% ropivacaine was injected. The following parameters were evaluated: block onset, analgesia and motor block duration, complications and side effects. RESULTS: Blockade was effective in 20 out of 22 patients, mean onset time was 15.52 min, mean surgical duration was 1.61 h. Mean analgesia duration was 15.85 h and mean motor block duration was 11.16 h. There were no clinical signs or symptoms of toxic effects of local anesthetics and no patient presented side effects. CONCLUSIONS: Posterior brachial plexus block with the aid of nerve stimulator provides effective anesthesia, is very comfortable for patients and easy to perform.
Energy Technology Data Exchange (ETDEWEB)
Fraser, S.D.; Monsberger, M.; Hacker, V. [Graz Univ. of Technology, Graz (Austria). Christian Doppler Laboratory for Fuel Cell Systems; Gubner, A.; Reimer, U. [Forschungszentrum Julich, Julich (Germany)
2007-07-01
Since the late 1980s, numerous FC models have been developed by scientists and engineers worldwide to design, control and optimize fuel cells (FCs) and fuel cell (FC) power systems. However, state-of-the-art FC models have only a small range of applications within the versatile field of FC modelling. As fuel cell technology approaches commercialization, the scientific community is faced with the challenge of providing robust fuel cell models that are compatible with established processes in industrial product development. One such process, known as Hardware in the Loop (HiL), requires real-time modelling capability. HiL is used for developing and testing hardware components by adding the complexity of the related dynamic systems with mathematical representations. Sensors and actuators are used to interface simulated and actual hardware components. As such, real-time fuel cell models are among the key elements in the development of the Generic Fuel Cell Modelling Environment (GenFC) software. Six European partners are developing GenFC under the support of the Sixth European Framework Programme for Research and Technological Development (FP6). GenFC is meant to increase the use of fuel cell modelling for systems design and to enable cost- and time-efficient virtual experiments for optimizing operating parameters. This paper presented an overview of the GenFC software and the GenFC HiL functionality. It was concluded that GenFC is going to be an extendable software tool providing FC modelling techniques and solutions to a wide range of different FC modelling applications. By combining the flexibility of the GenFC software with this HiL-specific functionality, GenFC is going to promote the use of FC model-based HiL technology in FC system development. 9 figs.
fcGENE: a versatile tool for processing and transforming SNP datasets.
Directory of Open Access Journals (Sweden)
Nab Raj Roshyara
Full Text Available Modern analysis of high-dimensional SNP data requires a number of biometrical and statistical methods such as pre-processing, analysis of population structure, association analysis and genotype imputation. Software used for these purposes often rely on specific and incompatible input and output data formats. Therefore extensive data management including multiple format conversions is necessary during analyses.In order to support fast and efficient management and bio-statistical quality control of high-dimensional SNP data, we developed the publically available software fcGENE using C++ object-oriented programming language. This software simplifies and automates the use of different existing analysis packages, especially during the workflow of genotype imputations and corresponding analyses.fcGENE transforms SNP data and imputation results into different formats required for a large variety of analysis packages such as PLINK, SNPTEST, HAPLOVIEW, EIGENSOFT, GenABEL and tools used for genotype imputation such as MaCH, IMPUTE, BEAGLE and others. Data Management tasks like merging, splitting, extracting SNP and pedigree information can be performed. fcGENE also supports a number of bio-statistical quality control processes and quality based filtering processes at SNP- and sample-wise level. The tool also generates templates of commands required to run specific software packages, especially those required for genotype imputation. We demonstrate the functionality of fcGENE by example workflows of SNP data analyses and provide a comprehensive manual of commands, options and applications.We have developed a user-friendly open-source software fcGENE, which comprehensively supports SNP data management, quality control and analysis workflows. Download statistics and corresponding feedbacks indicate that software is highly recognised and extensively applied by the scientific community.
The New Zealand Construction Contracts Amendment Act 2015 - For Better or Worse?
Directory of Open Access Journals (Sweden)
David Finnie
2015-11-01
Full Text Available Adjudication has been statutorily introduced as an alternative dispute resolution method in 14 jurisdictions including New Zealand. Whilst adjudication under the New Zealand Construction Contracts Act 2002 has been hailed a success, further refinements were proposed in the Construction Contracts Amendment Bill first published in 2013. As part of the legislative process, 48 submissions were made to the Commerce Committee. There was general support for most of the amendments, but some parties expressed concerns on some of the changes. A documentary analysis of the Amendment Bills and submissions to the Commerce Committee was made to critically evaluate the changes proposed and establish if they were improvements. The findings show the major changes proposed include (i removing most of the distinctions between the treatment of residential and commercial contracts under the Act, (ii extending the scope of the Act to apply to contracts for certain professional services, (iii removing the distinction between enforcement of payment determinations and of those relating to rights and obligations, and (iv making the enforcement process more efficient. The findings also show that during a period of over two years from when the Bill was first introduced in January 2013, one other significant improvement for retentions to be held in trust was made. A few proposals to further refine the Bill such as the suggestion to mandate retentions to be kepts in a separate trust account were however not accepted. The Construction Contract Amendment Bill (Bill 97-3 was uninanimously passed during the third and final reading in Parliament on 20 October 2015 with most of the amendments coming into force on 1 December 2015, those incorporating professional services on 1 September 2016, and the retention provisions on 31 March 2017. Royal assent was given on 11 October 2015 leading to the enactment of the Construction Contracts Amendment Act 2015.
The New Zealand Construction Contracts Amendment Act 2015 - For Better or Worse?
Directory of Open Access Journals (Sweden)
David Finnie
2015-11-01
Full Text Available Adjudication has been statutorily introduced as an alternative dispute resolution method in 14 jurisdictions including New Zealand. Whilst adjudication under the New Zealand Construction Contracts Act 2002 has been hailed a success, further refinements were proposed in the Construction Contracts Amendment Bill first published in 2013. As part of the legislative process, 48 submissions were made to the Commerce Committee. There was general support for most of the amendments, but some parties expressed concerns on some of the changes. A documentary analysis of the Amendment Bills and submissions to the Commerce Committee was made to critically evaluate the changes proposed and establish if they were improvements. The findings show the major changes proposed include (i removing most of the distinctions between the treatment of residential and commercial contracts under the Act, (ii extending the scope of the Act to apply to contracts for certain professional services, (iii removing the distinction between enforcement of payment determinations and of those relating to rights and obligations, and (iv making the enforcement process more efficient. The findings also show that during a period of over two years from when the Bill was first introduced in January 2013, one other significant improvement for retentions to be held in trust was made. A few proposals to further refine the Bill such as the suggestion to mandate retentions to be kept in a separate trust account were however not accepted. The Construction Contract Amendment Bill (Bill 97-3 was uninanimously passed during the third and final reading in Parliament on 20 October 2015 with most of the amendments coming into force on 1 December 2015, those incorporating professional services on 1 September 2016, and the retention provisions on 31 March 2017. Royal assent was given on 11 October 2015 leading to the enactment of the Construction Contracts Amendment Act 2015.
Pfeiffer, Norbert; Traverso, Carlo E; Lorenz, Katrin; Saarela, Ville; Liinamaa, Johanna; Uusitalo, Hannu; Astakhov, Yury; Boiko, Ernest; Ropo, Auli
2014-12-01
The efficacy, safety and tolerability of the preservative-free (PF) fixed combination (FC) of tafluprost 0.0015% and timolol 0.5% (once daily) were compared to those of the individual components (PF tafluprost 0.0015% once daily and PF timolol 0.5% twice daily) in patients with open-angle glaucoma or ocular hypertension inadequately controlled on prior timolol or prostaglandin monotherapy for 6 months. A stratified, double-masked, randomized, multicenter phase III study was conducted. A total of 189 prior timolol users were randomized within the timolol stratum (TS) to receive either FC (n = 95) or timolol 0.5% (TIM; n = 94). Furthermore, a total of 375 prior prostaglandin analog (PGA) users were randomized within the prostaglandin stratum (PS) to receive either FC (n = 188) or tafluprost 0.0015% (TAF; n = 187). To be eligible for participation in the study, the patients were required to have an intraocular pressure (IOP) of ≥22 mmHg when on timolol (TIM) or of ≥20 mmHg when on PGA in either treated eye at the screening and end-of-run-in visits. In addition to these, the study included visits at baseline, 2 and 6 weeks, 3 and 6 months and at a post-study visit. IOP was measured at 8 a.m., 10 a.m., 4 p.m., and 8 p.m. In the TS, a significant reduction from baseline IOP was seen with FC and TIM throughout the study. Average diurnal IOP change from baseline at month 3 was -8.55 mmHg (32%) for FC and -7.35 mmHg (28%) for TIM. The model-based treatment difference (FC-TIM) was -0.885 mmHg [95% confidence interval (CI) -1.745 to -0.024; p = 0.044] demonstrating the superiority of FC over TIM. In the PS, a significant reduction in IOP was seen with both FC and TAF throughout the study. The average diurnal IOP change from baseline at month 3 was -8.61 mmHg (33%) for FC and -7.23 mmHg (28%) for TAF. The model-based treatment difference (FC-TAF) was -1.516 mmHg (95% CI -2.044 to -0.988; p preservative-free fixed combination of tafluprost and
Directory of Open Access Journals (Sweden)
Roberto Augusto Castellanos
1983-12-01
Full Text Available Foi realizado estudo a fim de comparar o efeito na redução do ataque de cárie de uma solução de fluoreto de sódio, na concentração de 0,5% aplicada sob a forma de bochecho, escovação, escovação e bochecho, uma vez por semana, sob supervisão, durante um período escolar de 10 meses em 424 escolares de 9 a 10 anos de idade matriculados em cinco escolas estaduais do Estado de São Paulo (Brasil. As crianças foram distribuídas igualmente em três grupos experimentais e um grupo controle, de acordo com a idade dental (nº de superfícies de dentes permanentes irrompidas e experiência anterior de cárie (CPO-S. Foram examinadas 307 crianças e os resultados mostraram que houve uma redução, estatisticamente significante ao nível de 0,05, de ataque de cárie entre os grupos experimentais e controle, da ordem de 35,19% para o grupo de bochecho (grupo I, de 37,91% para o grupo de escovação (grupo II, e de 49,77% para o grupo de escovação e bochecho (grupo IV. Quando comparados os grupos experimentais entre si não houve diferenças estatisticamente significantes ao nível de 0,05.A comparative study of the anticariogenic effect of sodium fluoride solution, with a concentration of 0.5%, applied weekly and under supervision, in mouthwashing and toothbrushing, used independently and in combination, was carried out on 424 children of 9 and 10 years of age from five public schools in S. Paulo, Brazil, over a period of 10 school months. The children were equally divided into three experimental groups and one control group according to the dental age (number of erupted permanent teeth surfaces and history of caries (DMF-S. Three hundred and seven children were examined at the end of the study and the results show a statistically significant decrease at the 0.05 level, between the experimental groups and control group, in the incidence of caries - 35.19% for the mouthwashing group (Group I; 37.91% for the toothbrushing group (Group II; and
Directory of Open Access Journals (Sweden)
Elka Maltez de Miranda Moreira
2010-11-01
Full Text Available A Agência Nacional de Vigilância Sanitária (Anvisa é acompanhada pelo Ministério da Saúde mediante contrato de gestão, instrumento de avaliação de desempenho. Realizou-se estudo de caso mediante entrevistas semiestruturadas com atores selecionados e análise documental, objetivando descrever e analisar o modelo de avaliação de desempenho da Anvisa, com vistas à finalidade da instituição, de acordo com as seguintes categorias analíticas: formalização do contrato de gestão, instrumentos de avaliação, sujeito avaliador e desempenho institucional. As entrevistas semiestruturadas e a análise documental indicam que a Anvisa celebrou um contrato de gestão, em 1999, atualizado por quatro termos aditivos. O avaliador interno é representado pela Diretoria Colegiada e Núcleo de Assessoramento à Gestão Estratégica; o avaliador externo, por uma Comissão de Avaliação constituída pelo Ministério da Saúde. Identificaram-se três fases do modelo avaliativo: estruturação do novo modelo de gestão (1999-2000, legitimação ante o segmento produtivo (2001-2004 e ampliação da legitimação (2005. O melhor desempenho ocorreu em 2000 (86,05%, e o pior em 2004 (40,00%. Verificou-se que o modelo de avaliação pouco avançou em direção à finalidade institucional e aferição da efetividade das ações realizadas.The Brazilian National Health Surveillance Agency (Anvisa is supervised by the Ministry of Health by means of a management contract, a performance evaluation tool. This case study was aimed at describing and analyzing Anvisa's performance evaluation model based on the agency's institutional purpose, according to the following analytical categories: the management contract formalization, evaluation tools, evaluators and institutional performance. Semi-structured interviews and document analysis revealed that Anvisa signed only one management contract with the Ministry of Health in 1999, updated by four additive terms. The
POTÊNCIA E CAPACIDADE ANAERÓBIA EM ATLETAS DE KARATE
Directory of Open Access Journals (Sweden)
Keith Sato Urbinati
2011-01-01
Full Text Available O objetivo do presente estudo foi verificar o nível de potência muscular, bem como a intensidade de esforço durante prova de potência e capacidade anaeróbia em atletas de Karate. Participaram do estudo treze karatekas especialistas em prova de kumitê (luta,sexo masculino, idade média de 20,7±3,79 anos. Realizou-se a avaliação de potência e capacidade anaeróbia (Wingate test, com coleta das variáveis fisiológicas:frequência cardíaca (FC, pressão arterial (PA e lactato sanguíneo (LAC de repouso, imediatamente após e em 5 min de recuperação. Para verificar se ocorrem diferenças nas variáveis fisiológicas durante o teste, realizou-se análise de variância, post hoc de Bonferronie (p?0,05. Verificou-se potência de pico(PP de 8,77 ± 0,99 W/kg-1, potência média (PM de 5,13± 0,49 W.kg-1 e % de fadiga de 50,5 ± 6,45%. Para as variáveis fisiológicas,a FC (F=9,79; p=0,00 pós-teste de Wingate foi estatisticamente maior e diferenteda FC de repouso e recuperação. Não foram encontradas diferenças nos níveis pressatórios e nas concentrações de LAC. Em relação aos valores de FC e LAC tais variáveis pós-teste não se apresentaram elevados. Os valores de potência anaeróbia estão de acordo com a necessidade da modalidade esportiva. Assim, verificou-se menores intensidades de esforço em teste de Wingate quando comparados a de situação real de competição. O nível de potência muscular parece estar adequado ao kumitê.
International Nuclear Information System (INIS)
Schwalbe, K.H.; Zerbst, U.; Kim, Y.J.; Brocks, W.; Cornec, A.; Heerens, J.; Amstutz, H.
1998-01-01
EFAM ETM 97 is a document of the GKSS Procedure 'Engineering Flaw Assessment Method (EFAM)'. It describes methods for estimating the crack driving force for cracks in structural components in terms of the crack tip opening displacement, δ 5 , and the J-integral. It consists of several modules covering particular application problems. Appendices to this document provide solutions for the stress intensity factor and the yield load, as well as information on transferability of fracture parameters and on the treatment of bi-axial and mixed mode loadings. A second assessment route is also given in an appendix. (orig.) [de
Klaassen, R. J.; Ouwehand, W. H.; Huizinga, T. W.; Engelfriet, C. P.; von dem Borne, A. E.
1990-01-01
FcRIII is not present on peripheral blood monocytes, but becomes expressed upon culturing and can be demonstrated on tissue macrophages. We studied the expression of FcRIII of cultured monocytes in detail and compared its structure with FcRIII of neutrophils and NK cells. The cell density of FcRIII
Inhibition of Notch signaling by Dll4-Fc promotes reperfusion of acutely ischemic tissues
Energy Technology Data Exchange (ETDEWEB)
Liu, Ren [Department of Pathology, University of Southern California, Los Angeles (United States); Trindade, Alexandre [Centro Interdisciplinar de Investigacao em Sanidade Animal (CIISA), Lisbon Technical University, Lisbon (Portugal); Instituto Gulbenkian de Ciencia, Oeiras (Portugal); Sun, Zhanfeng [Department of Vascular Surgery, 2nd Affiliated Hospital of Harbin Medical University, Harbin, Heilongjiang (China); Kumar, Ram; Weaver, Fred A. [Department of Surgery, University of Southern California, Los Angeles (United States); Krasnoperov, Valery; Naga, Kranthi [Vasgene Therapeutics, Los Angeles, CA (United States); Duarte, Antonio [Centro Interdisciplinar de Investigacao em Sanidade Animal (CIISA), Lisbon Technical University, Lisbon (Portugal); Instituto Gulbenkian de Ciencia, Oeiras (Portugal); Gill, Parkash S., E-mail: parkashg@usc.edu [Department of Pathology, University of Southern California, Los Angeles (United States)
2012-02-03
Highlights: Black-Right-Pointing-Pointer Low dose Dll4-Fc increases vascular proliferation and overall perfusion. Black-Right-Pointing-Pointer Low dose Dll4-Fc helps vascular injury recovery in hindlimb ischemia model. Black-Right-Pointing-Pointer Low dose Dll4-Fc helps vascular injury recovery in skin flap model. Black-Right-Pointing-Pointer Dll4 heterozygous deletion promotes vascular injury recovery. Black-Right-Pointing-Pointer Dll4 overexpression delays vascular injury recovery. -- Abstract: Notch pathway regulates vessel development and maturation. Dll4, a high-affinity ligand for Notch, is expressed predominantly in the arterial endothelium and is induced by hypoxia among other factors. Inhibition of Dll4 has paradoxical effects of reducing the maturation and perfusion in newly forming vessels while increasing the density of vessels. We hypothesized that partial and/or intermittent inhibition of Dll4 may lead to increased vascular response and still allow vascular maturation to occur. Thus tissue perfusion can be restored rapidly, allowing quicker recovery from ischemia or tissue injury. Our studies in two different models (hindlimb ischemia and skin flap) show that inhibition of Dll4 at low dose allows faster recovery from vascular and tissue injury. This opens a new possibility for Dll4 blockade's therapeutic application in promoting recovery from vascular injury and restoring blood supply to ischemic tissues.
Single chain Fc-dimer-human growth hormone fusion protein for improved drug delivery.
Zhou, Li; Wang, Hsuan-Yao; Tong, Shanshan; Okamoto, Curtis T; Shen, Wei-Chiang; Zaro, Jennica L
2017-02-01
Fc fusion protein technology has been successfully used to generate long-acting forms of several protein therapeutics. In this study, a novel Fc-based drug carrier, single chain Fc-dimer (sc(Fc) 2 ), was designed to contain two Fc domains recombinantly linked via a flexible linker. Since the Fc dimeric structure is maintained through the flexible linker, the hinge region was omitted to further stabilize it against proteolysis and reduce FcγR-related effector functions. The resultant sc(Fc) 2 candidate preserved the neonatal Fc receptor (FcRn) binding. sc(Fc) 2 -mediated delivery was then evaluated using a therapeutic protein with a short plasma half-life, human growth hormone (hGH), as the protein drug cargo. This novel carrier protein showed a prolonged in vivo half-life and increased hGH-mediated bioactivity compared to the traditional Fc-based drug carrier. sc(Fc) 2 technology has the potential to greatly advance and expand the use of Fc-technology for improving the pharmacokinetics and bioactivity of protein therapeutics. Copyright © 2016 Elsevier Ltd. All rights reserved.
Goulding, N J; Knight, S M; Godolphin, J L; Guyre, P M
1992-04-01
The therapeutic potential of interferon gamma (IFN gamma) in a number of disease states is still being explored, but progress is hampered by the lack of a suitable measure of in vivo biological activity. To assess the in vivo biological effects of recombinant human IFN gamma (rhIFN gamma), 14 patients were studied in a randomised, prospective, double blind, placebo controlled trial of this cytokine for the treatment of rheumatoid arthritis. The levels of Fc gamma receptors on peripheral blood neutrophils were measured at baseline and after 21 days of once daily, subcutaneous injections of rhIFN gamma or placebo. An induction of neutrophil Fc gamma receptor type I (Fc gamma RI) was seen in the group of patients receiving recombinant human rhIFN gamma but not in those receiving placebo. No change in the expression of Fc gamma RII or Fc gamma RIII was detected. The amount of induction of Fc gamma RI detected on the neutrophils of patients receiving rhIFN gamma did not correlate with clinical measures of response at either 21 days or at the end of the study (24 weeks). No significant clinical responses were observed in the rhIFN gamma group at these times. These data confirm that the reported in vitro effect of IFN gamma on human neutrophil Fc receptor expression can be reproduced in vivo.
Optimal football strategies: AC Milan versus FC Barcelona
Papahristodoulou, Christos
2012-01-01
In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.
Thorn, Mitchell; Piche-Nicholas, Nicole; Stedman, Donald; Davenport, Scott W; Zhang, Ning; Collinge, Mark; Bowman, Christopher J
2012-10-01
There is concern about embryo-fetal exposure to antibody-based biopharmaceuticals based on the increase of such therapies being prescribed to women of childbearing potential. Therefore, there is a desire to better characterize embryo-fetal exposure of these molecules. The pregnant rat is a standard model for evaluating the potential consequences of exposure but placental transfer of antibody-based biopharmaceuticals is not well understood in this model. The relative embryo-fetal distribution of an antibody-based biopharmaceutical was evaluated in the rat. Bevacizumab (Avastin) was chosen as a tool antibody since it does not have significant target binding in the rat that might influence embryo-fetal biodistribution. Avastin was labeled with a fluorescent dye, characterized, and injected into pregnant rats at different gestation ages. Labeled Avastin in fetal tissues was visualized ex vivo using an IVIS 200 (Caliper, A PerkinElmer Company, Alameda, CA). Avastin localized to the fetus as early as 24-hr post intravenous injection of the dam, and was taken up by the fetus in a dose-dependent manner. Avastin was detectable in the developing embryo as early as gestation day 13 and continued to be transferred until the end of gestation. Fetal transfer of Avastins mutated in the portion of the antibody that binds the neonatal Fc receptor (FcRn) was tested in late gestation and was found to correlate with affinities of the mutant Avastin antibody to FcRn. The novel application of this imaging technology was used to characterize the onset and duration of Avastin maternal-fetal transfer in rats and the importance of FcRn binding. © 2012 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Patrícia Schneider
2004-04-01
Full Text Available O objetivo deste estudo foi descrever e comparar as forças musculares isométrica e isocinética em diferentes graus maturacionais de meninos e meninas atletas de voleibol. Participou do estudo um total de 66 crianças e adolescentes saudáveis, em treinamento esportivo competitivo. Dos 37 meninos, 10 eram pré-púberes (PP, 15 púberes (PU e 12 pós-púberes (PO. Das 29 meninas, 11 eram PP, 13 PU e 5 PO. Foi utilizado um dinamômetro computadorizado (Cybex Norm para medir a força isocinética de flexão do cotovelo (FC e de extensão de joelho (EJ nas velocidades de 60 e 90º.s-1. A força isométrica foi medida nos mesmos exercícios nos ângulos de 60 e 90º (FC, e 45 e 60º (EJ. Utilizou-se a ANOVA para comparações entre os gêneros e graus maturacionais, e o teste post hoc de Tuckey. O nível de significância considerado foi de p El objetivo de este estudio fué describir y comparar las fuerzas musculares isométrica e isocinética en diferentes grados maduracionales de niños y niñas atletas de voleibol. Participó del estudio un total de 66 niños y adolescentes, en tratamiento deportivo competitivo. De los 37 niños, 10 eran pre-púberes (PP, 15 púberes (PU y 12 post-púberes (PO. De las 29 niñas, 11 eran PP, 13 PU e 5 PO. Fué utilizado un dinamómetro computarizado (Cybex Norm para medir la fuerza isocinética de flexión de codo (FC y extensión de rodilla (EJ en las velocidades de 60 y 90º.s-1. La fuerza isométrica fue medida en los mismos ejercicios en los ángulos de 60 y 90º (FC, y 45 y 60º (EJ. Se utilizó la ANOVA para comparaciones entre los géneros y grados maduracionales y el test post hoc de Tuckey. El nivel de significancia considerado fue de p The objective of this work was to describe and to compare the isometric and isokinetic muscular strength at different maturational degree of boys and girls volleyball athletes. 66 healthy children and youth participated in the study in a competitive sportive training
Effects of altered FcγR binding on antibody pharmacokinetics in cynomolgus monkeys
Leabman, Maya K; Meng, Y Gloria; Kelley, Robert F; DeForge, Laura E; Cowan, Kyra J; Iyer, Suhasini
2013-01-01
Antibody interactions with Fcγ receptors (FcγRs), like FcγRIIIA, play a critical role in mediating antibody effector functions and thereby contribute significantly to the biologic and therapeutic activity of antibodies. Over the past decade, considerable work has been directed towards production of antibodies with altered binding affinity to FcγRs and evaluation of how the alterations modulate their therapeutic activity. This has been achieved by altering glycosylation status at N297 or by engineering modifications in the crystallizable fragment (Fc) region. While the effects of these modifications on biologic activity and efficacy have been examined, few studies have been conducted to understand their effect on antibody pharmacokinetics (PK). We present here a retrospective analysis in which we characterize the PK of three antibody variants with decreased FcγR binding affinity caused by amino acid substitutions in the Fc region (N297A, N297G, and L234A/L235A) and three antibody variants with increased FcγRIIIA binding affinity caused by afucosylation at N297, and compare their PK to corresponding wild type antibody PK in cynomolgus monkeys. For all antibodies, PK was examined at a dose that was known to be in the linear range. Since production of the N297A and N297G variants in Chinese hamster ovary cells results in aglycosylated antibodies that do not bind to FcγRs, we also examined the effect of expression of an aglycosylated antibody, without sequence change(s), in E. coli. All the variants demonstrated similar PK compared with that of the wild type antibodies, suggesting that, for the six antibodies presented here, altered FcγR binding affinity does not affect PK. PMID:24492343
Fc-receptors and surface immunoglobulins in cells of the hairy cell leukemia
International Nuclear Information System (INIS)
Rieber, E.P.; Linke, R.P.; Riethmueller, G.; Heyden, H.W. von; Waller, H.D.
1976-01-01
Using 125 I-labelled aggregated IgG in a quantitative assay a strong expression of Fc-receptors was found on the leukemic cells of a patient with hairy cell leukemia. The Fc-receptor activity on these cells was much higher than that on monocytes and B-lymphocytes from normal blood. Surface immunoglobulins were detected by radioautography using radioactively labelled (Fab') 2 -fragments of monospecific antibodies directed against immunoglobulin heavy chains. Prior to radioautography the cells were stained for the tartrate resistant acid phosphatase. It is found that all cells containing this enzyme bore delta-chains on their surface. On more than 90% of these cells a simultaneous expression of μ-chains was detected. γ-chains could only be demonstrated on cells which were negative for the tartrate resistant acid phosphatase; part of these cells, however, were hairy cells by morphological criteria. (orig.) [de
Suzuki, Mami; Yamanoi, Ayaka; Machino, Yusuke; Ootsubo, Michiko; Izawa, Ken-ichi; Kohroki, Junya; Masuho, Yasuhiko
2016-01-01
The Fc domain of human IgG1 binds to Fcγ receptors (FcγRs) to induce effector functions such as phagocytosis. There are four interchain disulfide bonds between the H and L chains. In this study, the disulfide bonds within the IgG1 trastuzumab (TRA), which is specific for HER2, were cleaved by mild S-sulfonation or by mild reduction followed by S-alkylation with three different reagents. The cleavage did not change the binding activities of TRA to HER2-bearing SK-BR-3 cells. The binding activities of TRA to FcγRIIA and FcγRIIB were greatly enhanced by modification with mild reduction and S-alkylation with ICH2CONH2 or N-(4-aminophenyl) maleimide, while the binding activities of TRA to FcγRI and FcγRIIIA were decreased by any of the four modifications. However, the interchain disulfide bond cleavage by the different modifications did not change the antibody-dependent cell-mediated phagocytosis (ADCP) of SK-BR-3 cells by activated THP-1 cells. The order of FcγR expression levels on the THP-1 cells was FcγRII > FcγRI > FcγRIII and ADCP was inhibited by blocking antibodies against FcγRI and FcγRII. These results imply that the effect of the interchain disulfide bond cleavage on FcγRs binding and ADCP is dependent on modifications of the cysteine residues and the FcγR isotypes. © The Authors 2015. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.
DEFF Research Database (Denmark)
Jeppesen, Anine; Ditlev, Sisse Bolm; Soroka, Vladyslav
2015-01-01
with severe clinical manifestations, such as cerebral malaria in children and placental malaria in pregnant women. PfEMP1 that can bind the Fc part of IgM (Fcμ) characterizes one such type, although the functional significance of this IgM binding to PfEMP1 remains unclear. In this study, we report...... resemble the rosette-mediating and IgM-binding PfEMP1 HB3VAR06, but none of them mediated formation of rosettes. We could map the capacity for Fc-specific IgM binding to DBLε domains near the C terminus for three of the four PfEMP1 proteins tested. Our study provides new evidence regarding Fc...
Directory of Open Access Journals (Sweden)
Oscar García Pulpeiro
2009-12-01
Full Text Available Se desarrolló por primera vez en Cuba, una formulación de jalea de piroxicam al 0,5 %. Se tomó como referencia la composición de la formulación líder del mercado FELDENE GELâ, a la cual se le efectuaron algunas modificaciones. Se realizaron 4 experimentos en las evaluaciones preliminares que sirvieron de base para la etapa posterior de diseño y optimización de la formulación. Se aplicó un diseño de experimentos con mezcla, para lo cual se emplearon como variables independientes la concentración de Carbopol 940, trietanolamina y hidroxipropilmetilcelulosa. Se evaluó la influencia de estos componentes en el pH, el área de extensibilidad y en algunas propiedades organolépticas. A partir de estos resultados, se seleccionó una formulación óptima.For the first time in Cuba a 0.5 % Piroxican jelly formula was developed. The point of reference was the leader formula from FELEDENE GELâ; market which underwent some modifications. During first assessments four experiments were carried out as basis for the later stage of formula design and optimization. An experimental design with mixture was applied using as independent variables the concentration of Carbopol 940, Trietanolamine, and Hidroxypropyl methylcellulose. Influence of these components on pH, the extensibility area, and on some organoleptic properties. From these results, an optimal formula was selected.
Directory of Open Access Journals (Sweden)
André Carlos Silva Pimentel
2007-04-01
Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramentecasualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre otratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. Anexperiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC andcharacteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up to 13.31%, to improve the feed conversion.
46 CFR 90.05-5 - Specific application noted in text.
2010-10-01
... to which the text pertains, and in many cases limits the application of the text to vessels... 46 Shipping 4 2010-10-01 2010-10-01 false Specific application noted in text. 90.05-5 Section 90... VESSELS GENERAL PROVISIONS Application § 90.05-5 Specific application noted in text. (a) At the beginning...
Silva, Wagner Chagas da
2008-01-01
Apesar de sua eficácia no combate de infecções orais, a pigmentação de dentes e língua associada ao uso de soluções de clorexedina é um dos efeitos adversos que mais desencoraja o uso deste antisséptico por tempo prolongado. O objetivo deste estudo foi analisar o efeito da solução para bochecho contendo 0,12% de clorexidina, 0,05% de cetilpiridínio e 0,05% de fluoreto de sódio, na atividade anti- placa e formação da pigmentação extrínseca dental e da língua. Participara...
Directory of Open Access Journals (Sweden)
J. L. Tuimil
2010-09-01
Full Text Available
Los objetivos de este estudio fueron comparar la frecuencia cardíaca (FC media entre dos tipos de entrenamiento de carga externa equiparada basados en la carrera, la relación de la velocidad aeróbica máxima (VAM con la F.C. de reserva (FCR y los efectos de estos dos tipos de entrenamiento sobre la F.C. basal (FCB. El estudio se llevó a cabo con ocho estudiantes de educación física (23,25 años; VAM: 17,93 Km.h-1 que realizaron dos tipos de entrenamiento: CC =8 km al 70%VAM y CI= 4x(1000m al 90%VAM+1000m al 50% VAM. Se registró la FC durante el entrenamiento y la FCB antes y después del mismo. La diferencia de la FC media entre ambos métodos no fue estadísticamente significativa, sin embargo las medias del CC (FCCC (Z=2,240; p<0,05 y CI (FCCI (Z=2,380; p<0,05 fueron significativamente más elevadas que la calculada al 70% de FCR. La FCB se elevó de forma significativa (Z=2,319; p=0.020 solamente después del entrenamiento CI. En conclusión, dos métodos de entrenamiento distintos, pero de intensidad media similar, pueden dar lugar a una FC media también similar. La intensidad de carrera programada en función de la VAM es significativamente superior a la programada en función de la FCR. El entrenamiento interválico puede tener un mayor efecto sobre el incremento de la FCB.
PALABRAS CLAVE: Frecuencia cardíaca media, frecuencia cardíaca de reserva, frecuencia cardíaca basal, VAM, carrera continua, carrera interválica.
The aims of this study were to compare the mean heart rate response in two training methods of equal average intensity based on running, the relationship of the maximal aerobic speed (VAM with the reserve heart rate (FCR and the effects of these modes of training on the basal heart rate (FCB. The study was carried out with eight physical activity students (23,25 years old; VAM: 17,93 Km.h-1
Estudo do crescimento inicial de plântulas de Cereus jamacaru DC em diferentes substratos
Directory of Open Access Journals (Sweden)
Wanderlucia Silva Rodrigues
2014-12-01
Full Text Available O presente trabalho objetivou avaliar o desenvolvimento de mudas de Cereus jamacaru DC, em substratos a base de fibra de coco e casca de arroz carbonizada. Os tratamentos utilizados foram dispostos em um delineamento inteiramente casualizado constituídos por cinco substratos a base de fibra de coco (FC e casca de arroz carbonizado (CAC, misturados com diferentes proporções volumétricas. Os tratamentos constituíram-se dos substratos 100% FC (T1, 100% CAC (T2, 75%FC+25%CAC (T3, 50%FC+50%CAC (T4, e 25%FC+75%CAC (T5. Cada tratamento foi composto por 14 repetições com 2 plantas por tratamento. Caixas de plástico transparente foram utilizados como recipientes. Aos 125 dias após o transplantio, foram avaliadas as seguintes variáveis das plântulas: comprimento, número, massa fresco e massa seco de raiz; massa fresco e massa seco da parte aérea; comprimento da parte aérea. Nas condições do experimento, conclui-se que o substrato composto somente por fibra de coco apresentou melhores resultados em todas as variáveis analisadas.
Directory of Open Access Journals (Sweden)
Luiz Eduardo Imbelloni
2004-10-01
punta cortante, lenta velocidad de inyección y la posición lateral han sido relatados como facilitadores de la producción de raquianestesia unilateral. El presente estudio longitudinal investiga el grado de raquianestesia unilateral utilizando 5 mg de bupivacaína a 0,5% hiperbárica inyectada a través de aguja 27G tipo Quincke en el paciente en decúbito lateral, con miembro a ser operado vuelto para abajo. MÉTODO: Raquianestesia con 0,5% de bupivacaína fue realizada a través de aguja 27G Quincke en 30 pacientes estado físico ASA I y II sometidos a cirugías ortopédicas. La punción subaracnóidea fue realizada con el paciente previamente colocado con el lado a ser operado vuelto para abajo y fueron inyectados 5 mg de bupivacaína a 0,5% hiperbárica en la velocidad de 1 ml.15s-1. Bloqueos sensitivo y motor (picada de aguja y escala de 0 a 3 fueron comparados entre los lados a ser operados y el contralateral. RESULTADOS: Los bloqueos motor y sensitivo entre el lado operado y el contralateral fueron significativamente diferentes en todos los momentos. Raquianestesia unilateral fue obtenida en 85,7% de los pacientes. Estabilidad hemodinámica fue observada en todos los pacientes. Ningún paciente desenvolvió cefalea pós-raquianestesia. CONCLUSIONES: En las condiciones de este estudio la bupivacaína hiperbárica a 0,5% (5 mg proporcionó un predominante bloqueo unilateral. Veinte minutos fueron suficientes para la instalación del bloqueo. Las principales ventajas de la raquianestesia unilateral son la estabilidad hemodinámica, la satisfacción del paciente y recuperación mas rápida de la anestesia.BACKGROUND AND OBJECTIVES: Unilateral spinal anesthesia may be advantageous, especially for outpatient procedures. Low anesthetic doses, pencil point or cutting point needles, slow injection rate and the lateral position have been reported as helping unilateral spinal anesthesia technique. This longitudinal study aimed at investigating the depth of unilateral
Directory of Open Access Journals (Sweden)
Beatriz Wills
2016-03-01
Full Text Available La falla cardiaca (FC es la causa más común de admisión hospitalaria en adultos en el mundo. Además, de su importante prevalencia la FC tiene un alta tasa de mortalidad, se estima que aproximadamente el 50% de los pacientes con FC mueren a los 5 años posterior al egreso hospitalario. Esto ha motivado el desarrollo de nuevas terapias seguras y efectivas para el manejo de esta entidad. El LCZ696 es un inhibidor dual de la neprilisina y del receptor de angiotensina II que demostró en estudios de fase III disminuir el desenlace primario de muerte cardiovascular y hospitalización por empeoramiento de la FC y muerte global. Probablemente el LCZ696 se convertirá en la piedra angular del manejo en pacientes con FC con fracción de eyección deprimida.
Vanderven, Hillary A; Wragg, Kathleen; Ana-Sosa-Batiz, Fernanda; Kristensen, Anne B; Jegaskanda, Sinthujan; Wheatley, Adam K; Wentworth, Deborah; Wines, Bruce D; Hogarth, P Mark; Rockman, Steve; Kent, Stephen J
2018-05-31
New treatments for severe influenza are needed. Passive transfer of influenza-specific hyperimmune pooled immunoglobulin (Flu-IVIG) boosts neutralising antibody responses to past strains in influenza-infected subjects. The effect of Flu-IVIG on antibodies with Fc-mediated functions, which may target diverse influenza strains, is unclear. We studied the capacity of Flu-IVIG, relative to standard IVIG, to bind to Fc receptors and mediate antibody-dependent cellular cytotoxicity in vitro. The effect of Flu-IVIG infusion, compared to placebo infusion, was examined in serial plasma samples from 24 subjects with confirmed influenza infection in the INSIGHT FLU005 pilot study. Flu-IVIG contains higher concentrations of Fc-functional antibodies than IVIG against a diverse range of influenza hemagglutinins. Following infusion of Flu-IVIG into influenza-infected subjects, a transient increase in Fc-functional antibodies was present for 1-3 days against infecting and non-infecting strains of influenza. Flu-IVIG contains antibodies with Fc-mediated functions against influenza virus and passive transfer of Flu-IVIG increases anti-influenza Fc-functional antibodies in the plasma of influenza-infected subjects. Enhancement of Fc-functional antibodies to a diverse range of influenza strains suggests that Flu-IVIG infusion could prove useful in the context of novel influenza virus infections, when there may be minimal or no neutralising antibodies in the Flu-IVIG preparation.
Langone, J J; Das, C; Mainwaring, R; Shearer, W T
1985-01-01
Protein A of Staphylococcus aureus is an Fc receptor for IgG that has been used as a therapeutic reagent to treat cancer in humans and experimental animals. We used ultracentrifugation combined with analysis of isolated fractions by radioimmunoprecipitation and competitive radioimmunoassay with chicken antibodies that bind free protein A or protein A in complexes but do bind free immunoglobulin reagents to localize and characterize the types of complexes formed with different molar ratios of 125I-protein A and human 131I-IgG alone or in serum, and 131I-Fc gamma fragments. This approach offers a distinct advantage over direct counting of radioactivity in the fractions because resolution of complexes and free reagents is much improved. With excess 131I-IgG or 131I-Fc, all the 125I-protein A is present only in complexes that contained 4 molecules of immunoglobulin reagent and 2 molecules of protein A (4:2 complexes), whereas with excess 125I-protein A the stoichiometry of the complexes was 1:1. We have also shown the preformed 4:2 and 1:1 complexes will interconvert in the presence of added excess protein A or IgG, respectively, and that fresh IgG will exchange with IgG or Fc gamma in preformed complexes. Because protein A has been found to elute from an immobilized reagent used in serotherapy of human cancer and is present in a large excess of IgG, the 4:2 complexes may play an active role in the tumoricidal or toxic reactions observed.
Human IgG4 binds to IgG4 and conformationally altered IgG1 via Fc-Fc interactions
Rispens, Theo; Ooievaar-de Heer, Pleuni; Vermeulen, Ellen; Schuurman, Janine; van der Neut Kolfschoten, Marijn; Aalberse, Rob C.
2009-01-01
The Fc fragment of IgG4 can interact with the Fc fragment of another IgG molecule. This interaction is a confounding factor when measuring IgG4 rheumatoid factor levels. Recently, we demonstrated that half-molecules of IgG4 can exchange to form a bispecific Ab. We expected these two phenomena to be
Directory of Open Access Journals (Sweden)
Rodrigo Garófallo GARCIA
2010-11-01
Full Text Available O objetivo do trabalho foi avaliar as características da carne de peito de frango de corte submetida a diferentes soluções de marinação e tempo de maturação. Os tratamentos foram distribuídos em um arranjo fatorial 3x3 sendo três formas diferentes de marinação (controle-água, cloreto de sódio e glutamato monossódico e três tempos diferentes de maturação da carne na geladeira (0, 24, e 48 horas e foram avaliados o pH, perda de peso por cozimento (PPC, força de cisalhamento (FC, capacidade de retenção de água (CRA, perda de exudato (PE, dimensionamento de peito (DP e características sensoriais. O pH não houve alteração significativa (p>0,05 apresentou-se no índice de acidificação ideal. A PPC foi afetada pela marinação e tempo de maturação (p<0,05 tendo a solução salina menores perdas e a solução com glutamato maiores perdas na medida que aumentou-se o tempo de maturação. A FC mostrou que os filés marinados com a solução salina nos três tempos de maturação foram mais macios (p<0,001 que os dos tratamentos controle e glutamato. A CRA não foi influenciada pelos precessos de marinação e maturação. Na análise sensorial a maturação não favoreceu os atributos estudados e, a marinação com sal ou glutamato pode ser empregada para melhorar a maciez, suculência e palatabilidade. Palavras-chave: qualidade de carne, filés de peito de frango.
Directory of Open Access Journals (Sweden)
Kettelin Aparecida Arbos
2013-04-01
Full Text Available O processamento industrial de frutos de manga gera elevada quantidade de resíduos agroindustriais, representados pelas cascas e sementes (amêndoa, os quais, sem aplicação viável, acabam sendo descartados diretamente no meio ambiente. Esses resíduos são ricos em compostos bioativos, amplamente reconhecidos pelas suas propriedades promotoras da saúde e em aplicações tecnológicas. Os objetivos foram avaliar as atividades antimicrobiana e antioxidante e o teor de compostos fenólicos de dois extratos: um obtido da casca (FC e outro da amêndoa (FA de manga variedade 'Tommy Atkins'. O teor de compostos fenólicos totais variou de 3.123 a 6.644 mg de catequina/100 g. Os extratos FC e FA demonstraram relevante atividade antimicrobiana frente às cepas das bactérias Escherichia coli, Salmonella sp., Pseudomonas aeruginosa . Staphylococcus aureus, determinadas pelo método de difusão em disco. A ação antioxidante de FC e FA aumentou com o aumento das concentrações testadas, atingindo o valor máximo de 88% (FC. Em todas as concentrações testadas os extratos FC apresentaram ação antioxidante significativamente superior às respectivas concentrações dos extratos FA. Esses resultados sugerem potencial aplicação dos resíduos de manga como fonte de compostos fenólicos, substâncias antimicrobianas e antioxidantes, podendo ser explorados pelas indústrias de alimentos.
Directory of Open Access Journals (Sweden)
Fernando Olabe Sánchez
2012-12-01
Full Text Available ResumenEl FC Barcelona y el Real Madrid CF han cambiado su modelo de gestión comunicativa, especialmente en su relación con los medios de comunicación. Favorecidos por la implantación de las TIC, los departamentos de Comunicación de estas entidades se constituyen en gatekeeper al controlar y emitir, a través de sus propios medios de comunicación, como las televisiones y radios propias y los soportes online, las informaciones que ellos mismos generan. De este modo, controlan los mensajes y los emiten directamente a sus públicos objetivos sin la intermediación de los medios convencionales, condicionando las rutinas productivas de los periodistas deportivos.El objetivo de este trabajo es mostrar la percepción que estos profesionales tienen sobre las diferentes herramientas y soportes online que los departamentos de Comunicación de estos clubes emplean en su actividad diaria con los medios.AbstractThe FC Barcelona and Real Madrid CF have changed their communicative management model, especially in its relationship with the media. Favored by the introduction of ICT, Communication departments of these entities constitute gatekeeper to control and issue, through their own media, such as television and radio stations and media own online, the information that they generate. Thus, controlling broadcast messages and their target audiences directly without the intermediation of the mainstream media, conditioning routines productive sports journalists.The aim of this paper is to show the perception that these professionals have about the different tools and online media Communication departments to use these clubs in their daily activities with the media.
Directory of Open Access Journals (Sweden)
Óscar Pablo Gutiérrez Sancho
2002-06-01
Full Text Available Se estudió el efecto de la suplementación con creatina (Crsobre el rendimiento en natación, ciclismo y atletismo en 10 mujeres. Las participantes debían realizar 4intervalos en cada deporte a máxima intensidad, además de un segmento aeróbico de 7 min post intervaloentre el 65 - 85% de la FCmáx. En un diseño de medidas repetidas, las atletas completaron 3 condicionesexperimentales: control (CT, suplementación con creatina (CCr, y condición placebo (PL. Se registró eltiempo de cada intervalo en las diferentes condiciones y se aplicaron 3 ANOVAS de medidas repetidas paracada deporte. Se encontraron interacciones entre los tratamientos y las mediciones en ciclismo (p = .001 yatletismo (p = .002. El análisis de seguimiento para la interacción de ciclismo reveló que todas lascondiciones fueron diferentes entre sí (p < 0.05, y que éstas diferencias en los promedios se encontraban enlos intervalos 1, 2 y 4. El análisis post-hoc de Tukey mostró diferencias (p < 0.05 en el intervalo 1 entre CT(M = 78.3 ± 11.58 s y PL (M = 75.2 ± 7.62 s (p < 0.05. En el intervalo 2 las diferencias fueron entre CT(M = 77.3 ± 7.97 s y CCr (M = 75.3 ± 7.97 s (p < 0.05; y entre CT (M = 77.3 ± 7.97 s y PL (M = 74.8 ±7.28 s (p < 0.05. En el intervalo 4, CCr (M = 77.5 ± 8.29 s y PL (M = 76.4 ± 7.49 s. El análisis deseguimiento de la interacción de atletismo mostró diferencias en los intervalos 1, 3 y 4. El análisis post-hocde Tukey indicó diferencias en el intervalo 1 de atletismo entre CCr (M = 96.6 ± 13.63 s y PL (M = 90.4 ±14.08 s y entre CCr (M = 96.6 ± 13.63 s y CT (M = 91.8 ± 9.73 s (p < 0.05. En el intervalo 3 hubodiferencias entre CT (M = 94.8 ± 13.60 s y PL (M = 90.2 ± 8.97 s. Por último, en el intervalo 4 lasdiferencias fueron entre CT (M = 96.9 ± 15.18 s y CCr (M = 90.3 ± 11.84 s; y entre CT (M = 96.9 ± 15.18s y PL (M = 90.7 ± 11.35 s (p < 0.05. Se concluye que durante las etapas de atletismo hubo un efecto positivo de la
Anumula, Kalyan Rao
2012-08-31
Typical clinical grade human IgG (intravenous immunoglobulin, IVIG), used for carbohydrate analysis, is derived from thousands of healthy donors. Quantitative high-resolution glycan profiles of IgG and its Fc-Fab fragments are presented here. Glycan profiles were established following digestions with Fc specific endoglycosidase S and generic PNGase F under denaturing and non-denaturing (native) conditions. The native PNGase F glycan profile of IgG was similar (but not identical) to that of Endo S. Endo S profiles did not contain the glycans with bisecting GlcNAc. PNGase F glycan profiles were the same for Fc fragments that were isolated from pepsin and Ide S protease digests. Both isolated Fab fragments and the previously deglycosylated IVIG (native conditions) yielded the same glycan profile. Glycan profiles were established using high resolution HPLC with 2-aminobenzoic acid (2AA) labeling. An accurate determination of sialylation levels can be made by this method. Carbohydrate content in Fc and Fab was determined using an internal standard and corrected for both protein and glycan recoveries. Fab portion contained about 14% of the total carbohydrate which translates to 2.3 sugar chains per mol in IVIG where 2 chains are located in the CH2 domain of the Fc. Fc glycans consisted of neutral (N) 84.5%; mono-sialylated (S1) 15% and di-sialylated (S2) 0.5%. In contrast, Fab contained N, 21%; S1, 43% and S2, 36%. The distribution of bisecting N-acetylglucosamine and fucose was found to be very different in various glycans (N, S1 and S2) found in Fab and Fc. Total IgG glycan profile (Fab plus Fc) contained N, 78.5%; S1, 17% and S2, 4.5%. Percent distribution of glycans G0, G1 and G2 (with 0, 1 and 2 two galactoses) was 26, 49 and 25 respectively within the 78% of the neutral glycans. Glycan profiles were nearly the same for various clinical grade IVIG preparations from various manufacturers. A fast HPLC profiling method was developed for the separation and quantitation
Energy Technology Data Exchange (ETDEWEB)
Rosa, Renata Gualberto Cordeiro [PETROBRAS, Rio de Janeiro, RJ (Brazil)
2008-07-01
Considering the activities of exploration and production of oil and natural gas and the concession regimen applicable to them in Brazil, the assignment of rights and obligations of the concession contract is analyzed from the points of view of the Petroleum Law and the contract itself. This paper intend to address the legal aspects that support the general legal authorization and the rules of the concession contract, as well as the role of ANP in the approval of the transfer and in the development of technical rules, regarding its function as a regulatory agency. Two controversial issues, the transfer with retroactive effects and the transfer of part of the concession area, are analyzed in light of the general features of the transfer of rights and obligations. Finally, the 'cessao de fato' and its consequences will be considered for the study of assignment of rights with retroactive effects and the operations of sole risk.. (author)
Can De Sitter spacetime be a final state of the contracting universe
International Nuclear Information System (INIS)
Berezin, V.A.
1984-01-01
This chapter attempts to phenomenologically describe the final stage of the Universe contraction. A model equation of state is used to demonstrate that during a cosmological contraction a de Sitter spacetime may be produced. It is shown that a equilibrium thermodynamic description of the matter in cosmological models leads to the absence of particle creation. It is proposed that these nonequilibrium processes be taken into account by introducing a new additional thermodynamic variable showing the explicit time dependence of all thermodynamic potentials into the thermodynamic relations. The spacetime is assumed to be homogeneous and isotropic, and the energy momentum tensor includes not only the energy density and pressure for the matter and radiation, but it also includes contributions due to vacuum polarization by correspondent fields. It is demonstrated that it is possible to reach in principle the de Sitter spacetime as the limit of the contraction
Características de las personas afectadas de fibrilación auricular en una consulta de cardiología
Directory of Open Access Journals (Sweden)
Patricia López-Mases
Full Text Available La Fibrilación auricular (FA presenta una elevada prevalencia en los ancianos. Se plantea como objetivo describir las características de la población afectada y valorar las relaciones existentes entre los diferentes aspectos medibles. Metodología: Estudio descriptivo e inferencial con muestreo por conveniencia, seleccionando todos los pacientes con episodios de FA asociados a frecuencias cardíacas (FC superiores a 80 ppm o que hayan revertido a ritmo sinusal, con el que se obtiene una muestra de 65 personas. Se han recopilado datos sociodemográficos, tipo de FA, variaciones en FC, visitas a urgencias y complicaciones. Los datos han sido analizados mediante el programa SPSS v.17.0. Resultados: La media de edad fue de 65 años. La FA paroxística se encuentra asociada a FC iniciales superiores a las del grupo de FA persistente, el cual se relaciona con edades más avanzadas. El grupo que acude a urgencias presenta FC iniciales superiores. Existen diferencias significativas, asociando directamente las consultas al servicio de urgencias con episodios de FA con FC elevadas que obliga a la derivación. A edades avanzadas, mayor asociación en el individuo de los factores de riesgo con los que esta se relaciona. Conclusiones: La FA es una de las arritmias más prevalentes, con un alto coste sanitario y con un empeoramiento de la calidad de vida, por lo que las actividades encaminadas a la detección precoz y tratamiento adecuado son fundamentales para su mejora.
Borek, Aleksandra; Sokolowska-Wedzina, Aleksandra; Chodaczek, Grzegorz; Otlewski, Jacek
2018-01-01
Fibroblast growth factor receptors (FGFRs) are promising targets for antibody-based cancer therapies, as their substantial overexpression has been found in various tumor cells. Aberrant activation of FGF receptor 2 (FGFR2) signaling through overexpression of FGFR2 and/or its ligands, mutations, or receptor amplification has been reported in multiple cancer types, including gastric, colorectal, endometrial, ovarian, breast and lung cancer. In this paper, we describe application of the phage display technology to produce a panel of high affinity single chain variable antibody fragments (scFvs) against the extracellular ligand-binding domain of FGFR2 (ECD_FGFR2). The binders were selected from the human single chain variable fragment scFv phage display libraries Tomlinson I + J and showed high specificity and binding affinity towards human FGFR2 with nanomolar KD values. To improve the affinity of the best binder selected, scFvF7, we reformatted it to a bivalent diabody format, or fused it with the Fc region (scFvF7-Fc). The scFvF7-Fc antibody construct presented the highest affinity for FGFR2, with a KD of 0.76 nM, and was selectively internalized into cancer cells overexpressing FGFR2, Snu-16 and NCI-H716. Finally, we prepared a conjugate of scFvF7-Fc with the cytotoxic drug monomethyl-auristatin E (MMAE) and evaluated its cytotoxicity. The conjugate delivered MMAE selectively to FGFR2-positive tumor cells. These results indicate that scFvF7-Fc-vcMMAE is a highly potent molecule for the treatment of cancers with FGFR2 overexpression.
30 CFR 285.436 - Can MMS require lease or grant contraction?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS require lease or grant contraction? 285... Administration Lease Or Grant Contraction § 285.436 Can MMS require lease or grant contraction? At an interval no more frequent than every 5 years, the MMS may review your lease or grant area to determine whether the...
Reproduction of the FC/DFC units in nucleoli.
Smirnov, Evgeny; Hornáček, Matúš; Kováčik, Lubomír; Mazel, Tomáš; Schröfel, Adam; Svidenská, Silvie; Skalníková, Magdalena; Bartová, Eva; Cmarko, Dušan; Raška, Ivan
2016-04-25
The essential structural components of the nucleoli, Fibrillar Centers (FC) and Dense Fibrillar Components (DFC), together compose FC/DFC units, loci of rDNA transcription and early RNA processing. In the present study we followed cell cycle related changes of these units in 2 human sarcoma derived cell lines with stable expression of RFP-PCNA (the sliding clamp protein) and GFP-RPA43 (a subunit of RNA polymerase I, pol I) or GFP-fibrillarin. Correlative light and electron microscopy analysis showed that the pol I and fibrillarin positive nucleolar beads correspond to individual FC/DFC units. In vivo observations showed that at early S phase, when transcriptionally active ribosomal genes were replicated, the number of the units in each cell increased by 60-80%. During that period the units transiently lost pol I, but not fibrillarin. Then, until the end of interphase, number of the units did not change, and their duplication was completed only after the cell division, by mid G1 phase. This peculiar mode of reproduction suggests that a considerable subset of ribosomal genes remain transcriptionally silent from mid S phase to mitosis, but become again active in the postmitotic daughter cells.
Construction of a bimolecular fluorescence complementation (BiFC ...
African Journals Online (AJOL)
Protein–protein interactions are essential for signal transduction in cells. Bimolecular fluorescence complementation (BiFC) is a novel technology that utilises green fluorescent proteins to visualize protein–protein interactions and subcellular protein localisation. BiFC based on pSATN vectors are a good system for ...
The effect of texture in (Bi3.5Nd0.5)(Ti2.97Nb0.03)O12 ceramics
Cao, Ziping; Ding, Aili; Zheng, Xinsen; Qiu, Pingsun; Cheng, Wenxiu
2004-11-01
(Bi3.5Nd0.5) (Ti2.97Nb0.03)O12 ferroelectric ceramics was successfully prepared by a hot-pressing method. XRD diffraction confirms that the samples hold different texture in the sliced planes parallel and perpendicular to the hot-pressing axis, respectively. The anisotropy of ferroelectric, dielectric and piezoelectric properties were all observed in the textured ceramics. Due to the great improvement of ferroelectric and piezoelectric properties, the sample which was sliced along the direction parallel to the hot-pressing axis can be considered as a good candidate of high temperature piezoelectric materials.
Directory of Open Access Journals (Sweden)
Sylvia Sance Marantina
2016-06-01
Full Text Available Dimorfisme FcγRlla memiliki keterkaitan dengan kemampuan inang dalam mengeliminasi parasit malaria sehingga perlu dilakukan penelitian untuk mengetahui polimorfisme alel FcγRlla dari populasi di daerah endemis malaria di Indonesia agar dapat diketahui peran imunitas dalam mengeliminasi parasit malaria. Sebanyak 120 sampel dried blood spot (DBS malaria falsifarum yang diperoleh dari studi efikasi obat DHP di lima wilayah di Indonesia dianalisis dengan polymerase chain reaction (PCR dan sekuensing untuk melihat varian alel FcγRIIa-131 serta hubungannya dengan densitas parasit dan efikasi dihidroartemisinin-piperakuin. Analisis gen FcγRIIa menunjukkan bahwa genotip RH memiliki frekuensi paling tinggi (50,8% dibandingkan RR (17,5% dan HH (31,7%. Alel R131 gen FcγRIIa menunjukkan efek protektif terhadap high density parasitemia/HDP (>5000 parasit/μL; odds ratio [OR]= 0,133, 95% confidence interval [CI]= 0,053–0,334, p< 0,001 dan berhubungan dengan keberadaan gametosit yang lebih lama pada inang (>72 jam; relative risk [RR]= 1,571, 95% confidence interval [CI]= 1,005–2,456, p= 0,090. Kata Kunci: malaria falsiparum, dihidroartemisinin-piperakuin, K13, FcγRIIa, efikasi obat Polymorphism of Human FcγRIIa and Its Association with P. falciparum Density and Efficacy of Dihydroartemisinin- Piperaquine Abstract FcγRlla dimorphism has been related to the ability of the host to eliminate malaria parasite so it is necessary to investigate the allele polymorphism FcγRlla of population in malaria-endemic areas in Indonesia in order to know the role of immunity in eliminating malaria parasite. A total of 120 samples of Dried Blood Spot (DBS falciparum malaria acquired from DHP drug efficacy studies in 5 regions in Indonesia were analyzed by Polymerase Chain Reaction (PCR and sequencing, to look at variants of FcγRIIa-131 allele and its Association with Parasite DensityandEfficacy ofDihydroartemisinin- Piperaquine. The FcγRIIa gene analysis indicated
Directory of Open Access Journals (Sweden)
Antonio A de Lima
2011-09-01
Full Text Available The aim of this work was to evaluate the yield and quality of tomato fruits, hybrid "Vênus", produced on substrates and with application of nutrient solution and humic acids (AH. Four doses of AH were evaluated (0, 20, 40 and 80 L ha-1 and 4 substrates: S1 (coconut fiber (CF, S2 (FC + carbonized coffee husk (CC in the ratio 1:3, S3 (CF + CC in the ratio 2:3 and S4 (CC, were evaluated following the randomized blocks design in factorial 4x4 scheme with four replications. The 35-day old seedlings were transplanted into plastic bags of 7 L. The humic acids were applied four times in eight-day intervals, and the first application was carried out eight days after transplanting. There was no significant effect of AH on the yield and quality of fruit, except in relation to soluble solids (SS/titratable acidity (AT. Doses of up to 36 L ha-1, increase the AT, above that amount favored increase of SS. The carbonized coffee husk in treatments S2, S3 and S4, did not alter the production of small fruits, medium, non-commercial, moisture, pH, SS, AT and SS/AT, however, significantly reduced the total production, commercial and large size fruit. The production of fruits in S1 was significantly higher compared to the other treatments, with an average of 142.6 t ha-1, showing average increase in yield of 24.4%, 29.3% and 36.1% compared to plant of treatments S2, S3 and S4, respectively.Este trabalho foi realizado com o objetivo de avaliar a produtividade e qualidade de frutos de tomateiro, híbrido Vênus, produzidos em substratos, com aplicação de solução nutritiva e de ácidos húmicos (AH. Foram avaliadas 4 doses de AH (0, 20, 40 e 80 L ha-1 e 4 substratos: S1 (fibra de coco (FC, S2 (FC + casca de café carbonizada (CC na proporção 1:3, S3 (FC + CC na proporção 2:3 e S4 (CC. O delineamento experimental foi em blocos casualizados distribuídos em esquema fatorial 4x4. As mudas foram transplantadas com 35 dias para sacolas plásticas com capacidade de 7
Directory of Open Access Journals (Sweden)
A.L.S. Lacerda
2001-12-01
Full Text Available Este trabalho foi conduzido no município de Selvíria-MS, semeando soja do cultivar IAC-15. O delineamento experimental utilizado foi o de blocos casualizados, estando os tratamentos dispostos em um esquema fatorial 3x3 e 4x4, sendo os fatores os produtos (dessecantes e as épocas de aplicação, nos anos agrícolas 1996/97 e 1997/98, respectivamente. Os dessecantes utilizados foram: paraquat, diquat e mistura paraquat + diquat, nas dosagens de 0,4; 0,3 e 0,2+0,15 em 1996/97, respectivamente, e os mesmos tratamentos em 1997/98, além do glufosinato de amônio na dosagem de 0,4 kg i.a. ha-1 em 1997/98. Como épocas, foram realizadas três aplicações em 1996/97 e quatro em 1997/98, todas espaçadas de cinco dias a partir do estádio fenológico médio da cultura R6. Concluiu-se que os dessecantes utilizados mostraram-se eficientes na dessecação da soja; foi possível obter antecipação da colheita de sementes de soja, sem alterar a produção, por um período máximo de sete dias.This research was carried out in Selvíria-MS, Brazil, during the growing seasons of 1996/97 and 1997/98, using the soybean cultivar IAC-15. The experimental design was arranged in randomized complete blocks in a 3x3 and 4x4 factorial scheme during 1996/97 and 1997/98, respectively, with the factors being the products (desiccants and timing of application. The desiccants sprayed were: paraquat, diquat and a mixture of paraquat + diquat at rates of 0.4; 0.3 and 0.2+0.15 in 1996/97 and the same treatments in 1997/98 added to ammonium glufosinate at 0.4 kg a.i. ha-1 in 1997/98. The timing of application was spaced every five days, starting from the soybean vegetative stage R6. The tested desiccants were efficient on the soybean desiccation ; it was possible to obtain grain harvest anticipation, without yield reduction, in a maximum period of seven days.
46 CFR 50.05-5 - Existing boilers, pressure vessels or piping systems.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Existing boilers, pressure vessels or piping systems. 50... ENGINEERING GENERAL PROVISIONS Application § 50.05-5 Existing boilers, pressure vessels or piping systems. (a) Whenever doubt exists as to the safety of an existing boiler, pressure vessel, or piping system, the marine...
Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Boross, P.; Roth, J.; Verbeek, S.; Lent, P.L.E.M. van; Berg, W.B. van den
2003-01-01
OBJECTIVE: To study the role of the activating Fc gamma receptor types I and III (Fc gamma RI and Fc gamma RIII, respectively) and the inhibiting Fc gamma receptor II (Fc gamma RII) in inflammation and in various aspects of cartilage destruction during arthritis that is solely induced by immune
Neutron Reflection Study of Surface Adsorption of Fc, Fab, and the Whole mAb.
Li, Zongyi; Li, Ruiheng; Smith, Charles; Pan, Fang; Campana, Mario; Webster, John R P; van der Walle, Christopher F; Uddin, Shahid; Bishop, Steve M; Narwal, Rojaramani; Warwicker, Jim; Lu, Jian Ren
2017-07-12
Characterizing the influence of fragment crystallization (Fc) and antigen-binding fragment (Fab) on monoclonal antibody (mAb) adsorption at the air/water interface is an important step to understanding liquid mAb drug product stability during manufacture, shipping, and storage. Here, neutron reflection is used to study the air/water adsorption of a mAb and its Fc and Fab fragments. By varying the isotopic contrast, the adsorbed amount, thickness, orientation, and immersion of the adsorbed layers could be determined unambiguously. While Fc adsorption reached saturation within the hour, its surface adsorbed amount showed little variation with bulk concentration. In contrast, Fab adsorption was slower and the adsorbed amount was concentration dependent. The much higher Fc adsorption, as compared to Fab, was linked to its lower surface charge. Time and concentration dependence of mAb adsorption was dominated by Fab behavior, although both Fab and Fc behaviors contributed to the amount of mAb adsorbed. Changing the pH from 5.5 to 8.8 did not much perturb the adsorbed amount of Fc, Fab, or mAb. However, a small decrease in adsorption was observed for the Fc over pH 8-8.8 and vice versa for the Fab and mAb, consistent with a dominant Fab behavior. As bulk concentration increased from 5 to 50 ppm, the thicknesses of the Fc layers were almost constant at 40 Å, while Fab and mAb layers increased from 45 to 50 Å. These results imply that the adsorbed mAb, Fc, and Fab all retained their globular structures and were oriented with their short axial lengths perpendicular to the interface.
Hayes, Jerrard M; Frostell, Asa; Karlsson, Robert; Müller, Steffen; Martín, Silvia Míllan; Pauers, Martin; Reuss, Franziska; Cosgrave, Eoin F; Anneren, Cecilia; Davey, Gavin P; Rudd, Pauline M
2017-10-01
Fc gamma receptors (FcγR) bind the Fc region of antibodies and therefore play a prominent role in antibody-dependent cell-based immune responses such as ADCC, CDC and ADCP. The immune effector cell activity is directly linked to a productive molecular engagement of FcγRs where both the protein and glycan moiety of antibody and receptor can affect the interaction and in the present study we focus on the role of the FcγR glycans in this interaction. We provide a complete description of the glycan composition of Chinese hamster ovary (CHO) expressed human Fcγ receptors RI (CD64), RIIa Arg131/His131 (CD32a), RIIb (CD32b) and RIIIa Phe158/Val158 (CD16a) and analyze the role of the glycans in the binding mechanism with IgG. The interactions of the monoclonal antibody rituximab with each FcγR were characterized and we discuss the CHO-FcγRIIIa Phe158/Val158 and CHO-FcγRI interactions and compare them to the equivalent interactions with human (HEK293) and murine (NS0) produced receptors. Our results reveal clear differences in the binding profiles of rituximab, which we attribute in each case to the differences in host cell-dependent FcγR glycosylation. The glycan profiles of CHO expressed FcγRI and FcγRIIIa Phe158/Val158 were compared with the glycan profiles of the receptors expressed in NS0 and HEK293 cells and we show that the glycan type and abundance differs significantly between the receptors and that these glycan differences lead to the observed differences in the respective FcγR binding patterns with rituximab. Oligomannose structures are prevalent on FcγRI from each source and likely contribute to the high affinity rituximab interaction through a stabilization effect. On FcγRI and FcγRIIIa large and sialylated glycans have a negative impact on rituximab binding, likely through destabilization of the interaction. In conclusion, the data show that the IgG1-FcγR binding kinetics differ depending on the glycosylation of the FcγR and further support a
Evaluación costo-efectividad de lidocaína al 5 % y bupivacaína al 0,5 % en anestesia espinal
Directory of Open Access Journals (Sweden)
Eréndira González Orozco
Full Text Available Se realizó un estudio económico prospectivo de costo-efectividad con datos primarios de efectividad obtenidos de un ensayo clínico aleatorizado, donde se comparan 2 anestésicos vía espinal: lidocaína al 5 % y bupivacaína al 0,5 %. La efectividad se evaluó como la probabilidad de aparición de síntomas neurológicos transitorios, reacción adversa propia de este grupo de medicamentos. Se formaron aleatoriamente 2 grupos de pacientes que requerían cirugías por debajo del ombligo con una duración no mayor de 120 min, con la aplicación de cada una de las opciones de anestesia estudiada a cada grupo, 109 pacientes en el grupo de lidocaína y 97 en el grupo de bupivacaína. Un especialista en Neurología evaluó a ciegas la condición neurológica posquirúrgica de cada paciente antes y 24 h después de la intervención. Se calcularon los costos de cada alternativa, que incluyeron los ocasionados por la toxicidad neurológica, y se determinaron las relaciones costo-efectividad y los costos incrementales. El grupo de bupivacaína resultó la alternativa con mejor relación costo-efectividad
48 CFR 12.505 - Applicability of certain laws to contracts for the acquisition of COTS items.
2010-10-01
... laws to contracts for the acquisition of COTS items. 12.505 Section 12.505 Federal Acquisition... Items 12.505 Applicability of certain laws to contracts for the acquisition of COTS items. COTS items.... In addition, the following laws are not applicable to contracts for the acquisition of COTS items: (a...
Desarrollo y optimización de una jalea de piroxicam 0,5 %
Directory of Open Access Journals (Sweden)
Oscar García Pulpeiro
Full Text Available Se desarrolló por primera vez en Cuba, una formulación de jalea de piroxicam al 0,5 %. Se tomó como referencia la composición de la formulación líder del mercado FELDENE GELâ, a la cual se le efectuaron algunas modificaciones. Se realizaron 4 experimentos en las evaluaciones preliminares que sirvieron de base para la etapa posterior de diseño y optimización de la formulación. Se aplicó un diseño de experimentos con mezcla, para lo cual se emplearon como variables independientes la concentración de Carbopol 940, trietanolamina y hidroxipropilmetilcelulosa. Se evaluó la influencia de estos componentes en el pH, el área de extensibilidad y en algunas propiedades organolépticas. A partir de estos resultados, se seleccionó una formulación óptima.
Sweat conductivity and coulometric quantitative test in neonatal cystic fibrosis screening
Directory of Open Access Journals (Sweden)
Mouseline Torquato Domingos
2015-11-01
Full Text Available Objective: To compare the results obtained with the sweat test using the conductivity method and coulometric measurement of sweat chloride in newborns (NBs with suspected cystic fibrosis (CF in the neonatal screening program. Methods: The sweat test was performed simultaneously by both methods in children with and without CF. The cutoff values to confirm CF were >50 mmol/L in the conductivity and >60 mmol/L in the coulometric test. Results: There were 444 infants without CF (185 males, 234 females, and 24 unreported submitted to the sweat test through conductivity and coulometric measurement simultaneously, obtaining median results of 32 mmol/L and 12 mmol/L, respectively. For 90 infants with CF, the median values of conductivity and coulometric measurement were 108 mmol/L and 97 mmol/L, respectively. The false positive rate for conductivity was 16.7%, and was higher than 50 mmol/L in all patients with CF, which gives this method a sensitivity of 100% (95% CI: 93.8–97.8, specificity of 96.2% (95% CI: 93.8–97.8, positive predictive value of 83.3% (95% CI: 74.4–91.1, negative predictive value of 100% (95% CI: 90.5–109.4, and 9.8% accuracy. The correlation between the methods was r = 0.97 (p > 0.001. The best suggested cutoff value was 69.0 mmol/L, with a kappa coefficient = 0.89. Conclusion: The conductivity test showed excellent correlation with the quantitative coulometric test, high sensitivity and specificity, and can be used in the diagnosis of CF in children detected through newborn screening. Resumo: Objetivo: Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos: O teste do suor foi realizado simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60
Directory of Open Access Journals (Sweden)
Paula Zapata
2007-06-01
Full Text Available Grifóla frondosa es un hongo Basidiomycete comestible y medicinal que produce polisacáridos tipo glucanos (β-1,6 y β-1,3 con actividad antitumoral e inmunomoduladora. Para el presente trabajo, el objetivo fue evaluar la incidencia de diferentes fuentes de carbono (FC en la producción de biomasa y exopolisacári-dos (EPS, bajo condiciones de cultivo sumergido, utilizando un diseño estadístico factorial con dos factores: fuente de carbono (FC(1-7 y medio (MB y MS. La máxima producción de biomasa micelial (21,10 ± 0,82 g/l y la máxima producción de EPS (6,53 ± 0,14 g/l se logró utilizando el medio MB suplementado con FC4. Además de lo anterior, se logró desarrollar un medio de cultivo que cumple con el objetivo de disminuir costos, de Col $18.455 a $656 por litro de medio, produciendo (14,14 ± 0,82 g/l de biomasa y (5,16 ± 0,14 g/l de EPS, utilizando el medio MS suplementando con FC4. Estos resultados abren nuevas alternativas y posibilidades en nuestro país para el desarrollo de productos a partir de esta especie con costos que estén al alcance de la población.Grifóla frondosa is a Basidiomycete fungus edible and medicinal, it produces polysaccharides such a glucans (β-1,6 and β-1,3 with anti-tumor and inmuno-stimulating activity. For this work, the aim was evaluate the incidence of different carbon sources (FC in biomass and exo-polymer (EPS production, under submerged culture conditions, by using a factorial statistical design with two factors: carbon source (FC(1-7 and medium (MB and MS. The maximal yield of mycelial biomass (21,10 ± 0,82 g/l and the maximal yield in EPS (6,53 ± 0,14 g/l was achieved by using the MB medium supplemented with FC4. Besides, it was possible to develop a medium that fulfills the objective of reducing costs from $18.455 to $656 Colombian pesos for each liter of medium used, which produces (14,14 ± 0,82 g/l of biomass and (5,16 ± 0,14 g/l of EPS, using the MS medium supplemented with FC4
27 CFR 19.97 - Taxpaid spirits or wines on bonded premises.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Taxpaid spirits or wines... Miscellaneous Provisions Conveyance of Spirits Or Wines on Plant Premises § 19.97 Taxpaid spirits or wines on bonded premises. Spirits or wines on which the tax has been paid or determined may be conveyed within a...
Directory of Open Access Journals (Sweden)
Sergio Benito Hernández
2013-11-01
Full Text Available El entrenamiento de la fuerza bajo oclusión vascular se muestra como una alternativa al entrenamiento de alta intensidad. El presente estudio muestra las respuestas cardiovasculares a este tipo de entrenamiento. 10 sujetos fueron sometidos a dos protocolos de entrenamiento oclusivo diferenciados por el peso levantado, (30% del peso máximo, post30, y 70% del peso máximo, post70. Se registraron los valores de tensión arterial sistólica (TAS, diastólica (TAD y frecuencia cardiaca (FC. Los resultados evidencian disminución significativa en TAS y TAD en el grupo post30 en 7 y 13 mm Hg respectivamente en referencia a los valores basales (p<0.05, resultando un descenso muy significativo en el grupo post70, 14 y 20 mm Hg respectivamente (p<0.005. Los valores de la FC no se vieron alterados por ninguno de los protocolos experimentales (p>0.05. Los efectos de tamaño para todos los grupos resultaron triviales (d<0.25. En conclusión los resultados del presente estudios presentan una tendencia a la reducción de la tensión arterial significativa en TAS y TAD en los protocolos de entrenamiento oclusivo, resultando más notable cuando se aplica la mayor intensidad de entrenamiento. Resultan necesarios más estudios que examinen el comportamiento de los parámetros cardiovasculares tras el entrenamiento de fuerza bajo oclusión vascular.AbstractOcclusive strength training is shown like an alternative to intensive training. Present study shown cardiovascular responses to this training. 10 subjects were subjected to two occlusion training protocols, differentiated by the weight lifted (30 % of maximum weight lifted, post30, and 70 % of maximum weight lifted, post70. The values of arterial systolic tension (TAS, diastolic (TAD and heart rate (FC were recorded. The results showing a significant decline in TAS and TAD after post30 of 7 and 13 mm Hg respectively from basis values (p<0.05, resulting a very significant decline in post70 group, 14 and 20 mm Hg
29 CFR 97.22 - Allowable costs.
2010-07-01
... accounting standards that comply with cost principles acceptable to the Federal agency. [53 FR 8069, 8087... LOCAL GOVERNMENTS Post-Award Requirements Financial Administration § 97.22 Allowable costs. (a... increment above allowable costs) to the grantee or subgrantee. (b) Applicable cost principles. For each kind...
Automatic Conflict Detection on Contracts
Fenech, Stephen; Pace, Gordon J.; Schneider, Gerardo
Many software applications are based on collaborating, yet competing, agents or virtual organisations exchanging services. Contracts, expressing obligations, permissions and prohibitions of the different actors, can be used to protect the interests of the organisations engaged in such service exchange. However, the potentially dynamic composition of services with different contracts, and the combination of service contracts with local contracts can give rise to unexpected conflicts, exposing the need for automatic techniques for contract analysis. In this paper we look at automatic analysis techniques for contracts written in the contract language mathcal{CL}. We present a trace semantics of mathcal{CL} suitable for conflict analysis, and a decision procedure for detecting conflicts (together with its proof of soundness, completeness and termination). We also discuss its implementation and look into the applications of the contract analysis approach we present. These techniques are applied to a small case study of an airline check-in desk.
The effect of texture in (Bi3.5Nd0.5)(Ti2.97Nb0.03)O12 ceramics
International Nuclear Information System (INIS)
Cao, Ziping; Ding, Aili; Zheng, Xinsen; Qiu, Pingsun; Cheng, Wenxiu
2004-01-01
(Bi 3.5 Nd 0.5 ) (Ti 2.97 Nb 0.03 )O 12 ferroelectric ceramics was successfully prepared by a hot-pressing method. XRD diffraction confirms that the samples hold different texture in the sliced planes parallel and perpendicular to the hot-pressing axis, respectively. The anisotropy of ferroelectric, dielectric and piezoelectric properties were all observed in the textured ceramics. Due to the great improvement of ferroelectric and piezoelectric properties, the sample which was sliced along the direction parallel to the hot-pressing axis can be considered as a good candidate of high temperature piezoelectric materials. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Resposta cronotrópica ao teste anaeróbio máximo de corrida - MART
Directory of Open Access Journals (Sweden)
Flávio Areal Lemos
2013-06-01
Full Text Available INTRODUÇÃO: A frequência cardíaca (FC no teste anaeróbio máximo de corrida (MART expressa o comportamento autonômico cardíaco em exercício. Ainda não foi investigado se tais respostas cronotrópicas apresentam associação com o desempenho aeróbio e anaeróbio. OBJETIVOS: Descrever a resposta cronotrópica cardíaca durante o MART nos segundos iniciais de estímulo (FC ON e de recuperação (FC OFF e estabelecer a associação entre as variáveis cronotrópicas com o desempenho aeróbio e anaeróbio. MÉTODOS: Foram voluntários 13 homens assintomáticos e fisicamente ativos, com 25,1 ± 4,9 anos, 76,8 ± 12,5 kg, 178,4 ± 9,0 cm e 50,6 ± 4,1 mL×kg‑1×min‑1. Na primeira visita, após a anamnese e medidas antropométricas, foi realizado um teste cardiopulmonar de exercício (TCPE com monitoração direta dos gases expirados. Na segunda visita, foi feita uma familiarização ao MART e na terceira, o teste de MART conduzido até a exaustão. RESULTADOS: A FC de recuperação (58 ± 20 bpm comparada à FC de pico alcançada no primeiro e no último estágio de MART (39 ± 14 bpm apresentou maior inclinação, resultando em maior amplitude de variação ao longo do teste, caracterizando diferenças significativas (P = 0,0017. A FC ON apresentou entre o momento inicial, meio e final do MART diferenças significativas (inicial versus final, p = 0,007. Para FC OFF foram encontradas diferenças significativas do início com o meio (p = 0,035 e do início com o final (p = 0,005 do teste. As correlações entre as variáveis cronotrópicas e de desempenho não apresentaram significância estatística (P < 0,05, assim como com as variáveis de desempenho. CONCLUSÃO: O MART parece ser um modelo de sobrecargas fisiológicas adequado para investigação da modulação autonômica cardíaca. Observou-se atuação do sistema parassimpático mesmo em cargas supramáximas até o final do teste.
Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D.
Kapur, Rick; Della Valle, Luciana; Verhagen, Onno J H M; Hipgrave Ederveen, Agnes; Ligthart, Peter; de Haas, Masja; Kumpel, Belinda; Wuhrer, Manfred; van der Schoot, C Ellen; Vidarsson, Gestur
2015-03-01
RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions with FcγRIII, with less Fc-fucosylation strengthening the interaction. Anti-D IgG1 Fc-glycosylation patterns in 93 plasma samples from 28 male and 28 female Dutch HIDs and RhIG were analyzed with mass spectrometry. The Fc-glycosylation profiles of HIDs were evaluated with regard to their immunization history. HID sera demonstrated clearly lowered anti-D Fc-fucosylation compared to normal IgG fucosylation (93%); this was more pronounced for female than for male HIDs (47% vs. 65%, p = 0.001). RhIG preparations from seven manufacturers varied greatly in the level of Fc-fucosylation (56%-91%). The level of fucosylation slightly increased upon repeated immunization, although it remained fairly constant over time. The RhIG from the different manufacturers all demonstrated increased Fc-galactosylation (64%-82%) compared to total IgG (38%-51%). RhIG preparations vary in Fc-fucosylation and all demonstrate increased galactosylation. Despite not knowing the exact working mechanism, immunoprophylaxis could perhaps be optimized by selection of donors whose anti-D have low amounts of Fc-fucose, to increase the clearance activity of anti-D preparations, as well as high amounts of galactosylation, for anti-inflammatory effects. Implementing a biologic assay in the standardization of RhIG preparations might be considered. © 2014 AABB.
Directory of Open Access Journals (Sweden)
Abhishek Saxena
2016-12-01
Full Text Available Today monoclonal immunoglobulin gamma (IgG antibodies have become a major option in cancer therapy especially for the patients with advanced or metastatic cancers. Efficacy of monoclonal antibodies (mAbs are achieved through both its antigen binding fragment (Fab and crystallizable fragment (Fc. Fab can specifically recognize tumor associated antigen (TAA and thus modulate TAA-linked downstream signaling pathways that may lead to inhibition of tumor growth, induction of tumor apoptosis and differentiation. The Fc region can further improve mAbs’ efficacy by mediating effector functions such as antibody-dependent cellular cytotoxicity (ADCC, complement-dependent cytotoxicity (CDC and antibody dependent cell-mediated phagocytosis (ADCP. Moreover, Fc is the region interacting with the neonatal Fc receptor (FcRn in a pH-dependent manner that can slow down IgG’s degradation and extend its serum half-life. Loss of the antibody Fc region dramatically shortens its serum half-life and weakens its anti-cancer effects. Given the essential roles that the Fc region plays in the modulation of the efficacy of mAb in cancer treatment, Fc engineering has been extensively studied in the past years. This review focuses on the recent advances in therapeutic Fc engineering that modulates its related effector functions and serum half-life. We also discuss the progress made in aglycosylated mAb development that may substantially reduce cost of manufacture but maintain similar efficacies as conventional glycosylated mAb. Finally, we highlight several Fc engineering based mAbs under clinical trials.
Biacchi, Michael; Said, Nassur; Beck, Alain; Leize-Wagner, Emmanuelle; François, Yannis-Nicolas
2017-05-19
The characterization of complex protein mixtures represents one of the biggest challenge in many research fields such as biological or biopharmaceutical sciences. Out of all categories, monoclonal antibodies (mAbs) and related products drawn the most interest due to their strong therapeutic potency and specificity. Because of their intrinsic complexity due to a large number of micro-heterogeneities, there is a crucial need for analytical methods to provide comprehensive in-depth characterization of these proteins. In this work, we developed a methodology using CE-UV/MALDI-MS to perform top-down or middle-down characterization after fraction collection enrichment applied to intact protein and mAbs samples. The performance of the method was evaluated with the rapid separation of three intact protein mixture. Good robustness of CZE separation and quality of MALDI-MS spectra and MALDI-ISD spectra of each protein confirms the usefulness of sample enrichment to obtain adequate quantity of deposed protein for top-down analysis and the proof of principle of the method. In a second step, the method was applied to the middle-down characterization of Fc/2 cetuximab variants. Identification of around 9% sequence coverage of Fc/2 cetuximab fragments allows to conclude on the feasibility of the strategy for middle-down characterization of Fc/2 cetuximab variants using CE-UV/MALDI-MS. Moreover, MALDI-ISD fragmentation of Fc/2 cetuximab variants confirm separation phenomenon based on the formation of Fc/2 dimers with and without C-terminal truncation. Copyright © 2017 Elsevier B.V. All rights reserved.
41 CFR 102-74.500 - Can Federal agencies disapprove permit applications or cancel issued permits?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can Federal agencies disapprove permit applications or cancel issued permits? 102-74.500 Section 102-74.500 Public Contracts and... cancel issued permits? Yes, Federal agencies may disapprove any permit application or cancel an issued...
Pérez, S.; López, C.; Bosque, R.; Solans, X.; Font-Bardía, M.; Roig, A.; Molins, E.; van Leeuwen, P.W.N.M.; van Strijdonck, G.P.F.; Freixa, Z.
2008-01-01
The synthesis, X-ray crystal structures, and the study of the solution behavior of the palladium(II) allyl complexes [Pd(eta(3)-1R(1)-C3H4){FcCH=N-CH2-(CH2)(n)-NMe2}][PF6] {with Fc = (eta(5)-C5H5)Fe(eta(5)-C5H4), R-1 = H, and n = 2 (4) or 1 (5) or R-1 = Ph and n = 2 (6) or 1 (7)} are described. The
DEFF Research Database (Denmark)
Schmøkel, Julie; Voldum, Anders; Tsakiridou, Georgia
2017-01-01
-linked aptamer to that of aptamer alone was found using an anticoagulant activity assay measuring temporal levels of activated partial thrombin. Covalent albumin-aptamer conjugation, however, substantially compromized binding to hFcRn, to 10% affinity of that of non-conjugated WT, determined by biolayer......-life, predominately facilitated by engagement with the cellular recycling neonatal Fc receptor (FcRn), and ligand transport properties of albumin promote it as an attractive candidate to improve the pharmacokinetic profile of aptamers. This study investigates the effect of Cys34 site-selective covalent attachment...... of a factor IXa anticoagulant aptamer on aptamer functionality and human FcRn (hFcRn) engagement using recombinant human albumin (rHA) of either a wild type (WT) or an engineered human FcRn high binding variant (HB). Albumin-aptamer conjugates, connected covalently through a heterobifunctional succinimidyl 4...
32 CFR 842.97 - Referring a claim to the US Attorney or the Department of Justice.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Referring a claim to the US Attorney or the Department of Justice. 842.97 Section 842.97 National Defense Department of Defense (Continued) DEPARTMENT OF... United States (31 U.S.C. 3701, 3711-3719) § 842.97 Referring a claim to the US Attorney or the Department...
Li, Cynthia H; Narhi, Linda O; Wen, Jie; Dimitrova, Mariana; Wen, Zai-qing; Li, Jenny; Pollastrini, Joseph; Nguyen, Xichdao; Tsuruda, Trace; Jiang, Yijia
2012-12-18
The circulation half-life of a potential therapeutic can be increased by fusing the molecule of interest (an active peptide, the extracellular domain of a receptor, an enzyme, etc.) to the Fc fragment of a monoclonal antibody. For the fusion protein to be a successful therapeutic, it must be stable to process and long-term storage conditions, as well as to physiological conditions. The stability of the Fc used is critical for obtaining a successful therapeutic protein. The effects of pH, temperature, and salt on the stabilities of Escherichia coli- and Chinese hamster ovary cell (CHO)-derived IgG1 Fc high-order structure were probed using a variety of biophysical techniques. Fc molecules derived from both E. coli and CHO were compared. The IgG1 Fc molecules from both sources (glycosylated and aglycosylated) are folded at neutral pH and behave similarly upon heat- and low pH-induced unfolding. The unfolding of both IgG1 Fc molecules occurs via a multistep unfolding process, with the tertiary structure and C(H)2 domain unfolding first, followed by changes in the secondary structure and C(H)3 domain. The acid-induced unfolding of IgG1 Fc molecules is only partially reversible, with the formation of high-molecular weight species. The CHO-derived Fc protein (glycosylated) is more compact (smaller hydrodynamic radius) than the E. coli-derived protein (aglycosylated) at neutral pH. Unfolding is dependent on pH and salt concentration. The glycosylated C(H)2 domain melts at a temperature 4-5 °C higher than that of the aglycosylated domain, and the low-pH-induced unfolding of the glycosylated Fc molecule occurs at a pH ~0.5 pH unit lower than that of the aglycosylated protein. The difference observed between E. coli- and CHO-derived Fc molecules primarily involves the C(H)2 domain, where the glycosylation of the Fc resides.
The application of the psychological contract to workplace safety.
Walker, Arlene; Hutton, Dorothy M
2006-01-01
Psychological contracts of safety are conceptualized as the beliefs of individuals about reciprocal safety obligations inferred from implicit or explicit promises. Although the literature on psychological contracts is growing, the existence of psychological contracts in relation to safety has not been established. The research sought to identify psychological contracts in the conversations of employees about safety, by demonstrating reciprocity in relation to employer and employee safety obligations. The identified safety obligations were used to develop a measure of psychological contracts of safety. The participants were 131 employees attending safety training sessions in retail and manufacturing organizations. Non-participant observation was used to collect the data during safety training sessions. Content analysis was used to analyze the data. Categories for coding were established through identification of language markers that demonstrated contingencies or other implied obligations. Direct evidence of reciprocity between employer safety obligations and employee safety obligations was found in statements from the participants demonstrating psychological contracts. A comprehensive list of perceived employer and employee safety obligations was compiled and developed into a measure of psychological contracts of safety. A small sample of 33 safety personnel was used to validate the safety obligations. CONCLUSIONS AND IMPACT ON INDUSTRY: Implications of these findings for safety and psychological contract research are discussed.
2005-01-01
This document concerns the increase of the contract amounts for LHC civil-engineering construction and civil-engineering consultancy, Package 2. The Finance Committee is invited to take note of the increase of the contract amounts with: - the joint venture DRAGADOS (ES) and SELI (IT) for civil-engineering construction, LHC Package 2, for an amount of 28 087 000 Swiss francs, subject to revision, in the amount previously announced to Finance Committee (CERN/FC/4516) of 132 200 000 Swiss francs, subject to revision, bringing the total to a maximum amount of 160 287 000 Swiss francs, subject to revision. - the joint venture GIBB (GB), GEOCONSULT (AT) and SGI (CH) for the provision of civil-engineering consultancy services, LHC Package 2, for an amount of 900 000 Swiss francs, subject to revision, in the amount previously announced to Finance Committee of 13 800 000 Swiss francs, subject to revision, bringing the total to a maximum amount of 14 700 000 Swiss francs, subject to revision
Directory of Open Access Journals (Sweden)
Claudia Lucía Ariza-García
2014-06-01
Full Text Available Objetivo: Evaluar el efecto de tres duraciones de estiramiento estático pasivo, 15, 30 y 60 segundos (s para aumentar el rango de movimiento de la flexión de cadera (ROM-FC. Metodología: Ensayo Clínico Controlado Aleatorizado. Nueve estudiantes mujeres (21,7 ± 4,3 años fueron asignadas aleatoriamente a tres grupos, 15 (G15, 30 (G30 y 60 (G60 s; n = 3 en cada grupo. El estiramiento de la musculatura isquitotibial se realizó en decúbito supino, máxima flexión de cadera, rodilla extendida y dorsiflexión de pie con ayuda de una banda elástica; dos veces consecutivas en ambos miembros inferiores, tres veces/semana, por tres semanas. El resultado principal fue el cambio del ROM-FC izquierda y derecha al finalizar la intervención. Se usó la prueba t de student y el análisis ANOVA. Resultados: Las diferencias entre evaluaciones en G15 y G30 fueron estadísticamente significativas para el miembro inferior derecho. No se encontraron diferencias significativas en el grupo G60 del hemicuerpo derecho ni en grupo alguno del hemicuerpo izquierdo. Tampoco para el aumento de ROM-FC entre los tres grupos ni entre hemicuerpos. Conclusión: El estiramiento estático pasivo de 15 y 30 s de duración fue efectivo para aumentar el ROM-FC derecho. Se requieren futuros estudios con un tamaño de muestra adecuado para detectar diferencias en el aumento del ROM-FC según duración del estiramiento y hemicuerpos.
Directory of Open Access Journals (Sweden)
José Samuel Medina-Bolívar
2016-11-01
Full Text Available El cultivo de fresa es una de las opciones productivas para los agricultores, principalmente de los departamentos de Cundinamarca, Antioquia y Boyacá. La tendencia creciente hacia una agricultura cada vez más abierta al comercio mundial determina que las actividades agrícolas nacionales deben ser cada día más productivas y competitivas, esto soportado en nuevas y mejores tecnologías de producción. Dentro de estas, se cuenta el uso de diferentes sustratos con el fin de solucionar problemas como acidez, alta erosión o problemas de tipo fitosanitario que impiden la siembra de forma directa en el suelo. Teniendo en cuenta lo anterior el objetivo de la investigación fue la evaluación de diferentes sustratos orgánicos en el crecimiento y desarrollo de plantas de fresa cv ‘Albion’, bajo condiciones de campo abierto. Para la evaluación se utilizó un diseño completamente al azar con tres tratamientos siendo S1: suelo 50% + fibra de coco 50% (S:FC, S2: suelo 50% + fibra de coco 25% + cascarilla de arroz 25% (S:FC:CA y S3: suelo 50% + cascarilla de arroz 50% (S:CA, cada uno conto con tres replicaciones. Las variables evaluadas fueron masa fresca y seca de raíz y parte aérea, área foliar, clorofilas totales, numero de frutos/planta y producción g/planta. El tratamiento (S1, mostró diferencias significativas según la prueba de Tukey (P≤0.05 en la mayoría de parámetros evaluados, esto lo convierte en una alternativa para la producción de fresa cv ‘Albión’ bajo las condiciones de estudio.
Technical progress report, Contracts DE-AC02-81ER40014, 40015 and 40016
International Nuclear Information System (INIS)
1981-01-01
This Progress Report summarizes work carried out at the Nuclear Physics Laboratory of the University of Colorado from November 1, 1980 through July 31, 1981, under contracts between the University of Colorado and the United States Department of Energy. The shorter report period of nine months is due to a change to an earlier submission date this year for our proposal for support to begin February 1, 1982. Cyclotron operation, research, and development have been supported under contract DE-AC02-81ER40014. The AVF cyclotron has continued to provide reliable and versatile beams of protons, deuterons, 3 He and 4 He. A wide variety of research results in direct reactions, nuclear structure, and compound reaction mechanisms can be noted in this Progress Report, correlated in many cases to current problems in intermediate energy physics. Theoretical work on nuclear reactions, carried out under contract DE-AC02-81ER40015, has been well matched to our experimental programs in low and intermediate energy physics. One important result has been the recasting of the DWBA in an eikonal expansion suited to high energy reactions. Our efforts in intermediate energy physics, under contract DE-AC02-81ER40016, have emphasized pion scattering studies at LAMPF and TRIUMF and proton induced charge exchange reactions at IUCF. Data for an important test of hadronic charge symmetry have been completed at two energies, using elastic pion-deuteron scattering
Design of intelligent gateway control system based on AllJoyn and FC-3180
Directory of Open Access Journals (Sweden)
Chen Yanzhong
2017-02-01
Full Text Available To simplify interconnection of distributed household equipment,this design creates a spontaneous,movable,safe and configurable equipment management system and smart home layout with the open-source software framework AllJoyn,the embedded microprocessor FC-3180,the low power wireless transmission network ZigBee and mobile application platform Android.
Directory of Open Access Journals (Sweden)
Cláudio Mendes Pannuti
2003-09-01
Full Text Available A randomized clinical trial was conducted to investigate the effect of a 0.5% chlorhexidine (CHX gel on dental plaque superinfecting microorganisms in mentally handicapped patients. Thirty inmates from the institution "Casas André Luiz" were assigned to either test group (CHX gel, n = 15 or control group (placebo gel, n = 15. The gel was administered over a period of 8 weeks. Supragingival plaque samples were collected at baseline, after gel use (8 weeks and 16 weeks after baseline. The presence of Gram-negative Enterobacteriaceae, Staphylococcus and yeasts was evaluated. No significant growth of any superinfecting microorganism was observed in the CHX group, when compared to the placebo group. The results indicated that the 0.5% chlorhexidine gel did not produce an undesirable shift in these bacterial populations.Foi conduzido um ensaio clínico aleatório com objetivo de investigar o efeito do gel de clorexidina (CHX a 0,5% sobre microorganismos superinfectantes da placa bacteriana de pacientes especiais. Trinta internos da instituição "Casas André Luiz" foram aleatoriamente divididos em grupo teste (gel de CHX, n = 15 e controle (gel placebo, n = 15. O gel foi utilizado por oito semanas. Amostras de placa supragengival foram coletadas no início do estudo, após o uso do gel (oito semanas e 16 semanas após o início do estudo. Foi avaliada a presença de bacilos entéricos Gram-negativos, Staphylococcus e leveduras. Não houve diferença entre os grupos quanto à presença desses microorganismos em qualquer momento do estudo. Os resultados indicam que o gel de CHX não provocou mudanças significativas na composição desses microorganismos.
Structural characterization of the Man5 glycoform of human IgG3 Fc
Energy Technology Data Exchange (ETDEWEB)
Shah, Ishan S.; Lovell, Scott; Mehzabeen, Nurjahan; Battaile, Kevin P.; Tolbert, Thomas J. (Kansas); (HWMRI)
2017-12-01
Immunoglobulin G (IgG) consists of four subclasses in humans: IgG1, IgG2, IgG3 and IgG4, which are highly conserved but have unique differences that result in subclass-specific effector functions. Though IgG1 is the most extensively studied IgG subclass, study of other subclasses is important to understand overall immune function and for development of new therapeutics. When compared to IgG1, IgG3 exhibits a similar binding profile to Fcγ receptors and stronger activation of complement. All IgG subclasses are glycosylated at N297, which is required for Fcγ receptor and C1q complement binding as well as maintaining optimal Fc conformation. We have determined the crystal structure of homogenously glycosylated human IgG3 Fc with a GlcNAc2Man5 (Man5) high mannose glycoform at 1.8 Å resolution and compared its structural features with published structures from the other IgG subclasses. Although the overall structure of IgG3 Fc is similar to that of other subclasses, some structural perturbations based on sequence differences were revealed. For instance, the presence of R435 in IgG3 (and H435 in the other IgG subclasses) has been implicated to result in IgG3-specific properties related to binding to protein A, protein G and the neonatal Fc receptor (FcRn). The IgG3 Fc structure helps to explain some of these differences. Additionally, protein-glycan contacts observed in the crystal structure appear to correlate with IgG3 affinity for Fcγ receptors as shown by binding studies with IgG3 Fc glycoforms. Finally, this IgG3 Fc structure provides a template for further studies aimed at engineering the Fc for specific gain of function.
48 CFR 2439.107 - Contract clauses.
2010-10-01
... Departmental automated information systems or applications as they are defined in the clause. (b) The contracting officer shall insert the clause at 48 CFR 2452.239-71, Information Technology Virus Security, in... SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY 2439.107 Contract clauses. (a) The...
Directory of Open Access Journals (Sweden)
C Bellaver
2001-12-01
Full Text Available A formulação com base no conceito de proteína ideal (PI é mais eficiente quando são usados ingredientes alternativos ao milho (M e ao farelo de soja (FS. Assim, o objetivo desse trabalho foi comparar formulações de dietas utilizando o conceito de PI, usando farinha de vísceras (FV em substituição ao FS, em dietas de frangos de corte. Os tratamentos foram os seguintes: T1 = dieta com 22 % e 20% de proteína bruta (PB nas fases inicial (FI e de crescimento (FC e 3200 kcal/kg de EM durante todo experimento; T2 = energia semelhante a dieta T1 e PI à base de M e FS (1,15% de lisina digestível na FI e 0,90% de lisina digestível na FC; T3=dieta semelhante a T2, com 20 % e 25 % de substituição do FS por FV nas FI e FC, respectivamente; T4=dieta semelhante a T3, com 40 e 50 % de substituição do FS por FV, nas FI e FC, respectivamente; T5=dieta semelhante a T4, porém com balanço por aminoácidos (AA totais (1,10 e 1,00 % de lisina total nas FI e FC, respectivamente. Os resultados permitiram concluir que a formulação com base na PI é melhor do que aquela que considera a PB ou AA totais. A inclusão de 20 % FV na FI e 25 % na FC de frangos de corte, em substituição ao FS, melhorou o desempenho até os 21 dias e não alterou o desempenho até os 42 dias em dietas formuladas dentro do conceito de proteína ideal.Ideal protein (IP concept in feed formulation is more suitable when alternative ingredients to corn (C and soybean meal (SBM are used. Thus, the objective of this paper was to compare diets using IP concept and poultry offal meal (POM in substitution to SBM in broiler diets. The treatments were: T1= diets with 22% and 20 % crude protein (CP in starting phase (SP and growing phase (GP, respectively and 3200 kcal ME/kg all over the experiment; T2= similar energy to T1 and IP diet based on C and SBM (1.15% digestible lysine in SP and 0.90 % in GP; T3= similar diet to T2, with 20% and 25% of substitution of SBM by POM in SP and GP
48 CFR 970.3102-05-4 - Bonding costs.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Bonding costs. 970.3102-05... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05-4 Bonding costs. (d) The allowability of bonding costs shall be determined pursuant to 970.5228...
Directory of Open Access Journals (Sweden)
Yijun Shen
Full Text Available Blocking proprotein convertase subtilisin kexin type 9 (PCSK9 binding to low-density lipoprotein receptor (LDLR can profoundly lower plasma LDL levels. Two anti-PCKS9 monoclonal antibodies (mAbs, alirocumab and evolocumab, were approved by the FDA in 2015. The recommended dose is 75 mg to 150 mg every two weeks for alirocumab and 140mg every two weeks or 420 mg once a month for evolocumab. This study attempted to improve the pharmacokinetic properties of F0016A, an IgG1 anti-PCKS9 mAb, to generate biologically superior molecules. We engineered several variants with two or three amino acid substitutions in the Fc fragment based on prior knowledge. The Fc-modified mAbs exhibited increased binding to FcRn, resulting in prolonged serum half-life and enhanced efficacy in vivo. These results demonstrate that Fc-modified anti-PCKS9 antibodies may enable less frequent or lower dosing of antibodies by improved recycling into the blood.
Contracts Take or Pay, for supply and transport of gas
International Nuclear Information System (INIS)
Velasquez Bermudez, Jesus Maria
2000-01-01
The present article has as objective to study the effect that has the contract of supply and of transport of gas that subscribe generators agents of the electric sector with the agents of the market of the gas. The article concentrates on the study of the denominated contracts take or pay. Initially the modeling is analyzed to include the effect of the contracts of gas in the mathematical models that are used to support the works of planning. Later on is studied of optimal form to determining the prices in spot markets of the industries associated to the contracts. Finally is presented the methodology and controlled experiments that allow to identify and to quantify the macro economic effect of the contracts
Liu, Zhen; Ren, Weijun; Peng, Ping; Guo, Shaobo; Lu, Teng; Liu, Yun; Dong, Xianlin; Wang, Genshui
2018-04-01
Both high pyroelectric properties and good temperature stability of ferroelectric materials are desirable when used for applications in infrared thermal detectors. In this work, we report lead-free ternary 0.97(0.99Bi0.5Na0.5TiO3-0.01BiAlO3)-0.03K0.5Na0.5NbO3 (BNT-BA-KNN) ceramics, which not only exhibits a large pyroelectric coefficient (p ˜ 3.7 × 10-8 C cm-2 K-1) and figures of merit (Fi, Fv, and Fd) but also shows excellent thermal stable properties. At room temperature, Fi, Fv, and Fd are determined as high as 1.32 × 10-10 m/V, 2.89 × 10-2 m2/C, and 1.15 × 10-5 Pa-1/2 at 1 kHz and 1.32 × 10-10 m/V, 2.70 × 10-2 m2/C, and 1.09 × 10-5 Pa-1/2 at 20 Hz, respectively. During the temperature range of RT to 85 °C, the achieved p, Fi, Fv, and Fd do not vary too much. The high depolarization temperature and the undispersed ferroelectric-ergodic relaxor phase transition with a sharp pyroelectric coefficient peak value of ˜400 × 10-8 C cm-2 K-1 are suggested to be responsible for this thermal stability, which ensures reliable actual operation. The results reveal the BNT-BA-KNN ceramics as promising lead-free candidates for infrared thermal detector applications.
Rispens, Theo; den Bleker, Tamara H.; Aalberse, Rob C.
2010-01-01
Human IgG4 antibodies are dynamic molecules that in vivo exchange half-molecules to become bispecific antibodies. Here we show that IgG4 antibodies and IgG4 Fc fragments similarly exchange resulting in hybrid antibodies (a single Fab + Fc) with a molecular weight of ca. 100 kDa. These antibodies can
Case studies on the success or failure of futures contracts.
Directory of Open Access Journals (Sweden)
Hilary Till
2015-06-01
Full Text Available Why do some futures contracts succeed and others fail? Although the U.S. futures markets have evolved in a trial-and-error fashion, research suggests key elements have determined whether particular futures contracts succeeded or failed. This knowledge could be useful for new financial centers as they build successful futures markets. This paper shows that there are three elements that determine whether a futures contract succeeds or not: 1. There must be a commercial need for hedging; 2. A pool of speculators must be attracted to a market; and 3. Public policy should not be too adverse to futures trading
Directory of Open Access Journals (Sweden)
Brian J. Franz
2015-01-01
Full Text Available Fc gamma receptor IIB (FcγRIIB is the only Fc gamma receptor (FcγR which negatively regulates the immune response, when engaged by antigen- (Ag- antibody (Ab complexes. Thus, the generation of Ag-specific IgG in response to infection or immunization has the potential to downmodulate immune protection against infection. Therefore, we sought to determine the impact of FcγRIIB on immune protection against Francisella tularensis (Ft, a Category A biothreat agent. We utilized inactivated Ft (iFt as an immunogen. Naïve and iFt-immunized FcγRIIB knockout (KO or wildtype (WT mice were challenged with Ft-live vaccine strain (LVS. While no significant difference in survival between naïve FcγRIIB KO versus WT mice was observed, iFt-immunized FcγRIIB KO mice were significantly better protected than iFt-immunized WT mice. Ft-specific IgA in serum and bronchial alveolar lavage, as well as IFN-γ, IL-10, and TNF-α production by splenocytes harvested from iFt-immunized FcγRIIB KO, were also significantly elevated. In addition, iFt-immunized FcγRIIB KO mice exhibited a reduction in proinflammatory cytokine levels in vivo at 5 days after challenge, which correlates with increased survival following Ft-LVS challenge in published studies. Thus, these studies demonstrate for the first time the ability of FcγRIIB to regulate vaccine-induced IgA production and downmodulate immunity and protection. The immune mechanisms behind the above observations and their potential impact on vaccine development are discussed.
Dual role of Fcγ receptors in host defense and disease in Borrelia burgdorferi-infected mice
Directory of Open Access Journals (Sweden)
Alexia Anne Belperron
2014-06-01
Full Text Available Arthritis in mice infected with the Lyme disease spirochete, Borrelia burgdorferi, results from the influx of innate immune cells responding to the pathogen in the joint and is influenced in part by mouse genetics. Production of inflammatory cytokines by innate immune cells in vitro is largely mediated by Toll-like receptor (TLR interaction with Borrelia lipoproteins, yet surprisingly mice deficient in TLR2 or the TLR signaling molecule MyD88 still develop arthritis comparable to that seen in wild type mice after B. burgdorferi infection. These findings suggest that other, MyD88-independent inflammatory pathways can contribute to arthritis expression. Clearance of B. burgdorferi is dependent on the production of specific antibody and phagocytosis of the organism. As Fc receptors (FcγR are important for IgG-mediated clearance of immune complexes and opsonized particles by phagocytes, we examined the role that FcγR play in host defense and disease in B. burgdorferi-infected mice. B. burgdorferi-infected mice deficient in the Fc receptor common gamma chain (FcεRγ-/- mice harbored ~10 fold more spirochetes than similarly infected wild type mice, and this was associated with a transient increase in arthritis severity. While the elevated pathogen burdens seen in B. burgdorferi-infected MyD88-/- mice were not affected by concomitant deficiency in FcγR, arthritis was reduced in FcεRγ-/-MyD88-/- mice in comparison to wild type or single knockout mice. Gene expression analysis from infected joints demonstrated that absence of both MyD88 and FcγR lowers mRNA levels of proteins involved in inflammation, including Cxcl1 (KC, Xcr1 (Gpr5, IL-1beta, and C reactive protein. Taken together, our results demonstrate a role for FcγR-mediated immunity in limiting pathogen burden and arthritis in mice during the acute phase of B. burgdorferi infection, and further suggest that this pathway contributes to the arthritis that develops in B. burgdorferi
21 CFR 866.5530 - Immunoglobulin G (Fc fragment specific) immunological test system.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Immunoglobulin G (Fc fragment specific... Test Systems § 866.5530 Immunoglobulin G (Fc fragment specific) immunological test system. (a) Identification. An immunoglobulin G (Fc fragment specific) immunological test system is a device that consists of...
Directory of Open Access Journals (Sweden)
Heinzen Robert A
2009-05-01
Full Text Available Abstract Background The obligate intracellular bacterial pathogen Coxiella burnetii causes the zoonosis Q fever. The intracellular niche of C. burnetii has led to the assumption that cell-mediated immunity is the most important immune component for protection against this pathogen. However, passive immunization with immune serum can protect naïve animals from challenge with virulent C. burnetii, indicating a role for antibody (Ab in protection. The mechanism of this Ab-mediated protection is unknown. Therefore, we conducted a study to determine whether Fc receptors (FcR or complement contribute to Ab-mediated immunity (AMI to C. burnetii. Results Virulent C. burnetii infects and replicates within human dendritic cells (DC without inducing their maturation or activation. We investigated the effects of Ab opsonized C. burnetii on human monocyte-derived and murine bone marrow-derived DC. Infection of DC with Ab-opsonized C. burnetii resulted in increased expression of maturation markers and inflammatory cytokine production. Bacteria that had been incubated with naïve serum had minimal effect on DC, similar to virulent C. burnetii alone. The effect of Ab opsonized C. burnetii on DC was FcR dependent as evidenced by a reduced response of DC from FcR knockout (FcR k/o compared to C57Bl/6 (B6 mice. To address the potential role of FcR in Ab-mediated protection in vivo, we compared the response of passively immunized FcR k/o mice to the B6 controls. Interestingly, we found that FcR are not essential for AMI to C. burnetii in vivo. We subsequently examined the role of complement in AMI by passively immunizing and challenging several different strains of complement-deficient mice and found that AMI to C. burnetii is also complement-independent. Conclusion Despite our data showing FcR-dependent stimulation of DC in vitro, Ab-mediated immunity to C. burnetii in vivo is FcR-independent. We also found that passive immunity to this pathogen is independent of
Fox, Michael D; Halko, Mark A; Eldaief, Mark C; Pascual-Leone, Alvaro
2012-10-01
Both resting state functional magnetic resonance imaging (fcMRI) and transcranial magnetic stimulation (TMS) are increasingly popular techniques that can be used to non-invasively measure brain connectivity in human subjects. TMS shows additional promise as a method to manipulate brain connectivity. In this review we discuss how these two complimentary tools can be combined to optimally study brain connectivity and manipulate distributed brain networks. Important clinical applications include using resting state fcMRI to guide target selection for TMS and using TMS to modulate pathological network interactions identified with resting state fcMRI. The combination of TMS and resting state fcMRI has the potential to accelerate the translation of both techniques into the clinical realm and promises a new approach to the diagnosis and treatment of neurological and psychiatric diseases that demonstrate network pathology. Copyright © 2012 Elsevier Inc. All rights reserved.
The production of KIR-Fc fusion proteins and their use in a multiplex HLA class I binding assay.
Hilton, Hugo G; Moesta, Achim K; Guethlein, Lisbeth A; Blokhuis, Jeroen; Parham, Peter; Norman, Paul J
2015-10-01
Soluble recombinant proteins that comprise the extracellular part of a surface expressed receptor attached to the Fc region of an IgG antibody have facilitated the determination of ligand specificity for an array of immune system receptors. Among such receptors is the family of killer cell immunoglobulin-like receptors (KIR) that recognize HLA class I ligands. These receptors, expressed on natural killer (NK) cells and T cells, play important roles in both immune defense and placental development in early pregnancy. Here we describe a method for the production of two domain KIR-Fc fusion proteins using baculovirus infected insect cells. This method is more scalable than traditional mammalian cell expression systems and produces efficiently folded proteins that carry posttranslational modifications found in native KIR. We also describe a multiplex binding assay using the Luminex platform that determines the avidity and specificity of two domain KIR-Fc for a panel of microbeads, each coated with one of 97 HLA class I allotypes. This assay is simple to perform, and represents a major improvement over the assays used previously, which were limited in the number of KIR and HLA class I combinations that could be assayed at any one time. The results obtained from this assay can be used to predict the response of NK cell and T cells when their KIR recognize HLA class I. Copyright © 2015 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Vural, B.; Erdinc, O.; Uzunoglu, M. [Department of Electrical Engineering, Yildiz Technical University, Istanbul 34349 (Turkey)
2010-12-15
Fuel cells (FC) are widely recognized as one of the most promising technologies to meet future power requirements of vehicular applications. However, a FC system combined with an energy storage system (ESS) can perform better for vehicle propulsion as considering several points. As the additional ESS can fulfill the transient power demand fluctuations, the FC system can be downsized to fit the base power demand without facing peak loads. Besides, braking energy can be recovered by the ESS. Interfacing of traction drive requirements with characteristics and modes of operation of on-board generation units and ESSs calls for suitable power electronic converter configuration. In this paper, a FC/UC hybrid vehicular power system using a multi-input converter-based power interface is proposed. The applied power interface topology ensures the active power sharing and DC link voltage stabilization for the hybrid vehicular system. The mathematical and electrical models of the hybrid vehicular system are developed in detail and simulated using MATLAB registered, Simulink registered and SimPowerSystems registered environments. (author)
International Nuclear Information System (INIS)
Vural, B.; Erdinc, O.; Uzunoglu, M.
2010-01-01
Fuel cells (FC) are widely recognized as one of the most promising technologies to meet future power requirements of vehicular applications. However, a FC system combined with an energy storage system (ESS) can perform better for vehicle propulsion as considering several points. As the additional ESS can fulfill the transient power demand fluctuations, the FC system can be downsized to fit the base power demand without facing peak loads. Besides, braking energy can be recovered by the ESS. Interfacing of traction drive requirements with characteristics and modes of operation of on-board generation units and ESSs calls for suitable power electronic converter configuration. In this paper, a FC/UC hybrid vehicular power system using a multi-input converter-based power interface is proposed. The applied power interface topology ensures the active power sharing and DC link voltage stabilization for the hybrid vehicular system. The mathematical and electrical models of the hybrid vehicular system are developed in detail and simulated using MATLAB (registered) , Simulink (registered) and SimPowerSystems (registered) environments.
Directory of Open Access Journals (Sweden)
Se Jin Im
Full Text Available Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc consisting of IgD and IgG4, and tested its function using erythropoietin (EPO conjugate, EPO-hyFc. Despite low amino acid homology (20.5% between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H, a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last. Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.
Im, Se Jin; Yang, Sang In; Yang, Se Hwan; Choi, Dong Hoon; Choi, So Young; Kim, Hea Sook; Jang, Do Soo; Jin, Kyeong Sik; Chung, Yo-Kyung; Kim, Seung-Hee; Paik, Sang Hoon; Park, Yoo Chang; Chung, Moon Koo; Kim, Yong Bum; Han, Kang-Hyun; Choi, Kwan Yong; Sung, Young Chul
2011-01-01
Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc) consisting of IgD and IgG4, and tested its function using erythropoietin (EPO) conjugate, EPO-hyFc. Despite low amino acid homology (20.5%) between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H), a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H) not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last)). Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.
NEW ROLES FOR FC RECEPTORS IN NEURODEGENERATION-THE IMPACT ON IMMUNOTHERAPY FOR ALZHEIMER’S DISEASE
Directory of Open Access Journals (Sweden)
James P. Fuller
2014-08-01
Full Text Available There are an estimated 18 million Alzheimer’s disease (AD sufferers worldwide and with no disease modifying treatment currently available, development of new therapies represents an enormous unmet clinical need. AD is characterised by episodic memory loss followed by severe cognitive decline and is associated with many neuropathological changes. AD is characterised by deposits of amyloid beta (Aβ, neurofibrillary tangles, and neuroinflammation. Active immunisation or passive immunisation against Aβ leads to the clearance of deposits in transgenic mice expressing human Aβ. This clearance is associated with reversal of associated cognitive deficits, but these results have failed to translate to humans, with both active and passive immunotherapy failing to improve memory loss. One explanation for these observations is that certain anti-Aβ antibodies mediate damage to the cerebral vasculature limiting the top dose and potentially reducing efficacy. Fc gamma receptors (Fcγ are a family of immunoglobulin like receptors which bind to the Fc portion of IgG, and mediate the response of effector cells to immune complexes. Data from both mouse and human studies suggest that cross-linking Fc receptors by therapeutic antibodies and the subsequent pro-inflammatory response mediates the vascular side effects seen following immunotherapy. Increasing evidence is emerging that Fc receptor expression on CNS resident cells, including microglia and neurons, is increased during aging and functionally involved in the pathogenesis of age-related neurodegenerative diseases. We propose that increased expression and ligation of Fc receptors in the CNS, either by endogenous IgG or therapeutic antibodies, has the potential to induce vascular damage and exacerbate neurodegeneration. To produce safe and effective immunotherapies for AD and other neurodegenerative diseases it will be vital to understand the role of Fc receptors in the healthy and diseased brain.
Directory of Open Access Journals (Sweden)
Riviana Roberta de Souza Loureiro
2006-01-01
Full Text Available O objetivo do presente trabalho foi avaliar o desempenho zootécnico e as características de carcaça de frangos de corte, alimentados com dietas contendo farinha de resíduo do processamento de camarões (FC. Foram utilizados 240 pintos de um dia de idade, distribuídos em um delineamento experimental inteiramente casualizado, sendo 5 tratamentos (níveis de inclusão de FC: 0, 3, 6, 9 e 12% em rações a base de milho e farelo de soja com 4 repetições e 12 aves por unidade experimental. Os níveis de inclusão da FC proporcionaram efeito quadrático apenas para o ganho de peso, demonstrando que os melhores níveis de inclusão na dieta foram de 5,46% e 5,87%, nos períodos de 1 a 21 e 22 a 42 dias de idade, respectivamente, melhorando, inclusive, a pigmentação na carcaça das avesThis experiment was to evaluate the performance of broiler chickens feed with different levels of shrimp meal (SM in their diet. In this experiment 240 broiler chickens were distributed at a complete randomized design in five treatments and four replications of 12 broiler chickens per experimental unit. The levels of SM were 0, 3, 6, 9 e 12% added to zea mays and soybean-meal ration based. These rations were fed to 1-day-old broiler chicks for 6 weeks (3 weeks of starter rations and 3 weeks of finished ration. Only the weight gain presented significant difference with effects on shrimp meal levels in the ration. The shrimp waste meal (Litopenaeus vannamei resulted in a quadratic effect (P<0.05, where the best level included was 5.46 and 5.87% for 1-21 and 22-42 day-old, respectively. The increasing levels of SM inclusion improved the pigmentation of the birds’ food-pad
APC targeting enhances immunogenicity of a novel multistage Fc-fusion tuberculosis vaccine in mice.
Soleimanpour, Saman; Farsiani, Hadi; Mosavat, Arman; Ghazvini, Kiarash; Eydgahi, Mohammad Reza Akbari; Sankian, Mojtaba; Sadeghian, Hamid; Meshkat, Zahra; Rezaee, Seyed Abdolrahim
2015-12-01
Numerous studies have demonstrated that targeting immunogens to FcγR on antigen-presenting cells (APCs) can selectively uptake and increase cellular immunity in vitro and in vivo. Therefore, the present study was conducted to evaluate immunogenicity of a novel multistage tuberculosis vaccine, a combination of an early and a dormant immunogenic protein, ESAT6 and HspX, fused to Fcγ2a fragment of mouse IgG2a to target all forms of tuberculosis. Codon-optimized genes consisting of ESAT6, a linker, and HspX fused either to mouse Fcγ2a (ESAT6:HspX:mFcγ2a) or 6× His-tag (ESAT6:HspX:His) were synthesized. The resulting proteins were then produced in Pichia pastoris. The fusion proteins were separately emulsified in dimethyldioctadecylammonium bromide(DDA)-trehalose-6,6-dibehenate(TDB) adjuvant, and their immunogenicity with and without bacille Calmette-Guérin (BCG) was assessed in C57BL/6 mice. Th1, Th2, Th17, and T-reg cytokine patterns were evaluated using the ELISA method. Both multistage vaccines induced very strong IL-12 and IFN-γ secretion from splenic cells; the Fc-tagged subunit vaccine induced a more effective Th1 immune response (IFN-γ, 910 pg/mL, and IL-12, 854 pg/mL) with a very low increase in IL-17 (∼0.1 pg/mL) and IL-4 (37 pg/mL) and a mild increase in TGF-β (543 pg/mL) compared to the BCG or ESAT6:HspX:His primed and boosted groups. The production of IFN-γ to ESAT6:HspX:Fcγ2a was very consistent and showed an increasing trend for IL-12 compared to the BCG or ESAT6:HspX:His primed and boosted groups. Fcγ2a used as a delivery vehicle supported the idea of selective uptake, inducing cross-presentation and forming a proper anti-tuberculosis response in context of Th1/Th2 and Th17/T-reg balances, which is important for protection and prevention of damage.
Directory of Open Access Journals (Sweden)
Regina Heloisa Maciel
2010-10-01
con los cuales los profesionales mantenían vínculos, buscando estimar los trayectos realizados por los médicos para cumplir los contratos de trabajo y su carga horaria semanal. RESULTADOS: De los 7.008 médicos vinculados al Estado, 3,751 (53,5% poseían entre dos a cuatro vínculos, y 39 (0,6% de 11 a 20 vínculos. Un profesional poseía 20 vínculos. Más de la mitad (51,9% de los médicos poseían vínculos de trabajo que, al sumarse, totalizaban una jornada semanal por encima de 40 horas y 27,0% (1.894 mantenían vínculos en más de un municipio. CONCLUSIONES: Para aumentar las ganancias con su trabajo los médicos articulan varios empleos, ejerciendo la profesión en locales diferentes en un constante ir y venir, inclusive en variados municipios, contribuyendo a la precarización de la calidad de sus vidas y, consecuentemente, el sistema de salud.OBJECTIVE: To analyze the multiple job contracts of physicians in the Brazilian National Health System in the State of Ceará. METHODS: Documental research was performed about the work contracts of the physicians, based on data of health professional contracts in the municipalities of Ceará state, Northeastern Brazil, in 2008. Indices were created for the quantity of contracts of each physician, as well as the municipalities where each physician maintained work contracts. The distances between the municipalities where they worked was calculated in order to estimate the total weekly hours of work. RESULTS: Of the 7,008 physicians employed by the Ceará state, 3,751 (53.5% maintain between two and four job contracts and 39 (0.6% between 11 and 20 contracts. One professional maintained 20 contracts. More than half (51.9% of the physicians had work contracts that when summed totaled more than 40 weekly working hours and 27.0% (1,894 maintained job contracts with more than one municipality. CONCLUSIONS: In order to increase their work income, physicians undertake various jobs, practicing their profession in different
FcγRIIb on myeloid cells rather than on B cells protects from collagen-induced arthritis.
Yilmaz-Elis, A Seda; Ramirez, Javier Martin; Asmawidjaja, Patrick; van der Kaa, Jos; Mus, Anne-Marie; Brem, Maarten D; Claassens, Jill W C; Breukel, Cor; Brouwers, Conny; Mangsbo, Sara M; Boross, Peter; Lubberts, Erik; Verbeek, J Sjef
2014-06-15
Extensive analysis of a variety of arthritis models in germline KO mice has revealed that all four receptors for the Fc part of IgG (FcγR) play a role in the disease process. However, their precise cell type-specific contribution is still unclear. In this study, we analyzed the specific role of the inhibiting FcγRIIb on B lymphocytes (using CD19Cre mice) and in the myeloid cell compartment (using C/EBPαCre mice) in the development of arthritis induced by immunization with either bovine or chicken collagen type II. Despite their comparable anti-mouse collagen autoantibody titers, full FcγRIIb knockout (KO), but not B cell-specific FcγRIIb KO, mice showed a significantly increased incidence and severity of disease compared with wild-type control mice when immunized with bovine collagen. When immunized with chicken collagen, disease incidence was significantly increased in pan-myeloid and full FcγRIIb KO mice, but not in B cell-specific KO mice, whereas disease severity was only significantly increased in full FcγRIIb KO mice compared with incidence and severity in wild-type control mice. We conclude that, although anti-mouse collagen autoantibodies are a prerequisite for the development of collagen-induced arthritis, their presence is insufficient for disease development. FcγRIIb on myeloid effector cells, as a modulator of the threshold for downstream Ab effector pathways, plays a dominant role in the susceptibility to collagen-induced arthritis, whereas FcγRIIb on B cells, as a regulator of Ab production, has a minor effect on disease susceptibility. Copyright © 2014 by The American Association of Immunologists, Inc.
Fc receptor gamma subunit polymorphisms and systemic lupus erythematosus
International Nuclear Information System (INIS)
Al-Ansari, Aliya; Ollier, W.E.; Gonzalez-Gay, Miguel A.; Gul, Ahmet; Inanac, Murat; Ordi, Jose; Teh, Lee-Suan; Hajeer, Ali H.
2004-01-01
To investigate the possible association between Fc receptor gamma polymorphisms and systemic lupus erythematosus (SLE). We have investigated the full FcR gamma gene for polymorphisms using polymerase chain reaction (PCR)-single strand confirmational polymorphisms and DNA sequencing .The polymorphisms identified were genotype using PCR-restriction fragment length polymorphism. Systemic lupus erythematosus cases and controls were available from 3 ethnic groups: Turkish, Spanish and Caucasian. The study was conducted in the year 2001 at the Arthritis Research Campaign, Epidemiology Unit, Manchester University Medical School, Manchester, United Kingdom. Five single nucleotide polymorphisms were identified, 2 in the promoter, one in intron 4 and, 2 in the 3'UTR. Four of the 5 single nucleotide polymorphisms (SNPs) were relatively common and investigated in the 3 populations. Allele and genotype frequencies of all 4 investigated SNPs were not statistically different cases and controls. fc receptor gamma gene does not appear to contribute to SLE susceptibility. The identified polymorphisms may be useful in investigating other diseases where receptors containing the FcR gamma subunit contribute to the pathology. (author)
ACQUA97 - a Fortran subroutine to evaluate the IAPWS-IF97 equations of state for water and steam
International Nuclear Information System (INIS)
Veloso, Marcelo A.; Dias, Marcio S.; Fortini, Maria Auxiliadora
2007-01-01
Fundamental to subroutine ACQUA97 is the IAPWS-IF97 formulation for the thermodynamic properties of water and steam adopted by the International Association for the Properties of Water and Steam (IAPWS) in 1997. This new formulation is designed specifically for industrial applications, and replaces the previous industrial formulation, IFC-67, that has formed the basis of steam tables used in many areas of steam power industry throughout the world since the late 1960's. ACQUA97 has been programmed to compute the thermodynamic properties of water and steam (pressure, temperature, specific volume, specific entropy, specific enthalpy, and internal specific energy) and their main first partial derivatives for several combinations of two independent variables. One of the independent variable is either pressure or temperature. Vapor-liquid saturation properties are calculated at specified temperature or pressure. Transport properties (dynamic viscosity and thermal conductivity) and vapor-liquid surface tension are also calculated with formulations adopted by IAPWS. Any of the above mentioned thermophysical properties can be computed by this single subroutine from a simple main program supplied by the user. ACQUA97 might be very useful to those who deal with design and evaluation of thermal power plants. (author)
National Research Council Canada - National Science Library
Jackson, Jr, Carl J
2007-01-01
.... The purpose of this research project is to analyze the 314th Contracting Squadron contracting processes and requirement target areas for improvement efforts by the application of the Contract Management Maturity Model (CMMM...
Seder, R A; Paul, W E; Dvorak, A M; Sharkis, S J; Kagey-Sobotka, A; Niv, Y; Finkelman, F D; Barbieri, S A; Galli, S J; Plaut, M
1991-01-01
Splenic and bone marrow cells from normal mice, and from mice that have been polyclonally activated by injection of anti-IgD antibody, contain cells that produce interleukin 4 (IL-4) in response to crosslinkage of Fc epsilon receptors (Fc epsilon R) or Fc gamma R or to ionomycin. Isolated Fc epsilon R+ cells have recently been shown to contain all of the IL-4-producing capacity of the nonlymphoid compartment of spleen and bone marrow. Here, purified Fc epsilon R+ cells are shown to be enriche...
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
2009-01-01
though the effort and expense increase exponentially as higher levels of nca Lu-177 are required, with more experience, these methods would be expected to be optimized and automated. Effective clinical results of targeted therapy exemplified with Lu-177-DOTAT-TOC and other peptides have been widely reported for neuroendocrine tumors. For this application, SA of probably > 10 Ci/mg is required. For arthritis therapy with Lu-177-EDTMP, much lower SA is sufficient (∼ 0.5 Ci Lu-177/mg). Although not yet realized, the unique opportunity to produce high activity levels/high SA Lu-177 essentially anywhere in the world would be expected to catalyze broader clinical use of Lu-177. In fact, this is a unique situation where production capabilities for both HSA and LSA Lu-177 far exceed current demand. The goals of this presentation are to discuss the issues associated with the routine production and processing of high activity levels of lutetium-177 and current and expected clinical applications. Research at the Oak Ridge National Laboratory (ORNL) is supported by the U.S. Department of Energy (DOE) under contract DE-AC05-00OR22725 with UT-Battelle, LLC. 'The submitted manuscript has been authored by a contractor of the U.S. Government under contract DE-AC05-00OR22725. Accordingly, the U.S. Government retains a nonexclusive, royalty-free license to publish or reproduce the published form of this contribution, or allow others to do so, for U.S. Government purposes.' (author)
Inhibition of B cell proliferation by antisense DNA to both alpha and beta forms of Fc epsilon R II.
Bhatti, L; Behle, K; Stevens, R H
1992-10-01
Epstein-Barr Virus (EBV) infection activates B lymphocyte proliferation through partially understood mechanisms, resulting in phenotypic changes, including the appearance of new antigens. One such antigen is Fc epsilon R II/CD-23 which may be relevant for B cell proliferation. We have used anti-sense oligonucleotides to study the importance of the two forms of this molecule for proliferation in the EBV-transformed, Fc epsilon R II +ve lymphoblastoid B cell line, RPMI 8866. Anti-sense oligodeoxynucleotides were generated to the two forms of Fc epsilon R II; Fc epsilon R IIa (alpha) and IIb (beta) which differ only in their intracytoplasmic domains. Addition of increasing concentrations of anti-sense oligonucleotides, ranging from 1 to 30 microM, significantly decreased cellular proliferation as measured by the incorporation of [3H]thymidine (inhibition range 8-88%). Optimum inhibition of cellular proliferation was apparent at 15 microM concentration of both anti-sense Fc epsilon R IIa and IIb (Fc epsilon R IIa, mean +/- SE = 75 +/- 7% inhibition, p less than 0.001; Fc epsilon R IIb, mean +/- SE = 71 +/- 7% inhibition, p less than 0.001). Anti-sense oligonucleotides complementary to the common part of Fc epsilon R II resulted in a similar inhibition of proliferation. Sense oligonucleotides did not induce significant inhibition. Preincubation of sense and anti-sense oligonucleotides resulted in an abrogation of proliferation inhibition. Moreover, none of these oligonucleotides had any effect on a Fc epsilon R II -ve cell line. Incubation with both anti-sense IIa and IIb resulted in additive, but not synergistic inhibition of proliferation. Addition of soluble Fc epsilon R II did not reverse inhibition of proliferation, suggesting that membrane-bound or intracellular rather than soluble Fc epsilon R II was important for the induced proliferation. Analysis of cell surface expression for Fc epsilon II indicated that while there was a pronounced effect on cell number
Energy Technology Data Exchange (ETDEWEB)
Lehmann, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1959-06-15
Isothermal and continuous cooling transformations process have been established on uranium-molybdenum alloys containing 0,5 to 4 w% Mo. Transformations process of the {beta} and {gamma} solid solutions are described. These processes depend upon molybdenum concentration. Out of the {beta} solid solution phase appears an eutectoid decomposition of {beta} to ({alpha} + {gamma}) or the formation of a martensitic phase {alpha}''. The {gamma} solid solution shows a decomposition of {gamma} to ({alpha} + {gamma}) or ({alpha} + {gamma}'), or a formation of martensitic phases a' or a'{sub b}. The U-Mo equilibrium diagram is discussed, particularly in low concentrations zones. Limits between domains ({alpha} + {gamma}) and ({beta} + {gamma}), ({beta} + {gamma}) and {gamma}, ({beta} + {gamma}) and {beta}, have been determined. (author) [French] Les processus des transformations isothermes, et au cours de refroidissements continus ont ete etablis sur les alliages uranium-molybdene de 0,5 a 4 % en poids de Mo. Ceci a permis de mettre en evidence les processus des transformations de solutions solides {beta} et {gamma}, differents suivant la teneur en molybdene de l'alliage. Dans le premier cas il y a decomposition eutectoide de {beta} en ({alpha} + {gamma}) ou formations d'une phase martensitique {alpha}''. Dans le second cas il y a decomposition de {gamma} soit en ({alpha} + {gamma}) soit en ({alpha} + {gamma}') suivant la temperature, ou bien formation des phases martensitiques {alpha}' ou {alpha}'{sub b}. Le diagramme d'equilibre, uranium-molybdene est sujet a de nombreuses controverses, en particulier dans la zone des faibles concentrations. Les limites entre les domaines ({alpha} + {gamma}) et ({beta} + {gamma}), ({beta} + {gamma}) et {gamma}, ({beta} + {gamma}) et {beta}, ont ete determinees. (auteur)
25 CFR 900.127 - What can be included in the Indian tribe or tribal organization's contract budget?
2010-04-01
..., taking into consideration the terms of the contract and the requirements of the Act and any other applicable law; (2) The costs of preparing the contract proposal and supporting cost data; (3) The costs... construction contract to make a reasonable profit, taking into consideration the risks associated with carrying...
Tanigaki, Keiji; Chambliss, Ken L.; Yuhanna, Ivan S.; Sacharidou, Anastasia; Ahmed, Mohamed; Atochin, Dmitriy N.; Huang, Paul L.
2016-01-01
Modest elevations in C-reactive protein (CRP) are associated with type 2 diabetes. We previously revealed in mice that increased CRP causes insulin resistance and mice globally deficient in the CRP receptor Fcγ receptor IIB (FcγRIIB) were protected from the disorder. FcγRIIB is expressed in numerous cell types including endothelium and B lymphocytes. Here we investigated how endothelial FcγRIIB influences glucose homeostasis, using mice with elevated CRP expressing or lacking endothelial FcγRIIB. Whereas increased CRP caused insulin resistance in mice expressing endothelial FcγRIIB, mice deficient in the endothelial receptor were protected. The insulin resistance with endothelial FcγRIIB activation was due to impaired skeletal muscle glucose uptake caused by attenuated insulin delivery, and it was associated with blunted endothelial nitric oxide synthase (eNOS) activation in skeletal muscle. In culture, CRP suppressed endothelial cell insulin transcytosis via FcγRIIB activation and eNOS antagonism. Furthermore, in knock-in mice harboring constitutively active eNOS, elevated CRP did not invoke insulin resistance. Collectively these findings reveal that by inhibiting eNOS, endothelial FcγRIIB activation by CRP blunts insulin delivery to skeletal muscle to cause insulin resistance. Thus, a series of mechanisms in endothelium that impairs insulin movement has been identified that may contribute to type 2 diabetes pathogenesis. PMID:27207525
Directory of Open Access Journals (Sweden)
George N Cox
Full Text Available Previously we showed that granulocyte colony-stimulating factor (G-CSF in vitro bioactivity is preserved when the protein is joined via a flexible 7 amino acid linker to an immunoglobulin-1 (IgG1-Fc domain and that the G-CSF/IgG1-Fc fusion protein possessed a longer circulating half-life and improved hematopoietic properties compared to G-CSF in normal rats. We have extended this analysis by comparing the relative hematopoietic potencies of G-CSF/IgG1-Fc to G-CSF in normal mice and to G-CSF and polyethylene glycol (PEG -modified G-CSF in neutropenic rats. Mice were treated for 5 days using different doses and dosing regimens of G-CSF/IgG1-Fc or G-CSF and circulating neutrophil levels in the animals measured on Day 6. G-CSF/IgG1-Fc stimulated greater increases in blood neutrophils than comparable doses of G-CSF when administered using daily, every other day or every third day dosing regimens. In rats made neutropenic with cyclophosphamide, G-CSF/IgG1-Fc accelerated recovery of blood neutrophils to normal levels (from Day 9 to Day 5 when administered as 5 daily injections or as a single injection on Day 1. By contrast, G-CSF accelerated neutrophil recovery when administered as 5 daily injections, but not when administered as a single injection. G-CSF/IgG1-Fc was as effective as PEG-G-CSF at accelerating neutrophil recovery following a single injection in neutropenic rats. G-CSF/IgG1-Fc and G-CSF/IgG4-Fc fusion proteins in which the 7 amino acid linker was deleted also were effective at accelerating neutrophil recovery following a single injection in neutropenic rats. These studies confirm the enhanced in vivo hematopoietic properties of G-CSF/IgG-Fc fusion proteins.
Processing and characterization of AlCoFeNiXTi0,5 (X = Mn, V) high entropy alloys
International Nuclear Information System (INIS)
Triveno Rios, C.; Kiminami, C.S.
2014-01-01
The microstructure of high entropy alloys consists of solid solution phases with FC and BCC simple structures, contrary to classical metallurgy where they form complex structures of intermetallic compounds. Because of this they have several attractive properties for engineering applications. In this work the AlCoFeNiMnTi 0,5 and AlCoFeNiVTi 0,5 alloys were processed by melting arc. Since the main objective was the microstructural and mechanical characterization of ingots as-cast. The alloys were characterized by scanning electron microscopy, X-ray diffraction, microhardness and cold compression test. The results showed that the microstructure consists mainly of dendrites and interdendritic regions consisting of metastable crystalline phases. It was also observed that the AlCoFeNiVTi 0,5 alloy showed better mechanical properties than the AlCoFeNiMnTi 0,5 alloy. This may be associated with differences in the parameters of formation of simple solid solution phases between the two alloys. (author)
Nagashima, Hiroaki; Ootsubo, Michiko; Fukazawa, Mizuki; Motoi, Sotaro; Konakahara, Shu; Masuho, Yasuhiko
2011-04-01
We previously reported that chimeric monoclonal antibodies (mAbs) with tandemly repeated Fc domains, which were developed by introducing tandem repeats of Fc domains downstream of 2 Fab domains, augmented binding avidities for all Fcγ receptors, resulting in enhanced antibody (Ab)-dependent cellular cytotoxicity. Here we investigated regarding Ab-dependent cellular phagocytosis (ADCP) mediated by these chimeric mAbs, which is considered one of the most important mechanisms that kills tumor cells, using two-color flow cytometric methods. ADCP mediated by T3-Ab, a chimeric mAb with 3 tandemly repeated Fc domains, was 5 times more potent than that by native anti-CD20 M-Ab (M-Ab hereafter). Furthermore, T3-Ab-mediated ADCP was resistant to competitive inhibition by intravenous Ig (IVIG), although M-Ab-mediated ADCP decreased in the presence of IVIG. An Fcγ receptor-blocking study demonstrated that T3-Ab mediated ADCP via both FcγRIA and FcγRIIA, whereas M-Ab mediated ADCP exclusively via FcγRIA. These results suggest that chimeric mAbs with tandemly repeated Fc domains enhance ADCP as well as ADCC, and that Fc multimerization may significantly enhance the efficacy of therapeutic Abs. Copyright © 2010 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
2010-10-01
...— (1) A request in writing regarding the contract or transfer is submitted to the Commandant before the contract is executed or the transfer is completed; and (2) The Commandant notifies the laboratory in... SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF...
Quality management and quality assurance contracts
International Nuclear Information System (INIS)
Teichler, M.
1991-01-01
Quality assurance contracts belong to the most important instruments of quality management systems. As a result of such contracts, quality control is to be done not only by the buyer, but is made a task to be fulfilled by the manufacturer. The author of the article shows that quality assurance contracts do change the contractual relationship between supplier and buyer, but have no effect on economic and practical conditions. This is so because quality assurance contracts apply only to warranty claims, which play a subordinate role in the legal relationship between producer and buyer, or producer and consumer, as compared to the claims for damages arising out of the contracts. (orig.) [de
17 CFR 8.05 - Enforcement staff.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Enforcement staff. 8.05... staff. (a) Each exchange shall establish an adequate enforcement staff which shall be authorized by the... staff shall consist of employees of the exchange and/or persons hired on a contract basis. It may not...
La transición de fase I4/mcm→Pm3m en Sr0.5Ba0.5HfO3-δ
Directory of Open Access Journals (Sweden)
Lamas, D.
2001-08-01
Full Text Available The effect of partial substitution of cations in AMO3 compounds have been studied because the physical properties and applications of these materials can be improved. In particular we are interested in the Sr1-xBaxHfO3 family. In SrHfO3 the phase transition to cubic structure has been observed to occur when the angle between two consecutive oxygen octahedra tends to zero. Instead in BaHfO3 no phase transition was observed. These facts were attributed to depend on the atomic radius of A cation. In this contribution the study of Sr0.5Ba0.5HfO3 oxide is shown. The compound was prepared by the high temperature solid state reaction method and analyzed by X-ray diffraction and Perturbed Angular Correlation (PAC Spectroscopy at different temperatures. Diffraction studies revealed that about 400-420º C a structural phase transition from I4/mcm to Pm3m occurred by tending to zero the rotation angle. By PAC this transition was also observed. In the cubic phase the electric field gradient EFG measured were produced by defects. The same model applied to interpreted the results of BaTi1-xHfxO3 and the atomic positions determined by X-ray diffraction were used. This calculation reproduces reasonably the temperature dependence of the EFG measured by PAC.Los AMO3, llamados perovskitas, forman una gran familia de compuestos que presentan a su vez diversas propiedades físicas así como enormes aplicaciones tecnológicas. Es posible expandir esta familia y sus propiedades y aplicaciones, sustituyendo los cationes Ay M originales por diferentes A’ y M’. En este trabajo presentamos el estudio del compuesto Sr1-xBaxHfO3 con x=0.5. El óxido fue preparado por el método de reacción en fase sólida. La muestra fue analizada por difracción de Rayos X y por espectroscopía de Correlaciones Angulares Perturbadas (PAC a diferentes temperaturas. El estudio cristalográfico del material reveló que entre 400 y 420ºC se produce la transición de fase de estructura I4
Directory of Open Access Journals (Sweden)
Luis Felipe Casado
2011-08-01
Full Text Available Objetivos: Evaluar el coste-efectividad del esquema de rituximab, fludarabina y ciclofosfamida (R-FC en comparación con el de fludarabina y ciclofosfamida (FC en dos tipos de pacientes con leucemia linfática crónica (LLC: no tratados previamente o bien en recidiva/resistentes al tratamiento previo. Métodos: Dos modelos de Markov, utilizando los resultados publicados de superviviencia libre de progresión (SLP de pacientes con LLC tratados con R-FC o FC en primera o segunda línea, las tasas de progresión de la enfermedad y las tasas de mortalidad en España. A los estados de SLP y progresión se les asignaron utilidades obtenidas en un estudio sobre LLC. Los costes de los medicamentos y de los tratamientos de soporte, así como los años de vida ajustados por calidad (AVAC, se estimaron para un periodo de 10 años. Se efectuaron análisis de sensibilidad univariados y probabilísticos (Monte Carlo. Resultados: La adición de rituximab a la quimioterapia con FC aumentó los años de vida ganados (AVG y los AVAC tanto en primera como en segunda línea de tratamiento. La razón de coste-eficacia incremental fue de 20.703 € por AVG y de 19.343 € por AVAC con la primera línea de tratamiento, y de 23.183 € por AVG y 24.781 € por AVAC con la segunda línea de tratamiento. Conclusiones: En los pacientes con LLC no tratados previamente y en aquellos en recaída o resistentes al tratamiento previo, la adición de rituximab al esquema FC aumentó la esperanza de vida y los AVAC, y en ambos casos resultó ser un tratamiento coste-efectivo.Objectives: We evaluated the cost-effectiveness of rituximab added to the chemotherapy regimen of fludarabine plus cyclophosphamide (R-FC versus fludarabine plus cyclophosphamide (FC for the treatment of patients with previously untreated or relapsed/refractory chronic lymphocytic leukemia (CLL. Methods: Two Markov models were built, using published results on progression-free survival (PFS in patients
Directory of Open Access Journals (Sweden)
Renata Albergaria de Mello Bandeira
2012-04-01
Full Text Available O artigo analisa, através da técnica de estudo de caso, a terceirização logística em uma empresa de telecomunicações. Inicialmente, são discutidos os cuidados e a importância do contrato de terceirização, segundo abordagem da economia dos custos de transação. Analisam-se as possíveis causas das falhas na contratação, e sugerem-se providências para evitar repetições em implementações semelhantes. A experiência adquirida indica que um erro primordial, na opinião dos autores, refere-se à falta de definição da estratégia a ser seguida pela organização em relação ao modelo de contratação. Essa definição é uma etapa fundamental, já que o contrato deve estar alinhado à estratégia.This article examines, through the technique of case study, the process of logistics outsourcing in a Brazilian telecommunications company. Initially, the importance of contracts for outsourcing is analyzed according to the perspective of the transaction costs economics theory. The possible causes of imperfections in the contracting process are analyzed, and the steps to avoid the repetition of these mistakes in similar implementations are suggested. According to the authors' point of view, the acquired experience indicates that a primary error in outsourcing contracts refers to the lack of a strategy to be followed by the organization in relation to a contracting model. This definition is a fundamental step, since the contract must be aligned to the strategy.
Directory of Open Access Journals (Sweden)
Edgar Navarro Lechuga
2005-01-01
Full Text Available Objetivo: Determinar los factores asociados a consumo de cigarrillo en adultos del suroccidente de Barranquilla. Métodos: Estudio analítico (145 casos y 290 controles. Personas identificadas de la base de datos del estudio de «Enfermedades crónicas no transmisibles del suroccidente de Barranquilla». La tabulación se realizó en epiinfo 6.04, con salidas a Microsoft Word y Microsoft Excel. Resultados: 44.1% de los fumadores comenzaron a hacerlo por curiosidad. El promedio de edad de inicio fue de 17.1 años. El promedio de cigarrillos fumados por día fue de 6. Se encontró asociación entre fumar y ser hombre (OR 2.39; IC95%: 1.56 3.69, bajo nivel de escolaridad (OR 1.93; IC95%: 1.26 2.97, estar laborando (OR 2.17; IC95%: 1.41 3.35, tener miembros en la familia fumadores (OR: 2.7, IC95%: 1.4 5.3, influencia de los medios de comunicación (OR: 0.91; IC95%: 2.97 12.48, no pertenecer a una religión (OR: 1.62, IC95%: 1.06 2.49, consumir café con frecuencia (OR: 2.05, IC95%: 1.28 3.29, consumir alcohol (OR: 2.7, IC95%: 1.22 6.19 y tener disfuncionalidad familiar (OR: 2.3, IC95%: 1.17 4.5. Conclusiones: Los fumadores están expuestos a variables sociodemográficas, inherentes a su ser, y del medio ambiente. Es necesario intervenir sobre los factores de riesgo modificables para disminuir el consumo de cigarrillo.
48 CFR 970.3102-05 - Selected costs.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Selected costs. 970.3102... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05 Selected costs. ...
Directory of Open Access Journals (Sweden)
JORGE IGNACIO MONTOYA
2010-12-01
Full Text Available Los humedales construidos se presentan actualmente como una tecnología prometedora en reducir la contaminación por aguas residuales; este estudio investigó la remoción de materia orgánica con agua residual sintética, en términos de demanda química de oxígeno (DQO, demanda biológica de oxígeno (DBO5 y mediciones in situ de pH, oxígeno y temperatura cada 15 días, durante 3 meses, en seis sistemas de humedales construidos de flujo subsuperficial horizontal, a escala piloto, sembrados con tres diferentes macrófitas: Canna limbata, Heliconia psittacorum y Phragmites sp; las remociones medias de DQO fueron de 97,31 % y 95,94 % para Canna limbata; 94,49 % y 93,50 % para Heliconia psittacorum; 97,39 % y 97,13 % para Phragmites sp. En DBO5 fueron de 100 % y 99,36 % para Canna limbata; 99,09 % y 97,49 % para Heliconia psittacorum; 100 % y 99,45 % para Phragmites sp. Se concluye que existen diferencias significativas para la remoción de DQO entre las diferentes plantas (P Os banhados construídos são agora uma tecnologia promissora para reduzir a poluição por esgotos; este estudo investigou a remoção de matéria orgânica com esgoto sintético, em termos de demanda química de oxigênio (DQO, demanda biológica de oxigênio (DBO5 e medições in situ de pH, oxigênio e temperatura a cada 15 dias durante 3 meses, em seis sistemas de banhados construídos de fluxo sub-superficial horizontal, em escala piloto plantados com três diferentes macrófitas: Canna limbata, Heliconia psittacorum e Phragmites sp; as remoçães médias de DQO média foram 97,31 % e 95,94 % para Canna limbata, 94,49 % e 93,50 % para Heliconia psittacorum; 97,39 % e 97,13 % para Phragmites sp. Em DBO5 foram de 100 % e 99,36 % para Canna limbata, 99,09 % e 97,49 % para Heliconia psittacorum; 100 % e 99,45 % para Phragmites sp. Conclui-se que existem diferenças significativas para a remoção de DQO entre plantas diferentes (P Constructed wetlands appear at the
A intersubjetividade no contexto da família de pessoas com fibrose cística
Directory of Open Access Journals (Sweden)
Geisa Santos Luz
2012-04-01
Full Text Available Trata-se de uma investigação qualitativa, com aproximação fenomenológica, que objetivou desvelar os processos intersubjetivos no contexto da família de pessoas com Fibrose Cística (FC. Desenvolveu-se entrevista com 14 famílias com portadores de FC, cadastrados na Associação Paranaense de Assistência à Mucoviscidose (AAMPR, residentes nas regiões Norte e Noroeste do estado do Paraná (PR, Brasil. Das suas falas foram apreendidas unidades de significado, agrupadas em três categorias: Família, portador de FC e o outro; Aspectos religiosos na vivência da FC na família; Portador de FC na vida escolar, afetiva e profissional. Os resultados evidenciaram que a experiência das famílias compartilhada com o outro foi crucial para o enfrentamento da doença. Conhecer os processos intersubjetivos que perpassam o âmago da família de pessoas acometidas pela FC possibilita um novo modo de atuar em Enfermagem.
Directory of Open Access Journals (Sweden)
Dilma Alves Costa
2017-04-01
Full Text Available RESUMO Os processos de adsorção podem ser empregados no tratamento de efluentes líquidos contendo metais pesados visando a reduzir os danos ambientais. Porém, o alto custo dos materiais adsorventes justifica a aplicação de adsorventes alternativos, como a fibra de coco (FC e a quitosana (Q. Assim, este trabalho teve como objetivo desenvolver compósitos porosos adsorventes a partir da mistura de polietileno graftizado com anidrido maleico/FC/Q/NaCl, como agente porogênico (PE-g-MA/FC/Q/NaCl, e avaliar estatisticamente a capacidade de adsorção do cromo (III em solução, com auxílio do software Statistica 5.0®. Os resultados mostraram que a eficiência do processo sofreu influência das dimensões da FC, do teor de Q e do pH da solução contendo Cr (III. A capacidade máxima de remoção de Cr (III por unidade de massa do compósito foi de 42,28 mg.g-1.
40 CFR Table 25 to Subpart G of... - Effective Column Diameter (Fc)
2010-07-01
... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Effective Column Diameter (Fc) 25 Table..., Table 25 Table 25 to Subpart G of Part 63—Effective Column Diameter (Fc) Column type Fc (feet) 9-inch by 7-inch built-up columns 1.1 8-inch-diameter pipe columns 0.7 No construction details known 1.0 ...
Comparação entre desempenhos de corrida time trial realizados em pista e esteira
Directory of Open Access Journals (Sweden)
Cecília Segabinazi Peserico
2014-05-01
Poucos estudos verificaram a influência do ambiente de teste (campo e laboratório sobre o ritmo de corrida e variáveis fisiológicas obtidas durante o desempenho em corrida de endurance. Portanto, o objetivo deste estudo foi comparar o comportamento da velocidade média (VM, ritmo de corrida, frequência cardíaca (FC e percepção subjetiva de esforço (PSE obtidas durante os desempenhos de corrida em provas time trial de uma hora realizados em pista de atletismo e em esteira. Dezoito homens corredores recreacionais (25,4 ± 3,3 anos realizaram duas performances de uma hora de corrida: uma em esteira e outra em pista de atletismo de 400 m. A PSE e a FC foram registradas a cada 10 minutos, e a VM a cada 15 minutos para a determinação do ritmo de corrida. As variáveis relacionadas aos desempenhos foram comparadas pelo teste t de Student para amostras pareadas. Os valores de VM, FC e PSE obtidos durante diferentes momentos das provas foram comparados pela Anova de dois fatores para medidas repetidas seguido do post hoc de Bonferroni. Para todas as análises, foi adotado nível de significância de P< 0,05. A VM da prova realizada em pista (12,2 ± 0,8 km·h-1 foi superior à prova em esteira (11,8 ± 0,8 km·h-1. Além disso, foram encontradas diferenças entre os dois desempenhos para os valores de frequência cardíaca média e máxima, e para o ritmo de corrida. A partir dessas diferenças, conclui-se que os desempenhos foram influenciados pelo ambiente onde as provas de uma hora foram realizadas.
Lemke, H; Krausse, R; Lorenzen, J; Havsteen, B
1985-05-01
During the production of Fc receptor (FcR)-bearing hybridomas it was observed with a particular monoclonal anti-sheep red blood cell antibody (anti-SRBC 1/5, IgG1) that the contamination with Mycoplasma arginini of in vitro cultured cell lines leads to an apparent FcR activity. This property did not correspond with the serological typing since other antibodies of the same isotype could not support FcR rosette formation. Another mycoplasma strain M. orale lacked this property. Analysis of the binding reaction revealed that M. arginini contains a lectin which binds the carbohydrate moiety of the anti-SRBC 1/5 antibody, i.e. anti-SRBC 1/5 synthesized under the influence of tunicamycin or deglycosylated by NaIO4 oxidation did not support rosette formation. These data suggest that binding of antibodies to certain mycoplasma strains may be a pathogenic factor during mycoplasma infections by masking the microorganisms with the host's own defense molecules. The experiments with M. arginini-infected cell lines gain immunological importance since we obtained identical results with staphylococcal protein A, as another bacteriological FcR, and cell lines expressing intrinsic membrane FcR. Although it is an open question whether the glycoconjugates are directly bound by the FcR or else by influencing the three-dimensional structure of the antibodies, it seems possible that FcR in general may be lectins.
A strategy for bacterial production of a soluble functional human neonatal Fc receptor
DEFF Research Database (Denmark)
Andersen, Jan Terje; Justesen, Sune; Berntzen, Gøril
2008-01-01
The major histocompatibility complex (MHC) class I related receptor, the neonatal Fc receptor (FcRn), rescues immunoglobulin G (IgG) and albumin from lysosomal degradation by recycling in endothelial cells. FcRn also contributes to passive immunity by mediating transport of IgG from mother to fetus...
29 CFR 4.122 - Contracts for operation of postal contract stations.
2010-07-01
... Application of the McNamara-O'Hara Service Contract Act Specific Exclusions § 4.122 Contracts for operation of postal contract stations. The Act, in paragraph (7) of section 7, exempts from its provisions “any... 29 Labor 1 2010-07-01 2010-07-01 true Contracts for operation of postal contract stations. 4.122...
Directory of Open Access Journals (Sweden)
Jorge Vitor Ludke
2007-11-01
Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramente casualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre o tratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations. The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. An experiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC and characteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up
Directory of Open Access Journals (Sweden)
Patrícia C. de F Fonseca
2012-12-01
Full Text Available In Tropical regions, the animal performance is often affected by climate conditions. This study aimed to evaluate covering materials in individual shelters, normally used to house dairy calves, and its influence on the calves physiology and performance. The design used was completely randomized, with a 2x3 factorial arrangement to compare the averages of 5% through the Tukey's test, i.e., both genders- and three types of covering in the shelters (Z - zinc; AC - asbestos cement; and WPAC - white-painted asbestos cement. Parameters evaluated included daily weight gain (DWG, dry matter intake (DMI, feed conversion (FC, rectal temperature (RT, and respiratory frequency (RF. Results showed significant differences (P 0.05 in the FC and the RT, and there were significant differences (P Nos trópicos, o desempenho animal é prejudicado pela ação do clima. Objetivou-se neste trabalho avaliar materiais de cobertura em abrigos individuais sobre a fisiologia e o desempenho de bezerros leiteiros. Utilizou-se o delineamento inteiramente casualizado, fatorial 2 X 3, para a comparação das médias ao nível de 5%, pelo teste de Tukey, ou seja, dois sexos e três tipos de coberturas (Z - zinco; CA - cimento-amianto e CAB - cimento-amianto pintado de branco. Foram medidos o ganho de peso diário (GPD, o consumo alimentar (CMS, a conversão alimentar (CA, a temperatura retal (TR e a frequência respiratória (FR. Os resultados mostraram que houve diferença significativa (P 0,05 para CA e TR e observou-se diferença significativa (P < 0,05 para FR nos tratamentos Z (56,9 mov.min-1, CAB (62,2 mov.min-1 e CA (70,25 mov.min-1. Conclui-se que os diferentes tipos de coberturas não influenciaram no desempenho e no consumo alimentar, mas interferiram na fisiologia de termorregulação dos animais.
International Nuclear Information System (INIS)
Loeffler, G.
1975-01-01
Turnkey or the turnkey type of contract refers to a system of management according to which one organization accepts total responsibility for completing all parts and all phases of a project. In the case of a power project the turnkey contractor undertakes to design the plant, supply or procure and erect the equipment, build the station and put it into operation. (orig./FW) [de
Cleavage of the interchain disulfide bonds in rituximab increases its affinity for FcγRIIIA.
Suzuki, Mami; Yamanoi, Ayaka; Machino, Yusuke; Kobayashi, Eiji; Fukuchi, Kaori; Tsukimoto, Mitsutoshi; Kojima, Shuji; Kohroki, Junya; Akimoto, Kazunori; Masuho, Yasuhiko
2013-07-05
The Fc region of human IgG1 mediates effector function via binding to Fcγ receptors and complement activation. The H and L chains of IgG1 antibodies are joined by four interchain disulfide bonds. In this study, these bonds within the therapeutic IgG1 rituximab (RTX) were cleaved either by mild reduction followed by alkylation or by mild S-sulfonation; consequently, two modified RTXs - A-RTX (alkylated) and S-RTX (S-sulfonated) - were formed, and both were almost as potent as unmodified RTX when binding CD20 antigen. Unexpectedly, each modified RTX had a higher binding affinity for FcγRIIIA (CD16A) than did unmodified RTX. However, S-RTX and A-RTX were each less potent than RTX in an assay of antibody-dependent cellular cytotoxicity (ADCC). In this ADCC assay, each modified RTX showed decreased secretion of granzyme B, but no change in perforin secretion, from effector cells. These results provide significant information on the structures within IgG1 that are involved in binding FcγRIIIA, and they may be useful in the development of therapeutic antagonists for FcγRIIIA. Copyright © 2013 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Ricardo Alejandro Miranda-Gelvez
2015-07-01
Full Text Available Background: The cultivation of Sacha Inchi (P. volubilis has been developed in the Peruvian Amazon and in Colombia is grown mainly in the Department of Putumayo. There are proposals nowadays for implementation of this crop in the Catatumbo region (Norte de Santander. Objective: This study assessed the effect of Sacha Inchi cake (SIC (Plukenetia volubilis inclusion as a source of protein in diets for juveniles of red tilapia (Oreochromis sp. Methodology: four experimental diets including SIC as a partial substitute of fishmeal were prepared in the following percentages: 0%, 5%, 10% and 20%. 144 juvenile tilapia with initial weight of 5.8 ± 0.9 g were used, being fed with eight daily rations during 55 days to assess: weight gain (WG, feed conversion (FC, specific growth rate (SGR, protein efficiency ratio (PER, hepatosomatic index (HI and survival rate (%S. Results: The results showed no significant differences (p> 0.05 in any of the diets for FC and %S. However, the parameters: WG, SGR, PER and HI had significantly higher values for inclusions of 0,5 and 10%, being statistically different (p <0.01 from the 20% inclusion level. Conclusion: It is concluded that P. volubilis can replace fish meal up to a 10% level of inclusion.
Relativistic beam self-contraction in the inhomogeneous magnetic field with a neck
International Nuclear Information System (INIS)
Grishin, V.K.
1979-01-01
For production of short bunches of relativistic electrons and accompanying electromagnetic fields with amplitudes (up to MW/cm), considered was self-contraction of a relativistic electron beam (REB) in a magnetic field with a neck. REB dynamics in a ferrodielectric channel with permeability >> 1 was considered as well. It is shown, that in a such system, 10 m beam with a current up to ten kA is contracted to a length of approximately 0.5 m. Also the possible ways of application of the considered method of REB contraction are shown. For instance, a slow REB, fearing a great field, can be used for the capture and subsequent acceleration of heavy ions. The contracted beam application for generating powerful pulses of a h.f. field with, in fact, a homogeneous spectrum up to 100-300 MHz and total field energy up to 10-15% of initial beam energy is of great interest as well
ENFORCEMENT OF MORTGAGE CONTRACT
Directory of Open Access Journals (Sweden)
Alisa A. BELU
2016-07-01
Full Text Available A chattel mortgage contract is the expression of a real guarantee that gives the creditor precedence over other creditors, in addition to the general pledge upon the belongings of the debtor. It refers to the sale of mortgaged movable assets, exclusively or prioritized in favor of the mortgaging creditor, in case the debtor does not comply with his / her commitments, under the signed mortgage contract. Beginning from this purpose, shared by both sides (as the chattel mortgage contract is synallagmatic, in case the debtor is unable to fulfill his / her commitments, the sides reach a situation of enforcement of the signed chattel mortgage contract. Given the legal status of the chattel mortgage contract [Art. 2387-2477 Noul Cod Civil , Universul Juridic, Bucureşti, 2016, ISBN 978-606-673-792-0], the principle of binding force of the contract and the principle according to which signed legal conventions will entail legal effects, the Romanian law maker developed the proper legal framework for the enforcement of the chattel mortgage contract. [art. 622 si urm. Noul Cod de Procedură Civilă, ed. Hamangiu, Bucureşti, 2016, ISBN 978-606-27-0459-9].
Directory of Open Access Journals (Sweden)
Juliana Monteiro Candeloro
2008-01-01
Full Text Available Este estudo visou analisar as conseqüências cardiocirculatórias (na pressão arterial, PA, e freqüência cardíaca, FC de um programa de hidroterapia cujo objetivo clínico era ganho de força muscular e flexibilidade para mulheres idosas saudáveis e sedentárias. Participaram 16 idosas, de 65 a 70 anos. O programa constou de 32 sessões, com uma hora de duração cada, de exercícios em imersão para ganho de força muscular e flexibilidade, com grau de dificuldade crescente, em sete fases. As quatro primeiras sessões foram usadas para adaptação ao meio aquático e desconsideradas para coleta de dados. As medidas de PA e FC foram coletadas ao final de cada fase, em quatro momentos: repouso fora da água, em repouso 3 minutos após imersão, em imersão ao final dos exercícios, e três minutos após a saída da piscina. Os dados foram analisados estatisticamente com nível de significância a pThis study aimed at analysing cardiocirculatory effects (on blood pressure, BP, and heart rate, HR of a hydrotherapy program of which the purpose was to increase muscle force and flexibility of 16 sedentary, healthy, 65-to-70 year-old women. The program consisted of 32 1-hour sessions of strength and flexibility training exercises, with increasing degree of difficulty in seven phases. The first four sessions were used for adaptation to the aquatic environment and the respective data were not considered. BP and HR were monitored at the end of each phase in four different moments: at rest before diving, at rest 3 minutes after immersion, still immerged at the end of exercises, and at rest, 3 minutes after exiting the pool. Collected measures were statistically analysed, and significance level set at p<0.05. Results show significant mean at-rest systolic BP decrease of 5.6 mmHg, and mean at-rest diastolic BP decrease of 9.7 mmHg, from the 5th (base session to the 32nd (last session; participants' BP classification turned from threshold-normal to
New cholescintigraphic agent: ruthenium-97-DISIDA
Energy Technology Data Exchange (ETDEWEB)
Zanzi, I.; Srivastava, S.C.; Meinken, G,E.; Robeson, W.; Mausner, L.F.; Fairchild, R.G.; Margouleff, D.
1986-06-01
These studies demonstrate the first application of Ru-97-DISIDA in human subjects. High quality images were obtained. Scintigraphic findings in patients with hepatobiliary disorders were consistent with the biodistribution data obtained in experinmental animals and with other imaging procedures and clinical findings. Administration of Ru-97-DISIDA I.V. and of a solid test meal labeled with Tc-99m-Sulfur Colloid allowed simulateneous detection and quantification of deodenogastric reflux and determination of the gastric emptying rate. This represents an advantage as compared to the currently used techniques which necessitate two separate studies if a solid meal is used, or would mandate a liquid meal for a simultaneous study. The excellent nuclear decay characteristics of Ru-97 (tl/2 69.6 h, gamma 216 keV, 86%, no betas) permit delayed study of the hepatobiliary system with considerably less radiation exposure than I-131 Rose Bengal and with a marked improvement in image quality. 5 refs., 3 figs., 3 tabs.
Directory of Open Access Journals (Sweden)
Wang Chun Huy
2017-01-01
Full Text Available In this work, the piezoelectric ceramic system of the (1-x(Na0.5K0.5NbO3 - xBi(Na0.83K0.17TiO3 with composition close to the morphotropic phase boundary is studied. (Na0.5K0.5NbO3 with 0∼5 mole% Bi(Na0.83K0.17TiO3 has been prepared following the conventional mixed oxide process. The effect of sintering time on the properties of 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics is discussed. For 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.46 and 155 p/CN, respectively, at the sintering of 1100 °C for 3 h. Dielectric and piezoelectric properties have maximum values at the sintering temperature of 1100 °C for 5 h. For 0.97(Na0.5K0.5NbO3 -0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.56 and 190, respectively, at the sintering of 1100 °C for 5 h. The effect of prolonging the sintering time to the 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 system is a helpful method on ceramic processing to improve densification and properties.
2010-10-01
..., DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Applicability of Certain Laws to the Acquisition of Commercial Items 212.570 Applicability of certain laws to contracts and... laws to contracts and subcontracts for the acquisition of commercially available off-the-shelf items...
Directory of Open Access Journals (Sweden)
Gleidson Giordano Pinto de Carvalho
2006-08-01
Full Text Available Foram estudados os efeitos do uso de silagem de capim-elefante amonizada ou não com uréia (5% na base da MS e da substituição do concentrado (milho e farelo de soja por farelo de cacau (FC ou torta de dendê (TD na dieta sobre o comportamento ingestivo de ovinos Santa Inês. Dezoito ovinos machos não-castrados (peso médio inicial de 22,62 kg, alojados em baias individuais, foram distribuídos em delineamento experimental inteiramente casualizado, com seis tratamentos, dois volumosos (silagem de capim-elefante amonizada ou não com uréia e três níveis de substituição do concentrado (milho + farelo de soja por farelo de cacau ou torta de dendê (0% FC e TD, 40% FC e 40% TD na dieta, fornecida na proporção de 60:40 volumoso:concentrado. O período experimental foi de 78 dias, sendo 15 dias destinados à adaptação dos animais às dietas. Os animais foram observados a cada cinco minutos, durante dois períodos de 24 horas/dia, no final do período experimental. Foram registrados o tempo despendido em alimentação, ruminação e ócio e o número e o tempo de mastigações merícicas por bolo ruminado. Não houve diferença entre os tempos de alimentação, ruminação e ócio. A amonização do capim-elefente e a inclusão do farelo de cacau no concentrado aumentaram a eficiência de ruminação, mas a maioria dos parâmetros do comportamento ingestivo avaliados não sofreu alterações.The effects of feeding elephantgrass silage ammoniated or not with urea (5% DM basis and the concentrate replacement (corn and soybean meal by cocoa meal (CM or palm cake (PC on the ingestive behaviour of 18 Santa Inês non-castrated male sheep averaging 22.62 kg of initial body weight were studied. The animals were allotted to individual pensas a completely randomized design with six treatments, two roughages (elephantgrass silage ammoniated with urea or not and three concentrate replacement level with by cocoa meal or palm cake (0% CM and PC, 40% CM
Estudio de la carga interna en pádel amateur mediante la frecuencia cardíaca
Directory of Open Access Journals (Sweden)
Jesús Díaz García
2017-03-01
Full Text Available Los objetivos de este estudio fueron evaluar el nivel de condición física de 8 sujetos amateur de pádel, definir su perfil energético de esfuerzo en juego real mediante registro de frecuencia cardíaca (FC, y proponer un conjunto de variables justificadas de esta, que permita analizar el perfil de carga interna en pádel. Mediante prueba de esfuerzo incremental máxima en cinta de correr se obtuvieron parámetros ergoespirométricos, respiratorios y sus equivalentes cardíacos, introducidos en el sistema de registro de la FC Polar Team. Los sujetos disputaron 7 partidos de entrenamiento de 1 hora de duración y 72-96 horas de separación entre ellos, obteniéndose como variables: consumo máximo de oxígeno (VO2 máx y porcentaje (% de VO2 máx en el umbral anaeróbico; en prueba de esfuerzo, FC máx., media y mín., y zonas de trabajo metabólicas (rangos de FC. Los resultados presentan VO2 máx de 51,15 ± 5,73 ml · kg–1 · min–1, FC máx. durante el juego de 154,75 ± 7,25 ppm, FC med de 130,0 ± 10,4 ppm para tiempo de juego y 89,75 % del tiempo de juego en zona de trabajo aeróbica. Como conclusión, el esfuerzo al que son sometidos durante el juego a nivel cardiorrespiratorio los jugadores amateur de pádel se basa casi exclusivamente en metabolismos aeróbicos. Además, las variables máx., mín. y media de FC para tiempos de juego y descanso y el establecimiento de zonas de trabajo de FC pueden aportarnos información importante sobre lo que ocurre en el juego a nivel cardiorrespiratorio.
Zapata, Paula; Rojas, Diego; Fernández, Carlos; Ramírez, David; Restrepo, Gloria; Orjuela, Viviana; Arroyave, Marcela; Gómez, Tatiana; Atehortüa, Lucía
2007-01-01
Grifóla frondosa es un hongo Basidiomycete comestible y medicinal que produce polisacáridos tipo glucanos (β-1,6 y β-1,3) con actividad antitumoral e inmunomoduladora. Para el presente trabajo, el objetivo fue evaluar la incidencia de diferentes fuentes de carbono (FC) en la producción de biomasa y exopolisacári-dos (EPS), bajo condiciones de cultivo sumergido, utilizando un diseño estadístico factorial con dos factores: fuente de carbono (FC(1-7)) y medio (MB y MS). La máxima produ...
Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D.
Kapur, R.; Della Valle, L.; Verhagen, O.J.; Hipgrave Ederveen, A.; Ligthart, P.; de Haas, M.; Kumpel, B.; Wuhrer, M.; van der Schoot, C.E.; Vidarsson, G.
2015-01-01
Background RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions
Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D
Kapur, Rick; Della Valle, Luciana; Verhagen, Onno J. H. M.; Hipgrave Ederveen, Agnes; Ligthart, Peter; de Haas, Masja; Kumpel, Belinda; Wuhrer, Manfred; van der Schoot, C. Ellen; Vidarsson, Gestur
2015-01-01
RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions with
Long-term contracts and take-or-pay clauses in natural gas markets
International Nuclear Information System (INIS)
Creti, A.; Villeneuve, B.
2004-01-01
Theoretical and empirical research on long-term contracts inspired by the American experience are surveyed, with emphasis on the analysis of the role of take-or-pay clauses and price indexation rules, and whether regulation distorts optimal contract duration. The underlying motivation is to analyze the economic fundamentals of the European Union provisions on long-term contracts in the natural gas industry, and to highlight the features that differentiate them from the American experience. The impacts of long term contracts in the opening to competition of the European Union natural gas sector, and the apparent confusion between contract duration and flexibility as applied to long-term contracts in the European Union, are also explored. 29 refs., 2 tabs
NRG1-Fc improves metabolic health via dual hepatic and central action.
Zhang, Peng; Kuang, Henry; He, Yanlin; Idiga, Sharon O; Li, Siming; Chen, Zhimin; Yang, Zhao; Cai, Xing; Zhang, Kezhong; Potthoff, Matthew J; Xu, Yong; Lin, Jiandie D
2018-03-08
Neuregulins (NRGs) are emerging as an important family of signaling ligands that regulate glucose and lipid homeostasis. NRG1 lowers blood glucose levels in obese mice, whereas the brown fat-enriched secreted factor NRG4 protects mice from high-fat diet-induced insulin resistance and hepatic steatosis. However, the therapeutic potential of NRGs remains elusive, given the poor plasma half-life of the native ligands. Here, we engineered a fusion protein using human NRG1 and the Fc domain of human IgG1 (NRG1-Fc) that exhibited extended half-life in circulation and improved potency in receptor signaling. We evaluated its efficacy in improving metabolic parameters and dissected the mechanisms of action. NRG1-Fc treatment triggered potent AKT activation in the liver, lowered blood glucose, improved insulin sensitivity, and suppressed food intake in obese mice. NRG1-Fc acted as a potent secretagogue for the metabolic hormone FGF21; however, the latter was largely dispensable for its metabolic effects. NRG1-Fc directly targeted the hypothalamic POMC neurons to promote membrane depolarization and increase firing rate. Together, NRG1-Fc exhibits improved pharmacokinetic properties and exerts metabolic benefits through dual inhibition of hepatic gluconeogenesis and caloric intake.
Cohen, D A; Stotelmyer, N L; Kaplan, A M
1985-04-01
The development of functional Fc receptors (FcR) during induced differentiation with the tumor promoter, phorbol myristate acetate (PMA), was studied in the murine tumor cell line, P388. PMA induced the appearance of FcR on the membranes of P388 cells as indicated by the binding of IgG-coated sheep red blood cells (IgG-SRBC). Concentrations of PMA as low as 1 ng/ml were sufficient to induce the expression of FcR as well as to inhibit cellular division and to induce adherence in the P388 tumor cell line; however, optimal FcR induction occurred at PMA concentrations of 10-100 ng/ml. Immunofluorescent analysis with heat-aggregated myeloma proteins indicated that PMA induced FcR which were capable of binding IgG2a and IgG2b immunoglobulins, but not IgG1. Adherence to a substratum was determined to be a second required signal for expression of FcR, since PMA induction of P388 tumor cells in teflon dishes failed to fully develop FcR and adherence of P388 cells to poly-L-lysine-coated culture dishes in the absence of PMA was insufficient for FcR expression. FcR which appeared after PMA induction were non-functional in the sense that membrane-bound IgG-SRBC were not ingested to any significant extent by the tumor cells. However, if FcR induction occurred in the presence conA-induced rat spleen cell culture supernatants, phagocytosis of membrane-bound erythrocytes occurred. These findings suggest that for the expression of FcR which are capable of particle internalization, at least three identifiable membrane-transmitted signals are required during differentiation.
Crescimento de mudas de Eucalyptus camaldulensis em substratos à base de casca de arroz carbonizada
Directory of Open Access Journals (Sweden)
Dagma Kratz
2016-06-01
Full Text Available RESUMO Com base na importância do substrato na produção de mudas florestais, objetivou-se, com este trabalho, avaliar a viabilidade técnica de 13 substratos, preparados com misturas de substrato comercial à base de casca de pinus e vermiculita (SC, casca de arroz carbonizada com diferentes granulometrias [maior que 2 mm (CAC1, CAC com granulometria entre 1 - 2 mm (CAC2, CAC com granulometria entre 0,5 - 1 mm (CAC3, CAC com granulometria menor que 0,5 mm (CAC4], fibra de coco (FC e vermiculita média (VM, na produção de mudas de Eucalyptus camaldulensis, e a correlação de suas propriedades físicas e químicas com seu crescimento. Foram utilizados tubetes de 55 cm³. As mudas permaneceram 60 dias em estufa de vidro e 30 dias a pleno sol. Foram avaliadas a altura, diâmetro de colo, fitomassas secas aérea e radicial, facilidade de retirada do tubete, agregação das raízes ao substrato e relação entre altura e diâmetro de colo. Concluiu-se que o substrato formado por CAC pura, em diferentes granulometrias e em mistura com os outros componentes, é viável tecnicamente para a produção de mudas de Eucalyptus camaldulensis, embora aquele formado pela mistura de 50% de CAC e VM tenha resultado em maior crescimento das mudas. As propriedades dos substratos, densidade aparente, pH e capacidade de troca catiônica são importantes na produção de mudas, pois apresentaram correlações significativas com as variáveis biométricas.
Validity and efficacy of the labor contract
Directory of Open Access Journals (Sweden)
Jorge Toyama
2012-12-01
Full Text Available The validity and efficacy of the labor contract as well as cases of nullity and defeasibility import an analysis of scopes of the supplementary application of Civil Code taking into account the peculiarities of Labor Law. Labor contract, while legal business has as regulatory framework to the regulations of Civil Code but it is necessary to determine, in each case, whether to apply fully this normative body, or modulate its supplemental application, or simply conclude that it doesn’t result compatible its regulation due to the special nature of labor relations. Specifically, this issue will be analyzed from cases of nullity and defeasibility of the labor contract.
Biodisponibilidad de lisina para el pollo en crecimiento de cuatro harinas de subproductos avícolas
Directory of Open Access Journals (Sweden)
Arturo Cortes Cuevas
2011-01-01
Full Text Available Para conocer la biodisponibilidad de lisina para el pollo de cuatro lotes de harinas de subproductos avícolas (HSA mexicanas, se realizaron dos experimentos. En el Exp 1, se emplearon 168 pollitos de 1 a 21 días de edad y en el Exp 2, 210 pollitos de 7 a 21 días, en ambos experimentos las aves se distribuyeron completamente al azar en siete tratamientos con tres repeticiones cada uno. Los tratamientos fueron, 1 dieta basal sorgo-soya-ajonjolí (deficiente en lisina, 2 dieta basal + 0.05% de L-lisina, 3 dieta basal+0.10% de L-lisina, 4 dieta basal+0.05% de lisina a partir de HSA A o B, 5 dieta basal+0.10% de lisina a partir de HSA A o B, 6 dieta basal+0.05% de lisina a partir de HSA C o D y 7 dieta basal+0.10% de lisina a partir de HSA C o D. Los resultados del crecimiento se explicaron por la ecuación de regresión lineal múltiple de, Y=265.074+0.04288X1+0.0417X2+0.04085X3 , en donde X1 fue L-lisina, X2 la HSA A y X3 la HSA C (Exp 1 y del Exp 2 por Y=129.131+ 0.06764X1+0.06437X2+0.06614X3, en donde X1 fue L-lisina, X2 la HSA B y X3 la HSA D. Al comparar las pendientes de las HSA, con la de L-lisina considerada como 100 %, se obtuvieron biodisponibilidades de la HSA A de 97.2 %, C de 95.2 %, B de 95.2 % y D de 97.8 %. En base a los resultados obtenidos, se puede concluir que la calidad proteica de los cuatro lotes de harinas evaluadas, resultaron similares y de buena calidad.
46 CFR 97.05-1 - Duty of officers.
2010-10-01
... Lakes. These notices may be obtained free of charge, by making application to Commander, 9th Coast Guard... Edition), published by the Commander, 9th Coast Guard District, contain announcements and information on... in the U.S. Consulates where they may be inspected. [CGFR 66-33, 31 FR 15286, Dec. 6, 1966, as...
Monoclonal antibodies and Fc fragments for treating solid tumors
Directory of Open Access Journals (Sweden)
Eisenbeis AM
2012-01-01
Full Text Available Andrea M Eisenbeis, Stefan J GrauDepartment of Neurosurgery, University Hospital of Cologne, Cologne, GermanyAbstract: Advances in biotechnology, better understanding of pathophysiological processes, as well as the identification of an increasing number of molecular markers have facilitated the use of monoclonal antibodies and Fc fragments in various fields in medicine. In this context, a rapidly growing number of these substances have also emerged in the field of oncology. This review will summarize the currently approved monoclonal antibodies used for the treatment of solid tumors with a focus on their clinical application, biological background, and currently ongoing trials.Keywords: targeted therapy, monoclonal antibodies, cancer, biological therapy
Fc-fusion technology and recombinant FVIII and FIX in the management of the hemophilias.
Mancuso, Maria Elisa; Mannucci, Pier Mannuccio
2014-01-01
Prophylaxis with regular infusions of factor VIII (FVIII)- or factor IX (FIX)- containing products is the mainstay of modern hemophilia care. However, this therapeutic regimen is inconvenient, requiring repeated intravenous injections from childhood. Approaches meant to prolong the half-life of FVIII and FIX in plasma have been developed in order to improve the feasibility and acceptability of replacement therapy, extending protection from bleeding, reducing infusion frequency and hence the need for venous access devices in young children. Several strategies have been implemented to enhance the pharmacokinetics of clotting factors, including conjugation with polyethylene glycol and the production by genetic engineering of fusion proteins containing the coagulation factors linked to a long-lived plasma protein such as albumin or the Fc fragment of immunoglobulin (Ig)G. The latter technology is one of the most promising, since the prolongation of FVIII and FIX half-life is obtained by exploiting the physiological binding of the Fc domain to the neonatal Fc receptor. Fc fusion monomers have been obtained with both recombinant FVIII (rFVIIIFc) and FIX (rFIXFc), and data from preclinical and clinical studies showed improved pharmacokinetics for both factors, which are produced in human embryonic kidney (HEK) 293 cells, thus ensuring full human post-translational modifications. In Phase I/IIa studies, rFVIIIFc and rFIXFc showed 1.5-1.7 fold and 3.0-4.0 fold longer elimination half-life, respectively. Similar data have been obtained in the Phase III clinical studies with rFVIIIFc and rFIX-Fc published recently. Both drugs were satisfactorily safe, particularly with respect to immunogenicity, and no serious adverse event was observed.
IgG receptor FcγRIIB plays a key role in obesity-induced hypertension.
Sundgren, Nathan C; Vongpatanasin, Wanpen; Boggan, Brigid-Meghan D; Tanigaki, Keiji; Yuhanna, Ivan S; Chambliss, Ken L; Mineo, Chieko; Shaul, Philip W
2015-02-01
There is a well-recognized association between obesity, inflammation, and hypertension. Why obesity causes hypertension is poorly understood. We previously demonstrated using a C-reactive protein (CRP) transgenic mouse that CRP induces hypertension that is related to NO deficiency. Our prior work in cultured endothelial cells identified the Fcγ receptor IIB (FcγRIIB) as the receptor for CRP whereby it antagonizes endothelial NO synthase. Recognizing known associations between CRP and obesity and hypertension in humans, in the present study we tested the hypothesis that FcγRIIB plays a role in obesity-induced hypertension in mice. Using radiotelemetry, we first demonstrated that the hypertension observed in transgenic mouse-CRP is mediated by the receptor, indicating that FcγRIIB is capable of modifying blood pressure. We then discovered in a model of diet-induced obesity yielding equal adiposity in all study groups that whereas FcγRIIB(+/+) mice developed obesity-induced hypertension, FcγRIIB(-/-) mice were fully protected. Levels of CRP, the related pentraxin serum amyloid P component which is the CRP-equivalent in mice, and total IgG were unaltered by diet-induced obesity; FcγRIIB expression in endothelium was also unchanged. However, whereas IgG isolated from chow-fed mice had no effect, IgG from high-fat diet-fed mice inhibited endothelial NO synthase in cultured endothelial cells, and this was an FcγRIIB-dependent process. Thus, we have identified a novel role for FcγRIIB in the pathogenesis of obesity-induced hypertension, independent of processes regulating adiposity, and it may entail an IgG-induced attenuation of endothelial NO synthase function. Approaches targeting FcγRIIB may potentially offer new means to treat hypertension in obese individuals. © 2014 American Heart Association, Inc.
IgG Receptor FcγRIIB Plays a Key Role in Obesity-Induced Hypertension
Sundgren, Nathan C.; Vongpatanasin, Wanpen; Boggan, Brigid-Meghan D.; Tanigaki, Keiji; Yuhanna, Ivan S.; Chambliss, Ken L.; Mineo, Chieko; Shaul, Philip W.
2015-01-01
There is a well-recognized association between obesity, inflammation, and hypertension. Why obesity causes hypertension is poorly understood. We previously demonstrated using a C-reactive protein (CRP) transgenic mouse that CRP induces hypertension that is related to NO deficiency. Our prior work in cultured endothelial cells identified the Fcγ receptor IIB (FcγRIIB) as the receptor for CRP whereby it antagonizes endothelial NO synthase. Recognizing known associations between CRP and obesity and hypertension in humans, in the present study we tested the hypothesis that FcγRIIB plays a role in obesity-induced hypertension in mice. Using radiotelemetry, we first demonstrated that the hypertension observed in transgenic mouse-CRP is mediated by the receptor, indicating that FcγRIIB is capable of modifying blood pressure. We then discovered in a model of diet-induced obesity yielding equal adiposity in all study groups that whereas FcγRIIB+/+ mice developed obesity-induced hypertension, FcγRIIB−/− mice were fully protected. Levels of CRP, the related pentraxin serum amyloid P component which is the CRP-equivalent in mice, and total IgG were unaltered by diet-induced obesity; FcγRIIB expression in endothelium was also unchanged. However, whereas IgG isolated from chow-fed mice had no effect, IgG from high-fat diet–fed mice inhibited endothelial NO synthase in cultured endothelial cells, and this was an FcγRIIB-dependent process. Thus, we have identified a novel role for FcγRIIB in the pathogenesis of obesity-induced hypertension, independent of processes regulating adiposity, and it may entail an IgG-induced attenuation of endothelial NO synthase function. Approaches targeting FcγRIIB may potentially offer new means to treat hypertension in obese individuals. PMID:25368023
(Some) Cellular Mechanisms Influencing the Transcription of Human Endogenous Retrovirus, HERV-Fc1
DEFF Research Database (Denmark)
Laska, Magdalena Janina; Nissen, Kari Konstantin; Nexø, Bjørn Andersen
2013-01-01
DNA methylation and histone acetylation are epigenetic modifications that act as regulators of gene expression. DNA methylation is considered an important mechanism for silencing of retroelements in the mammalian genome. However, the methylation of human endogenous retroviruses (HERVs) is not well...... investigated. The aim of this study was to investigate the transcriptional potential of HERV-Fc1 proviral 5'LTR in more detail, and examined the specific influence of CpG methylation on this LTR in number of cell lines. Specifically, the role of demethylating chemicals e.g. 5-aza-2' deoxycytidine...... and Trichostatin-A, in inducing or reactivating expression of HERV-Fc1 specific sequences and the mechanisms were investigated. In our present study, 5-aza-dC is shown to be a powerful inducer of HERV-Fc1, and at the same time it strongly inhibits methylation of DNA. Treatment with this demethylating agent 5-aza...
Sistemas de Distribución de Clave Cuántica Basados en Codificación en Frecuencia
Ruiz Alba Gaya, Antonio
2012-01-01
Esta tesis se centra en el estudio de la aplicabilidad que dos disciplinas, la fotónica de microondas (MWP) y las comunicaciones cuánticas, pueden aportar en el desarrollo de nuevos sistemas de distribución de clave cuántica (QKD). El objetivo principal es el análisis y la validación experimental de sistemas QKD en la técnica de codificación en frecuencia (FC-QKD), por medio de distintas configuraciones de moduladores. Los sistemas FC-QKD permiten la incorporación de técnicas de multiplexació...
Nova proposta de teste incremental de remada na avaliação aeróbia de surfistas
Directory of Open Access Journals (Sweden)
Felipe Bercht CANOZZI
2015-09-01
Full Text Available ResumoOs objetivos desse estudo foram: 1 verificar as respostas do lactato sanguíneo e da frequência cardíaca (FC durante um protocolo de campo específico de remada no surfe; 2 correlacionar os índices de capacidade e potência aeróbia determinados nesse protocolo específico com o tempo de prática da modalidade e variáveis antropométricas. Participaram deste estudo nove sujeitos (24 ± 4,5 anos; 72,2 ± 6,7 kg; 178,4 ± 4,8 cm que foram submetidos a um teste progressivo intermitente de remada sobre a sua própria prancha de surfe, do tipo vai e vêm, com velocidades iniciais entre 1-1,1 m/s e incrementos de 0,05 m/s a cada 3 min até a exaustão voluntária. Uma resposta linear e exponencial foram observadas para a FC e o lactato sanguíneo, respectivamente, durante o protocolo incremental. Este comportamento foi semelhante ao demonstrado durante protocolos incrementais com objetivo de avaliar a capacidade e a potência aeróbia realizados em outras modalidades cíclicas. Além disso, foram encontradas correlações significantes entre o pico de velocidade (PV e a velocidade correspondente ao início do acúmulo de lactato no sangue (vOBLA (r = 0,87, p = 0,005 e do PV com tempo de prática de surfe (r = 0,70, p = 0,03. No entanto, não foram encontradas correlações significativas entre PV e vOBLA com nenhuma das variáveis antropométricas mensuradas. Assim, podemos concluir que o protocolo incremental específico de remada no surfe utilizado no presente estudo poderia ser uma ferramenta útil na determinação de índices relacionados à capacidade (vOBLA e potência (PV aeróbia de surfistas.
Borrok, M Jack; Luheshi, Nadia M; Beyaz, Nurten; Davies, Gareth C; Legg, James W; Wu, Herren; Dall'Acqua, William F; Tsui, Ping
2015-01-01
Fc effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC) and antibody-dependent cell-mediated phagocytosis (ADCP) are crucial to the efficacy of many antibody therapeutics. In addition to IgG, antibodies of the IgA isotype can also promote cell killing through engagement of myeloid lineage cells via interactions between the IgA-Fc and FcαRI (CD89). Herein, we describe a unique, tandem IgG1/IgA2 antibody format in the context of a trastuzumab variable domain that exhibits enhanced ADCC and ADCP capabilities. The IgG1/IgA2 tandem Fc format retains IgG1 FcγR binding as well as FcRn-mediated serum persistence, yet is augmented with myeloid cell-mediated effector functions via FcαRI/IgA Fc interactions. In this work, we demonstrate anti-human epidermal growth factor receptor-2 antibodies with the unique tandem IgG1/IgA2 Fc can better recruit and engage cytotoxic polymorphonuclear (PMN) cells than either the parental IgG1 or IgA2. Pharmacokinetics of IgG1/IgA2 in BALB/c mice are similar to the parental IgG, and far surpass the poor serum persistence of IgA2. The IgG1/IgA2 format is expressed at similar levels and with similar thermal stability to IgG1, and can be purified via standard protein A chromatography. The tandem IgG1/IgA2 format could potentially augment IgG-based immunotherapeutics with enhanced PMN-mediated cytotoxicity while avoiding many of the problems associated with developing IgAs.
Journal de la Recherche Scientifique de l'Université de Lomé - Vol ...
African Journals Online (AJOL)
Journal de la Recherche Scientifique de l'Universite de Lome. ... V.J. Mama, J Oloukoi, F.C. Biaou, R Tete, 231-247 ... Etat des lieux et profil de l'imagerie par resonance magnetique dans l'exploration du cancer de la prostate au Togo · EMAIL ...
Schmøkel, Julie; Voldum, Anders; Tsakiridou, Georgia; Kuhlmann, Matthias; Cameron, Jason; Sørensen, Esben S.; Wengel, Jesper; Howard, Kenneth A.
2017-05-01
Aptamers are an attractive molecular medicine that offers high target specificity. Nucleic acid-based aptamers, however, are prone to nuclease degradation and rapid renal excretion that require blood circulatory half-life extension enabling technologies. The long circulatory half-life, predominately facilitated by engagement with the cellular recycling neonatal Fc receptor (FcRn), and ligand transport properties of albumin promote it as an attractive candidate to improve the pharmacokinetic profile of aptamers. This study investigates the effect of Cys34 site-selective covalent attachment of a factor IXa anticoagulant aptamer on aptamer functionality and human FcRn (hFcRn) engagement using recombinant human albumin (rHA) of either a wild type (WT) or an engineered human FcRn high binding variant (HB). Albumin-aptamer conjugates, connected covalently through a heterobifunctional succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate linker, were successfully prepared and purified by high performance liquid chromatography as confirmed by gel electrophoresis band-shift analysis and matrix-assisted laser desorption/ionization time of flight. Minimal reduction (∼25%) in activity of WT-linked aptamer to that of aptamer alone was found using an anticoagulant activity assay measuring temporal levels of activated partial thrombin. Covalent albumin-aptamer conjugation, however, substantially compromized binding to hFcRn, to 10% affinity of that of non-conjugated WT, determined by biolayer interferometry. Binding could be rescued by aptamer conjugation to recombinant albumin engineered for higher FcRn affinity (HB) that exhibited an 8-fold affinity compared to WT alone. This work describes a novel albumin-based aptamer delivery system whose hFcRn binding can be increased using a HB engineered albumin.
Evaluation of FcεRl-binding serum IgE in patients with ocular allergic diseases
Directory of Open Access Journals (Sweden)
Satoru Matsumoto
1999-01-01
Full Text Available We evaluated high-affinity receptor for IgE (FcεRI- binding serum IgE in patients with atopic keratoconjunctivitis (AKC; n=31 and with seasonal allergic conjunctivitis (SAC; n=13 by enzyme-linked immunosorbent assay (ELISA using a recombinant soluble form of the human FcεRIα ectodomain (soluble α. The quantities of FcεRI-binding IgE are compared with those of total IgE measured by a conventional sandwich ELISA. Both of the quantities of FcεRI-binding and total IgE in AKC were significantly larger than those in SAC (P<0.001. In contrast, the proportion of FcεRI- binding IgE (FcεRI-binding IgE/total IgE; % in SAC was significantly larger than that in AKC (P <0.001, although significant reverse correlation was observed between the proportion of FcεRI-binding IgE and total IgE in both AKC and SAC. Significantly, a higher proportion of FcεRI-binding IgE in SAC than that in AKC may reflect the differences in pathologic states of AKC and SAC that are caused by a disparity in immune responses in these diseases.
Directory of Open Access Journals (Sweden)
Corrado Lupo
2018-04-01
Full Text Available Abstract This study aimed to define a performance profile of elite hit ball matches. Eighty-six male Italian Serie A hit ball players (29.3±5.0 yrs participated in the study. A technical and tactical analysis (18 indicators was performed on eleven matches; heart rate (HR was monitored during matches on 25 players; countermovement jump (CMJ and maximal grip strength (GS were measured on all participants before and after match. Differences (P<0.05 between winning (W and losing (L teams for technical and tactical analysis (Chi-square, and between match phases for HR, CMJ, and GS (ANOVA for repeated measurements were tested. Hit ball teams meanly performed 297±10 rallies per match (W: 41±6 goals; L: 23±3 goals, P=0.042. No differences between quarters emerged for HR (171-190 bpm for 57±21 % of match duration. Opposite trends emerged for CMJ (after: 36.2±6.3 cm; before: 33.1±4.8 cm; P=0.001 and GS (after: 433±102 N; before: 463±98 N; P=0.018 performances. Findings show that hit ball is performed at high HR intensity, and that CMJ improves and GS declines after matches. This could be determined by a neuromuscular activation of lower limbs and repeated harm concussions due to shots. Resumen El estudio tenía como objetivo definir los perfiles de rendimiento en partidos de hit ball de elite. Un total de 81 jugadores italianos de la Serie A (29.3±5.0 años tomaron parte en el estudio. El análisis técnico y táctico (18 indicadores se realizó durante once partidos; la variable frecuencia cardíaca (FC fue monitorizada durante los partidos en 25 jugadores; el test de salto en contramovimiento (SCM y el test de fuerza máxima de prensión (FMP se midieron antes y después de cada partido. Las diferencias (P<0.05 entre equipos ganadores (G y perdedores (P en los aspectos técnicos y tácticos se realizó mediante el test de Chi-cuadrado, y para las diferencias entre las fases del partido en las variables FC, SCM y FMP se empleó el ANOVA de
Fcγ receptor expression on splenic macrophages in adult immune thrombocytopenia
Audia, S; Santegoets, K; Laarhoven, A G; Vidarsson, G; Facy, O; Ortega-Deballon, P; Samson, M; Janikashvili, N; Saas, P; Bonnotte, B; Radstake, T R
2017-01-01
Splenic macrophages play a key role in immune thrombocytopenia (ITP) pathogenesis by clearing opsonized platelets. Fcγ receptors (FcγR) participate in this phenomenon, but their expression on splenic macrophages and their modulation by treatment have scarcely been studied in human ITP. We aimed to
Stapleton, Nigel M; Armstrong-Fisher, Sylvia S; Andersen, Jan Terje; van der Schoot, C Ellen; Porter, Charlene; Page, Kenneth R; Falconer, Donald; de Haas, Masja; Williamson, Lorna M; Clark, Michael R; Vidarsson, Gestur; Armour, Kathryn L
2018-03-01
We have previously generated human IgG1 antibodies that were engineered for reduced binding to the classical Fcγ receptors (FcγRI-III) and C1q, thereby eliminating their destructive effector functions (constant region G1Δnab). In their potential use as blocking agents, favorable binding to the neonatal Fc receptor (FcRn) is important to preserve the long half-life typical of IgG. An ability to cross the placenta, which is also mediated, at least in part, by FcRn is desirable in some indications, such as feto-maternal alloimmune disorders. Here, we show that G1Δnab mutants retain pH-dependent binding to human FcRn but that the amino acid alterations reduce the affinity of the IgG1:FcRn interaction by 2.0-fold and 1.6-fold for the two antibodies investigated. The transport of the modified G1Δnab mutants across monolayers of human cell lines expressing FcRn was approximately 75% of the wild-type, except that no difference was observed with human umbilical vein endothelial cells. G1Δnab mutation also reduced transport in an ex vivo placenta model. In conclusion, we demonstrate that, although the G1Δnab mutations are away from the FcRn-binding site, they have long-distance effects, modulating FcRn binding and transcellular transport. Our findings have implications for the design of therapeutic human IgG with tailored effector functions. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.
Liability to disgorge profits upon breach of contract or a delict
Schrage, E.J.H.
2013-01-01
Remedies regarding contract and tort are, generally speaking, concerned with the incidence of liability for loss or damage suffered, whereas the claim in unjust enrichment is said to require that the enrichment has occurred at the expense of the creditor. Consequently claims for breach of contract
Kinder, Michelle; Greenplate, Allison R; Strohl, William R; Jordan, Robert E; Brezski, Randall J
2015-01-01
Cytotoxic therapeutic monoclonal antibodies (mAbs) often mediate target cell-killing by eliciting immune effector functions via Fc region interactions with cellular and humoral components of the immune system. Key functions include antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement-dependent cytotoxicity (CDC). However, there has been increased appreciation that along with cell-killing functions, the induction of antibody-dependent cytokine release (ADCR) can also influence disease microenvironments and therapeutic outcomes. Historically, most Fc engineering approaches have been aimed toward modulating ADCC, ADCP, or CDC. In the present study, we describe an Fc engineering approach that, while not resulting in impaired ADCC or ADCP, profoundly affects ADCR. As such, when peripheral blood mononuclear cells are used as effector cells against mAb-opsonized tumor cells, the described mAb variants elicit a similar profile and quantity of cytokines as IgG1. In contrast, although the variants elicit similar levels of tumor cell-killing as IgG1 with macrophage effector cells, the variants do not elicit macrophage-mediated ADCR against mAb-opsonized tumor cells. This study demonstrates that Fc engineering approaches can be employed to uncouple macrophage-mediated phagocytic and subsequent cell-killing functions from cytokine release.
34 CFR 97.408 - Requirements for permission by parents or guardians and for assent by children.
2010-07-01
... permission is not a reasonable requirement to protect the subjects (for example, neglected or abused children... for assent by children. 97.408 Section 97.408 Education Office of the Secretary, Department of Education PROTECTION OF HUMAN SUBJECTS Additional ED Protections for Children Who Are Subjects in Research...
High Affinity IgE-Fc Receptor alpha and gamma Subunit Interactions
International Nuclear Information System (INIS)
Rashid, A.; Housden, J. E. M.; Sabban, S.; Helm, B.
2014-01-01
Objective: To explore the relationships between the subunits (alpha, beta and gamma) of the high affinity IgE receptor (Fc and RI) and its ability to mediate transmembrane signaling. Study Design: Experimental study. Place and Duration of Study: Department of Molecular Biology and Biotechnology, University of Sheffield, UK, from 2008 to 2009. Methodology: The approach employed was to create a chimera (human alpha-gamma-gamma) using the extracellular (EC) domain of the human high affinity IgE receptor. The alpha subunit (huFc and RIalpha) of IgE receptor was spliced onto the rodent gamma TM and cytoplasmic domain (CD). This was transfected into the Rat Basophilic Leukemia cell line in order to assess the possibility of selectively activating cells transfected with this single pass construct for antigen induced mediator release. Results: The RBLs cell lines transfected with the huFc and RIalpha/gamma/gamma cDNA constructs were assessed for the cell surface expression of the huFc and RIalpha subunit and the response to the antigenic stimulus by looking for degranulation and intracellular Ca2+ mobilisation. The results obtained showed the absence of huFc and RIalpha subunit expression on the surface of transfected cells as seen by flowcytometric studies, beta-hexosaminidase assays and intracellular calcium mobilisation studies. Conclusion: In the present study the grounds for non-expression of huFc and RIalpha/gamma/gamma cDNA remains elusive but may be due to the fact that the human-rodent chimeric receptors are assembled differently than the endogenous rodent receptors as seen in study in which COS 7 cells were transfected with human/rat chimeric complexes. (author)
Directory of Open Access Journals (Sweden)
Nina Čelesnik Smodiš
Full Text Available BACKGROUND: We recently showed a desensitization of FcεRI-mediated basophil response after short-term VIT. Our aim was to evaluate the allergen specificity of this desensitization. METHODS: In 11 Hymenoptera-venom double positive subjects, basophil threshold sensitivity (CD-sens to anti-FcεRI, honeybee, and Vespula venom was assessed at the beginning and just before the first maintenance dose (MD of single ultra-rush VIT. In some patients we also monitored CD-sens to rApi m 1 and/or rVes v 5 or other co-sensitizations (i.e., grass pollen. In additional 7 patients, basophils were stripped and sensitized with house dust mite (HDM IgEs at the same time points. RESULTS: We demonstrated a marked reduction of CD-sens to anti-FcεRI and VIT-specific venom before the first MD in all 18 subjects included. Furthermore, in 10 out of 11 double positive subjects, a significant and comparable decrease before the first MD was also evident for non-VIT venom; this nonspecific decrease was further supported by the opposite recombinant species-specific major allergen. In one subject with additional grass pollen allergy, a decrease of CD-sens to grass allergen was also demonstrated. Similarly, in 7 cases of patients with passively HDM-sensitized basophils, a significant reduction of CD-sens was also evident to de novo sensitized HDM allergen. CONCLUSIONS: Short-term VIT induced basophil desensitization to VIT-specific as well as to VIT-nonspecific venom. As opposed to long-term VIT, which induces venom-specific changes, the effect of short-term VIT seems to be venom-nonspecific.
HR Department
2006-01-01
Following discussion at TREF and on the recommendation of the Finance Committee, Council approved a new staff contract policy, which became effective on 1 January 2006. Its application is covered by a new Administrative Circular No. 2 (Rev. 3) 'Recruitment, appointment and possible developments regarding the contractual position of staff members'. The revised circular replaces the previous Circulars No. 9 (Rev. 3) 'Staff contracts' and No. 2 (Rev. 2) 'Guidelines and procedures concerning recruitment and probation period for staff members'. The main features of the new contract policy are as follows: The new policy provides chances for long-term employment for all staff recruits staying for four years without distinguishing between those assigned to long-term or short-term activities when joining CERN. In addition, it presents a number of simplifications for the award of ICs. There are henceforth only 2 types of contract: Limited Duration (LD) contracts for all recruitment and Indefinite Contracts (IC) for...
Technical Training; Tel. 74460
2001-01-01
SPL is organizing Training Sessions on the Contract Follow Up application. CFU is a Web based tool, developped and supported by the Administrative Information Services. It allows the creation of Divisional Requests and the follow up of their processing, from the Market Survey to the Invitation to Tender or Price Enquiry, approval by the Finance Committee, up to the actual signature of a Contract, acccording to the CERN Purchasing procedures. It includes a document management component. It also provides link with other AIS applications such as BHT and EDH. The course is primarily intended for DPOs, Contract Technical responsibles in the division and their assistants, but is beneficial to anybody involved in the follow up of such Purchasing Procedures. This course is free of charge, but application is necessary. The details of the course may be found at http://training.web.cern.ch/Training/ENSTEC/P2001/Bureautique/cfu4_f.htm General information of CFU may be found at http://ais.cern.ch/apps/cfu/ The dates of t...
Directory of Open Access Journals (Sweden)
Luciane Moreira Chaves
2005-12-01
entre 66,41 ± 4,82 años. No se identificó ningún uso de hormonas ni cualquier otra medicina que pudieran afectar el metabolismo del hueso, así como las mujeres no tenían hábito de fumar ni de ingerir alcohólico. La composición corporal y DMO de la región femoral (CF y de la columna lumbar (CL fueron moderados a través de DXA, un DPX-IQ lunar. Las relaciones entre MCT, MM y MG y DMO de CF y de CL fueron hechas separadamente, a través del análisis de regresión lineal. El análisis de regresión múltiple fue usado para determinar la contribución de MCT, MM y MG en DMO de CF y de CL. RESULTADOS: MCT mostró una correlación con DMO de CF fuertemente y de CL (r = 0,54, p = 0,01 y r = 0,37, p = 0,01 respectivamente, que la MG (r = 0,30, p = 0,01 y r = 0,19, p = 0,06 respectivamente y MM (r = 0,44, p = 0,01 y r = 0,26, p = 0,05 respectivamente. CONCLUSIÓN: MCT y MM fueron los componentes corpórales que mantuvieron la relación significante con DMO de CF y de CL. MG mostró una correlación débil con DMO de CF y de CL, no siendo estatisticamente significante en este último rango. Así, MCT y una saludable MM, son entre las variables de la composición corporal, uno de los determinantes significativos de la DMO en las mujeres más viejas.There are controversies in the literature as to the importance of the total body mass (TBM, lean mass (LM, and fat mass (FM as determinant factors to the mineral bone density (MBD in elder women. PURPOSE: To determine the relationship of the MBD to the TBM, LM and FM in elder women. METHODS: It was studied ninety-seven 60-70 years old women (mean 66.41 ± 4.82 years. None of the participants was using hormones or any other medication that could affect the bone metabolism, as well as they were not smokers or alcohol consumers. The body composition and the MBD of the femoral cervix (FC and lumbar spine (LS were measured through DXA, a lunar DPX-IQ. The relationship between TBM, LM, and FM as well as the FC and LS' MBD were
Daga, Shruti; Shepherd, James G.; Callaghan, J. Garreth S.; Hung, Rachel K.Y.; Dawson, Dana K.; Padfield, Gareth J.; Hey, Shi Y.; Cartwright, Robyn A.; Newby, David E.; Fitzgerald, J. Ross
2011-01-01
Cardiac vegetations result from bacterium–platelet adherence, activation and aggregation, and are associated with increased morbidity and mortality in infective endocarditis. The GPIIb/IIIa and FcγRIIa platelet receptors play a central role in platelet adhesion, activation and aggregation induced by endocarditis pathogens such as Staphylococcus aureus, but the influence of known polymorphisms of these receptors on the pathogenesis of infective endocarditis is unknown. We determined the GPIIIa platelet antigen PlA1/A2 and FcγRIIa H131R genotype of healthy volunteers (n = 160) and patients with infective endocarditis (n = 40), and investigated the influence of these polymorphisms on clinical outcome in infective endocarditis and S. aureus–platelet interactions in vitro. Platelet receptor genotype did not correlate with development of infective endocarditis, vegetation characteristics on echocardiogram or the composite clinical end-point of embolism, heart failure, need for surgery or mortality (P > 0.05 for all), even though patients with the GPIIIa PlA1/A1 genotype had increased in vivo platelet activation (P = 0.001). Furthermore, neither GPIIIa PlA1/A2 nor FcγRIIa H131R genotype influenced S. aureus-induced platelet adhesion, activation or aggregation in vitro (P > 0.05). Taken together, our data suggest that the GPIIIa and FcγRIIa platelet receptor polymorphisms do not influence S. aureus–platelet interactions in vitro or the clinical course of infective endocarditis. PMID:21044892
Biomecânica da córnea após laser de femtossegundo na cirurgia de catarata
Directory of Open Access Journals (Sweden)
Bruno Freitas Valbon
2015-10-01
, respectivamente. O teste de Mann-Whitney foi realizado para avaliar as diferenças dos parâmetros biomecânicos da córnea derivados do Corvis ST entre os dois grupos (LFS; FC após a cirurgia de catarata (D1. Foi considerado como estatisticamente significante p ≤ 0,05%. Resultados: A média de idade dos pacientes do grupo do LFS foi de 67,6 anos (± 9,9 e do grupo do FC foi de 68,4 anos (± 11,8.A média do PNS entre todos os pacientes (análise objetiva do cristalino foi de 0,62 (± 0,67. No grupo do LFS, 9 dos 11 parâmetros foram estatisticamente significativos entre o Pré e D1; e no grupo do FC, 7 dos 11 parâmetros estudados foram estatisticamente significativos entre o Pré e D1. De todos os parâmetros biomecânicos derivados do Corvis ST estudados, somente o tempo de concavidade máxima da córnea (HC-time; p ≤ 0.0387 foi diferente entre os dois grupos (laser de femtossegundo x faco convencional em D1. Conclusão: O laser de femtossegundo para cirurgia de catarata e a técnica de facoemulsificação convencional induziram alterações nas propriedades biomecânicas da córnea pelo Corvis ST no D1. Apenas 1 dos 11 parâmetros biomecânicos estudados foi diferente estatisticamente entre os grupos do LFS e FC.
2010-10-01
... laws to Executive agency contracts for the acquisition of commercial items. 12.503 Section 12.503... COMMERCIAL ITEMS Applicability of Certain Laws to the Acquisition of Commercial Items and Commercially... acquisition of commercial items. (a) The following laws are not applicable to Executive agency contracts for...
2010-10-01
... laws to executive agency contracts for the acquisition of commercial items. 212.503 Section 212.503... ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Applicability of Certain Laws to the Acquisition of Commercial Items 212.503 Applicability of certain laws to executive agency contracts for the acquisition of...
Directory of Open Access Journals (Sweden)
Yesid González
2011-10-01
Full Text Available En Colombia, desde 1984, se permite el empleo de antibióticos promotoresde crecimiento (APC, como mecanismo para mejorar el rendimiento productivode la avicultura, pero el uso de APC a niveles subterapéuticos favorece la aparición de factores de resistencia a estos medicamentos, causando un problema de salud pública, por el surgimiento de bacterias resistentes. De ahí, que el uso de extractos vegetales es una alternativa fitogénetica al uso de los APC. Entre varios, el de orégano ha sido comúnmente usado en la alimentación animal por sus efectos antioxidantes y bacteriostáticos permitiendo el mejoramiento del rendimiento productivo de pollos de engorde. El objetivo de este trabajo es evaluar el efecto de la adición de hojas frescas de orégano (O. vulgare en la ganancia de peso, eficiencia y conversión alimenticia en pollos de la línea Cobb. Para esto se realizó un estudio con un modelo experimental aleatorio con una duración de 32 días; 8 de los cuales fueron de adaptación a las hojas de dicha planta. Se emplearon tres tratamientos, cada uno con 30 pollos de la línea Cobb con registros independientes y alimentados con un concentrado comercial. El T3 denominado control, sin inclusión de hojas de orégano; en los tratamientos T1 y T2 se adicionó a la dieta comercialel 1 y 5% de hojas frescas de orégano respectivamente. Se observó que no hay diferencias estadísticamente significativas (p≥0.05 para la ganancia de peso, pero sí para la eficiencia y conversión alimenticia (p≤ 0.05 con respecto al tratamiento control (T3.
Bohrson, W. A.; Spera, F. J.
2004-12-01
Energy-Constrained Eruption, Recharge, Assimilation and Fractional Crystallization (E'RAχFC) tracks the evolution of an open-system magmatic system by coupling conservation equations governing energy, mass and species (isotopes and trace elements). By linking the compositional characteristics of a composite magmatic system (host magma, recharge magma, wallrock, eruptive reservoir) to its mass and energy fluxes, predictions can be made about the chemical evolution of systems characterized by distinct compositional and thermal characteristics. An interesting application of E'RAχFC involves documenting the influence distinct thermal regimes have on the chemical evolution of magmatic systems. Heat transfer between a magma-country rock system at epizonal depths can be viewed as a conjugate heat transfer problem in which the average country rock-magma boundary temperature, Tb, is governed by the relative vigor of hydrothermal convection in the country rock vs. magma convection. For cases where hydrothermal circulation is vigorous and magmatic heat is efficiently transported away from the boundary, contact aureole temperatures (~Tb) are low. In cases where magmatic heat can not be efficiently transported away from the boundary and hydrothermal cells are absent or poorly developed, Tb is relatively high. Simultaneous solution of the differential equations governing momentum and energy conservation and continuity for the coupled hydrothermal-magmatic conjugate heat transfer system enables calculation of the characteristic timescale for EC-RAFC evolution and development of hydrothermal deposits as a function of material and medium properties, sizes of systems and relative efficiency of hydrothermal vs. magmatic heat transfer. Characteristic timescales lie in the range 102-106 yr depending on system size, magma properties and permeability among other parameters. In E'RAχFC, Tb is approximated by the user-defined equilibration temperature, Teq, which is the temperature at
Directory of Open Access Journals (Sweden)
Dawn L Cooper
Full Text Available OBJECTIVE: The expression of FcγRIIIa/CD16 may render monocytes targets for activation by IgG-containing immune complexes (IC. We investigated whether FcγRIIIa/CD16 was upregulated in rheumatoid arthritis (RA, associated with TNF production in response to IC-stimulation, and if this predicted response to methotrexate therapy. METHODS: FcγRIIIa/CD16 expression on CD14(low and CD14++ monocytes was measured by flow cytometry in healthy controls and RA patients (early and long-standing disease. Intracellular TNF-staining was carried out after in vitro LPS or heat-aggregated immunoglobulin (HAG activation. FcγRIIIa/CD16 expression pre- and post-steroid/methotrexate treatment was examined. RESULTS: Increased FcγRIIIa/CD16 expression on CD14++ monocytes in long-standing RA patients compared to controls was demonstrated (p = 0.002 with intermediate levels in early-RA patients. HAG-induced TNF-production in RA patients was correlated with the percentage of CD14++ monocytes expressing FcγRIIIa/CD16 (p<0.001. The percentage of CD14++ monocytes expressing FcγRIIIa/CD16 at baseline in early DMARD-naïve RA patients was negatively correlated with DAS28-ESR improvement 14-weeks post-methotrexate therapy (p = 0.003 and was significantly increased in EULAR non-responders compared to moderate (p = 0.01 or good responders (p = 0.003. FcγRIIIa/CD16 expression was not correlated with age, presence of systemic inflammation or autoantibody titers. CONCLUSION: Increased FcγRIIIa/CD16 expression on CD14++ monocytes in RA may result in a cell that has increased responsiveness to IC-stimulation. This monocyte subset may contribute to non-response to methotrexate therapy.
Cooper, Dawn L.; Martin, Stephen G.; Robinson, James I.; Mackie, Sarah L.; Charles, Christopher J.; Nam, Jackie; Consortium, YEAR; Isaacs, John D.; Emery, Paul; Morgan, Ann W.
2012-01-01
Objective The expression of FcγRIIIa/CD16 may render monocytes targets for activation by IgG-containing immune complexes (IC). We investigated whether FcγRIIIa/CD16 was upregulated in rheumatoid arthritis (RA), associated with TNF production in response to IC-stimulation, and if this predicted response to methotrexate therapy. Methods FcγRIIIa/CD16 expression on CD14low and CD14++ monocytes was measured by flow cytometry in healthy controls and RA patients (early and long-standing disease). Intracellular TNF-staining was carried out after in vitro LPS or heat-aggregated immunoglobulin (HAG) activation. FcγRIIIa/CD16 expression pre- and post-steroid/methotrexate treatment was examined. Results Increased FcγRIIIa/CD16 expression on CD14++ monocytes in long-standing RA patients compared to controls was demonstrated (p = 0.002) with intermediate levels in early-RA patients. HAG-induced TNF-production in RA patients was correlated with the percentage of CD14++ monocytes expressing FcγRIIIa/CD16 (p<0.001). The percentage of CD14++ monocytes expressing FcγRIIIa/CD16 at baseline in early DMARD-naïve RA patients was negatively correlated with DAS28-ESR improvement 14-weeks post-methotrexate therapy (p = 0.003) and was significantly increased in EULAR non-responders compared to moderate (p = 0.01) or good responders (p = 0.003). FcγRIIIa/CD16 expression was not correlated with age, presence of systemic inflammation or autoantibody titers. Conclusion Increased FcγRIIIa/CD16 expression on CD14++ monocytes in RA may result in a cell that has increased responsiveness to IC-stimulation. This monocyte subset may contribute to non-response to methotrexate therapy. PMID:22235253
Surveillance for Intracellular Antibody by Cytosolic Fc Receptor TRIM21
Directory of Open Access Journals (Sweden)
William A. McEwan
2016-11-01
Full Text Available TRIM21 has emerged as an atypical Fc receptor that is broadly conserved and widely expressed in the cytoplasm of mammalian cells. Viruses that traffic surface-bound antibodies into the cell during infection recruit TRIM21 via a high affinity interaction between Fc and TRIM21 PRYSPRY domain. Following binding of intracellular antibody, TRIM21 acts as both antiviral effector and sensor for innate immune signalling. These activities serve to reduce viral replication by orders of magnitude in vitro and contribute to host survival during in vivo infection. Neutralization occurs rapidly after detection and requires the activity of the ubiquitin-proteasome system. The microbial targets of this arm of intracellular immunity are still being identified: TRIM21 activity has been reported following infection by several non-enveloped viruses and intracellular bacteria. These findings extend the sphere of influence of antibodies to the intracellular domain and have broad implications for immunity. TRIM21 has been implicated in the chronic auto-immune condition systemic lupus erythematosus and is itself an auto-antigen in Sjögren’s syndrome. This review summarises our current understanding of TRIM21’s role as a cytosolic Fc receptor and briefly discusses pathological circumstances where intracellular antibodies have been described, or are hypothesized to occur, and may benefit from further investigations of the role of TRIM21.
Fcγ receptor-mediated inflammation inhibits axon regeneration.
Directory of Open Access Journals (Sweden)
Gang Zhang
Full Text Available Anti-glycan/ganglioside antibodies are the most common immune effectors found in patients with Guillain-Barré Syndrome, which is a peripheral autoimmune neuropathy. We previously reported that disease-relevant anti-glycan autoantibodies inhibited axon regeneration, which echo the clinical association of these antibodies and poor recovery in Guillain-Barré Syndrome. However, the specific molecular and cellular elements involved in this antibody-mediated inhibition of axon regeneration are not previously defined. This study examined the role of Fcγ receptors and macrophages in the antibody-mediated inhibition of axon regeneration. A well characterized antibody passive transfer sciatic nerve crush and transplant models were used to study the anti-ganglioside antibody-mediated inhibition of axon regeneration in wild type and various mutant and transgenic mice with altered expression of specific Fcγ receptors and macrophage/microglia populations. Outcome measures included behavior, electrophysiology, morphometry, immunocytochemistry, quantitative real-time PCR, and western blotting. We demonstrate that the presence of autoantibodies, directed against neuronal/axonal cell surface gangliosides, in the injured mammalian peripheral nerves switch the proregenerative inflammatory environment to growth inhibitory milieu by engaging specific activating Fcγ receptors on recruited monocyte-derived macrophages to cause severe inhibition of axon regeneration. Our data demonstrate that the antibody orchestrated Fcγ receptor-mediated switch in inflammation is one mechanism underlying inhibition of axon regeneration. These findings have clinical implications for nerve repair and recovery in antibody-mediated immune neuropathies. Our results add to the complexity of axon regeneration in injured peripheral and central nervous systems as adverse effects of B cells and autoantibodies on neural injury and repair are increasingly recognized.
A soluble form of the high affinity IgE receptor, Fc-epsilon-RI, circulates in human serum.
Directory of Open Access Journals (Sweden)
Eleonora Dehlink
Full Text Available Soluble IgE receptors are potential in vivo modulators of IgE-mediated immune responses and are thus important for our basic understanding of allergic responses. We here characterize a novel soluble version of the IgE-binding alpha-chain of Fc-epsilon-RI (sFcεRI, the high affinity receptor for IgE. sFcεRI immunoprecipitates as a protein of ∼40 kDa and contains an intact IgE-binding site. In human serum, sFcεRI is found as a soluble free IgE receptor as well as a complex with IgE. Using a newly established ELISA, we show that serum sFcεRI levels correlate with serum IgE in patients with elevated IgE. We also show that serum of individuals with normal IgE levels can be found to contain high levels of sFcεRI. After IgE-antigen-mediated crosslinking of surface FcεRI, we detect sFcεRI in the exosome-depleted, soluble fraction of cell culture supernatants. We further show that sFcεRI can block binding of IgE to FcεRI expressed at the cell surface. In summary, we here describe the alpha-chain of FcεRI as a circulating soluble IgE receptor isoform in human serum.
Soleimanpour, Saman; Hassannia, Tahereh; Motiee, Mahdieh; Amini, Abbas Ali; Rezaee, S A R
2017-05-01
Affinity tags are vital tools for the production of high-throughput recombinant proteins. Several affinity tags, such as the hexahistidine tag, maltose-binding protein, streptavidin-binding peptide tag, calmodulin-binding peptide, c-Myc tag, glutathione S-transferase and FLAG tag, have been introduced for recombinant protein production. The fragment crystallizable (Fc) domain of the IgG1 antibody is one of the useful affinity tags that can facilitate detection, purification and localization of proteins and can improve the immunogenicity, modulatory effects, physicochemical and pharmaceutical properties of proteins. Fcγ recombinant forms a group of recombinant proteins called Fc-fusion proteins (FFPs). FFPs are widely used in drug discovery, drug delivery, vaccine design and experimental research on receptor-ligand interactions. These fusion proteins have become successful alternatives to monoclonal antibodies for drug developments. In this review, the physicochemical, biochemical, immunological, pharmaceutical and therapeutic properties of recombinant FFPs were discussed as a new generation of bioengineering strategies.
International Nuclear Information System (INIS)
Shimoyama, Shunji
1975-01-01
A turnkey contract is recommended to such a country which is in the initial stage of nuclear power development with respect to a few plants being constructed earlier. The prime contractor may not necessarily be a reactor supplier. In some cases an architect engineering company may be a contractor. If this arrangement is not possible and the contract had to be a non-turnkey type, there might be some advantage to such a developing country capable of undertaking some major portions of the project works. Even if she might face with troubles and difficulties during construction of the first nuclear power station, she might have chance of aquiring technical kowledge and experience which would later enable her to make the plant of her own manufacture. In such a case it is advisable to limit the number of main contracts as small as possible and to utilize an organization to assist the owner in project management or to assume this function in his behalf. (orig./FW) [de
48 CFR 970.2210 - Service Contract Act.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Service Contract Act. 970... REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Application of Labor Policies 970.2210 Service Contract Act. The Service Contract Act of 1965 is not applicable to contracts for the management and operation of...
Activation-induced proteolysis of cytoplasmic domain of zeta in T cell receptors and Fc receptors.
Taupin, J L; Anderson, P
1994-12-01
The CD3-T cell receptor (TCR) complex on T cells and the Fc gamma receptor type III (Fc gamma RIII)-zeta-gamma complex on natural killer cells are functionally analogous activation receptors that associate with a family of disulfide-linked dimers composed of the related subunits zeta and gamma. Immunochemical analysis of receptor complexes separated on two-dimensional diagonal gels allowed the identification of a previously uncharacterized zeta-p14 heterodimer. zeta-p14 is a component of both CD3-TCR and Fc gamma RIII-zeta-gamma. Peptide mapping analysis shows that p14 is structurally related to zeta, suggesting that it is either: (i) derived from zeta proteolytically or (ii) the product of an alternatively spliced mRNA. The observation that COS cells transformed with a cDNA encoding zeta express zeta-p14 supports the former possibility. The expression of CD3-TCR complexes including zeta-p14 increases following activation with phorbol 12-myristate 13-acetate or concanavalin A, suggesting that proteolysis of zeta may contribute to receptor modulation or desensitization.
Contribution of PIP-5 kinase Iα to raft-based FcγRIIA signaling
International Nuclear Information System (INIS)
Szymanska, Ewelina; Korzeniowski, Marek; Raynal, Patrick; Sobota, Andrzej; Kwiatkowska, Katarzyna
2009-01-01
Receptor FcγIIA (FcγRIIA) associates with plasma membrane rafts upon activation to trigger signaling cascades leading to actin polymerization. We examined whether compartmentalization of PI(4,5)P 2 and PI(4,5)P 2 -synthesizing PIP5-kinase Iα to rafts contributes to FcγRIIA signaling. A fraction of PIP5-kinase Iα was detected in raft-originating detergent-resistant membranes (DRM) isolated from U937 monocytes and other cells. The DRM of U937 monocytes contained also a major fraction of PI(4,5)P 2 . PIP5-kinase Iα bound PI(4,5)P 2 , and depletion of the lipid displaced PIP5-kinase Iα from the DRM. Activation of FcγRIIA in BHK transfectants led to recruitment of the kinase to the plasma membrane and enrichment of DRM in PI(4,5)P 2 . Immunofluorescence studies revealed that in resting cells the kinase was associated with the plasma membrane, cytoplasmic vesicles and the nucleus. After FcγRIIA activation, PIP5-kinase Iα and PI(4,5)P 2 co-localized transiently with the activated receptor at distinct cellular locations. Immunoelectron microscopy studies revealed that PIP5-kinase Iα and PI(4,5)P 2 were present at the edges of electron-dense assemblies containing activated FcγRIIA in their core. The data suggest that activation of FcγRIIA leads to membrane rafts coalescing into signaling platforms containing PIP5-kinase Iα and PI(4,5)P 2
Soto Curo, Lisbeth Maritza
2016-01-01
El presente trabajo de investigación tiene como objetivo general determinar de qué manera hay una relación entre gestión educativa y ética profesional de los docentes de la Red 03, UGEL 05 de San Juan de Lurigancho, 2015 la muestra consideró una parte de la población, en los cuales se ha utilizado la variable: gestión educativa y ética profesional. El tipo de investigación fue básica, enfoque cuantitativo, método hipotético deductivo, diseño no experimental corte transeccional ...
Energy Technology Data Exchange (ETDEWEB)
Martinez, Juan Bonifacio; Urena Nunez, Fernando [Instituto Nacional de Investigaciones Nucleares, Ocoyoacac, Estado de Mexico (Mexico)]. E-mail: juan.bonifacio@inin.gob.mx
2009-09-15
This work presents hydrogen absorption in quaternary alloy Mg1.95Ti0.05Ni0.95Cu0.05 obtained by the mechanical alloying method, followed by thermal treatment in ultra-high pure argon atmosphere. The composition of the phases, microstructure and morphology of ground powders and with thermal treatment were characterized by DRX, SEM/EDS and TEM. After 20 hours of mechanical grinding and recooked at 300 degrees Celsius/1h in argon atmosphere, the quaternary alloy has a Mg{sub 2}Ni crystalline hexagonal structure with a crystallite size under 10 nm. The absorption measurements were performed under a pressure of 0.2 to 1.2 MPa at a temperature of 200 degrees Celsius in a micro-reactor. The quantification of absorption-desorption of hydrogen in the intermetallic was conducted in a TGA-DSC simultaneous calorimeter. Metallic hydride-dehydride powder was characterized with SEM and XRD. [Spanish] En este trabajo se presenta la absorcion de hidrogeno en la aleacion cuaternaria Mg1.95Ti0.05Ni0.95Cu0.05 obtenida por el metodo de aleado mecanico, seguida de tratamiento termico en atmosfera de argon de ultra alta pureza. La composicion de las fases, microestructura y morfologia de los polvos molidos y con tratamiento termico fue caracterizada por DRX, SEM/EDS y TEM. Despues de 20 h de molienda mecanica con recocido a 300 grados Celsios/1h en atmosfera de argon, la aleacion cuaternaria tiene una estructura cristalina hexagonal Mg{sub 2}Ni con tamano de cristalito menor a 10 nm. Las mediciones de absorcion fueron realizadas bajo una presion de 0.2 a 1.2 MPa a una temperatura de 200 grados Celsios en un micro-reactor. La cuantificacion de absorcion-desorcion de hidrogeno en el intermetalico se realizo en un calorimetro simultaneo TGA-DSC. Se determino que la cantidad maxima absorbida de hidrogeno en la aleacion cuaternaria fue de 3.24% en peso cuando la presion fue de 0.8 MPa a dicha temperatura. Polvos metalicos hidrurados-deshidrurados se caracterizaron por SEM y XRD.
Tax, W J; Tamboer, W P; Jacobs, C W; Frenken, L A; Koene, R A
1997-01-15
Anti-CD3 monoclonal antibody (mAb) OKT3 is immunosuppressive, but causes severe adverse effects during the first administration ("first-dose reaction"). These adverse effects are presumably caused by cytokine release that results from T-cell activation. In vitro, T-cell activation by anti-CD3 mAb requires interaction with monocyte Fc receptors. The Fc receptor for murine IgG1, Fc gammaRIIa, is polymorphic. In some individuals, murine IgG1 anti-CD3 mAb causes T-cell proliferation and cytokine release in vitro (high responders [HR]), whereas in individuals with the low-responder (LR) phenotype it does not. We have now investigated the role of this Fc gammaRIIa polymorphism in the release of cytokines in vivo and the occurrence of adverse effects after the administration of WT31, a murine IgG1 anti-CD3/T cell receptor mAb. WT31 caused an increase of plasma tumor necrosis factor-alpha in all four HR patients and none of the five LR patients. In all HR patients except one, plasma gamma-interferon and interleukin 6 also increased, and a first-dose response was observed, whereas no cytokine release or adverse effects occurred in any of the LR patients. WT31 caused lymphopenia in all HR and none of the LR patients. FACS analysis demonstrated that in HR patients, after the initial disappearance of CD3+ cells from peripheral blood, modulation of CD3 occurred, whereas in LR patients a high degree of coating of the lymphocytes was observed. Surprisingly, WT31 also induced a marked granulocytopenia, as well as a decrease of thrombocytes, in three of the four HR patients (and in none of the LR patients). These data provide direct clinical evidence that Fc receptor interaction determines the release of cytokines and the occurrence of adverse effects after administration of anti-CD3/T cell receptor mAb. Furthermore, these data suggest that tumor necrosis factor-alpha by itself is not sufficient to induce the first-dose reaction.
Preparation and Characterization of FC Films Coated on PET Substrates by RF Magnetron Sputtering
Directory of Open Access Journals (Sweden)
Huang Mei-lin
2018-01-01
Full Text Available Fluorocarbon (FC films were prepared on polyethylene terephthalate (PET plates and PET fabrics respectively by a radiofrequency (RF magnetron sputtering technique using polytetrafluoroethylene (PTFE as a target. Scanning electron microscope and X-ray photoelectron spectroscopy were used to investigate the morphology, structure and composition of the obtained FC films. The hydrophobicity and uvioresistant properties of the FC film coated fabric were studied. The results show that the FC films were successfully deposited on the PET substrates by a RF magnetron sputtering. The deposited films are made up of four components -CF3, -CF2-, CF- and -C-. The proportions of the four components and surface morphologies of the deposited films vary with the sputtering conditions. Compared with the original fabric samples, the hydrophobicity of the FC film coated fabrics is quite good and improved significantly.
Choi, Hyoung-Seuk; Choi, Soon-Mok; Choi, Duck-Kyun
2016-01-01
A Pb-free PTC (positive temperature coefficient thermistor) heater was developed in the Ba0.97(Bi0.5Na0.5)0.03TiO3 system especially for automotive part applications. The reliability was verified by using a thermal cycling test designed on the basis of the result from a quality function deployment (QFD) analysis. We compared the thermal cycling test results from the newly-developed Pb-free PTC heaters with the results from PTC heaters currently on the market, namely, PTC heaters containing Pb. Life prediction and stress-strength relationships were analyzed together with a thermal diffusivity evaluation. We discuss the potential failure mechanisms during the thermal cycling test, focusing on the fact that electrical degradation in PTC materials is closely related to mechanical degradation due to the internal stress in the materials that comes from repeated phase changes. Different grain size distributions on the sintered bulks were considered to a key factor for explaining the different results of the reliability tests between the new Pb-free PTC heaters developed in this study and the commercial PTC heaters containing Pb.
DEFF Research Database (Denmark)
Jensen, Pernille Foged; Larraillet, Vincent; Schlothauer, Tilman
2015-01-01
The recycling of immunoglobulins by the neonatal Fc receptor (FcRn) is of crucial importance in the maintenance of antibody levels in plasma and is responsible for the long half-lives of endogenous and recombinant monoclonal antibodies. From a therapeutic point of view there is great interest...... in understanding and modulating the IgG-FcRn interaction to optimize antibody pharmacokinetics and ultimately improve efficacy and safety. Here we studied the interaction between a full-length human IgG1 and human FcRn via hydrogen/deuterium exchange mass spectrometry and targeted electron transfer dissociation...... to map sites perturbed by binding on both partners of the IgG-FcRn complex. Several regions in the antibody Fc region and the FcRn were protected from exchange upon complex formation, in good agreement with previous crystallographic studies of FcRn in complex with the Fc fragment. Interestingly, we found...
Liu, Liming
2015-06-01
Understanding the impact of glycosylation and keeping a close control on glycosylation of product candidates are required for both novel and biosimilar monoclonal antibodies (mAbs) and Fc-fusion protein development to ensure proper safety and efficacy profiles. Most therapeutic mAbs are of IgG class and contain a glycosylation site in the Fc region at amino acid position 297 and, in some cases, in the Fab region. For Fc-fusion proteins, glycosylation also frequently occurs in the fusion partners. Depending on the expression host, glycosylation patterns in mAb or Fc-fusions can be significantly different, thus significantly impacting the pharmacokinetics (PK) and pharmacodynamics (PD) of mAbs. Glycans that have a major impact on PK and PD of mAb or Fc-fusion proteins include mannose, sialic acids, fucose (Fuc), and galactose (Gal). Mannosylated glycans can impact the PK of the molecule, leading to reduced exposure and potentially lower efficacy. The level of sialic acid, N-acetylneuraminic acid (NANA), can also have a significant impact on the PK of Fc-fusion molecules. Core Fuc in the glycan structure reduces IgG antibody binding to IgG Fc receptor IIIa relative to IgG lacking Fuc, resulting in decreased antibody-dependent cell-mediated cytotoxicity (ADCC) activities. Glycoengineered Chinese hamster ovary (CHO) expression systems can produce afucosylated mAbs that have increased ADCC activities. Terminal Gal in a mAb is important in the complement-dependent cytotoxicity (CDC) in that lower levels of Gal reduce CDC activity. Glycans can also have impacts on the safety of mAb. mAbs produced in murine myeloma cells such as NS0 and SP2/0 contain glycans such as Galα1-3Galβ1-4N-acetylglucosamine-R and N-glycolylneuraminic acid (NGNA) that are not naturally present in humans and can be immunogenic when used as therapeutics. © 2015 Wiley Periodicals, Inc. and the American Pharmacists Association.
B97-3c: A revised low-cost variant of the B97-D density functional method
Brandenburg, Jan Gerit; Bannwarth, Christoph; Hansen, Andreas; Grimme, Stefan
2018-02-01
A revised version of the well-established B97-D density functional approximation with general applicability for chemical properties of large systems is proposed. Like B97-D, it is based on Becke's power-series ansatz from 1997 and is explicitly parametrized by including the standard D3 semi-classical dispersion correction. The orbitals are expanded in a modified valence triple-zeta Gaussian basis set, which is available for all elements up to Rn. Remaining basis set errors are mostly absorbed in the modified B97 parametrization, while an established atom-pairwise short-range potential is applied to correct for the systematically too long bonds of main group elements which are typical for most semi-local density functionals. The new composite scheme (termed B97-3c) completes the hierarchy of "low-cost" electronic structure methods, which are all mainly free of basis set superposition error and account for most interactions in a physically sound and asymptotically correct manner. B97-3c yields excellent molecular and condensed phase geometries, similar to most hybrid functionals evaluated in a larger basis set expansion. Results on the comprehensive GMTKN55 energy database demonstrate its good performance for main group thermochemistry, kinetics, and non-covalent interactions, when compared to functionals of the same class. This also transfers to metal-organic reactions, which is a major area of applicability for semi-local functionals. B97-3c can be routinely applied to hundreds of atoms on a single processor and we suggest it as a robust computational tool, in particular, for more strongly correlated systems where our previously published "3c" schemes might be problematic.
Energy Technology Data Exchange (ETDEWEB)
Li, Mi [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Liu, Lianqing, E-mail: lqliu@sia.cn [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); Xi, Ning [Department of Mechanical and Biomedical Engineering, City University of Hong Kong, Hong Kong (China); Wang, Yuechao [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); Xiao, Xiubin [Department of Lymphoma, Affiliated Hospital of Military Medical Academy of Sciences, Beijing 100071 (China); Zhang, Weijing, E-mail: zhangwj3072@163.com [Department of Lymphoma, Affiliated Hospital of Military Medical Academy of Sciences, Beijing 100071 (China)
2013-09-06
Highlights: •Nanoscale cellular ultra-structures of macrophages were observed. •The binding affinities of FcγRs were measured directly on macrophages. •The nanoscale distributions of FcγRs were mapped on macrophages. -- Abstract: Fc gamma receptors (FcγR), widely expressed on effector cells (e.g., NK cells, macrophages), play an important role in clinical cancer immunotherapy. The binding of FcγRs to the Fc portions of antibodies that are attached to the target cells can activate the antibody-dependent cell-mediated cytotoxicity (ADCC) killing mechanism which leads to the lysis of target cells. In this work, we used atomic force microscopy (AFM) to observe the cellular ultra-structures and measure the biophysical properties (affinity and distribution) of FcγRs on single macrophages in aqueous environments. AFM imaging was used to obtain the topographies of macrophages, revealing the nanoscale cellular fine structures. For molecular interaction recognition, antibody molecules were attached onto AFM tips via a heterobifunctional polyethylene glycol (PEG) crosslinker. With AFM single-molecule force spectroscopy, the binding affinities of FcγRs were quantitatively measured on single macrophages. Adhesion force mapping method was used to localize the FcγRs, revealing the nanoscale distribution of FcγRs on local areas of macrophages. The experimental results can improve our understanding of FcγRs on macrophages; the established approach will facilitate further research on physiological activities involved in antibody-based immunotherapy.
Análisis de la respuesta cardiaca de árbitros de fútbol en competición: estudio de caso.
Directory of Open Access Journals (Sweden)
Daniel Castillo Alvira
2015-05-01
Full Text Available Los objetivos de este estudio fueron, por un lado, examinar la respuesta cardiaca de un árbitro de fútbol tanto durante un test de campo incremental como durante dos partidos en un torneo nacional de categoría cadete, y por otro lado, determinar las zonas de intensidad del árbitro durante los partidos atendiendo a su FCmax individual. Un árbitro de fútbol de categoría nacional fue equipado con un pulsómetro (Polar Electro Oy, Kempele, Finlandia y su FC fue monitorizada durante la realización del Yo-Yo de recuperación intermitente nivel 1 (YYIR1 y durante dos partidos de un Torneo de Fútbol de categoría cadete. Las zonas de intensidad se establecieron atendiendo a la clasificación de Edwards (1993. La FCmax obtenida en el YYIR1 y en los partidos fue de 178 ppm y 161 ppm, respectivamente. Durante los partidos la FCmed registrada fue de 127 ± 1,03 ppm que corresponde a un 71,3% de la FCmax obtenida en el YYIR1. La distribución de la frecuencia cardiaca atendiendo a las zonas establecidas es la siguiente: 10 ± 1,95% (zona 1, 32 ± 1,65% (zona 2, 38 ± 5,14% (zona 3, 19 ± 4,31% (zona 4 y 1 ± 0,53% (zona 5. Los resultados obtenidos nos muestran que la FC más alta alcanzada en partidos de categoría cadete es inferior a la alcanzada en el YYIR1. Además, se observa que la carga interna, medida mediante FC obtenida en partidos, es inferior a la reportada en otros estudios con árbitros en partidos de categoría sénior.
Unusual ZFC and FC magnetic behavior in thin Co multi-layered structure
Energy Technology Data Exchange (ETDEWEB)
Ben-Dor, Oren; Yochelis, Shira [Department of Applied Physics, Center of Nanoscience and Nanotechnology, Hebrew University, Jerusalem 91904 (Israel); Felner, Israel [Racah Institute of Physics, Hebrew University, Jerusalem 91904 (Israel); Paltiel, Yossi [Department of Applied Physics, Center of Nanoscience and Nanotechnology, Hebrew University, Jerusalem 91904 (Israel)
2017-04-15
The observation of unusual magnetic phenomena in a Ni -based magnetic memory device ( O. Ben-Dor et al., 2013) encouraged us to conduct a systematic research on Co based multi-layered structure which contains a α-helix L polyalanine (AHPA-L) organic compound. The constant Co thickness is 7 nm and AHPA-L was also replaced by non-chiral 1-Decanethiol organic molecules. Both organic compounds were chemisorbed on gold by a thiol group. The dc magnetic field (H) was applied parallel and perpendicular to the surface layers. The perpendicular direction is the easy magnetization axis and along this orientation only, the zero-field-cooled (ZFC) plots exhibit a pronounced peak around 55–58 K. This peak is suppressed in the second ZFC and field-cooled (FC) runs performed shortly after the virgin ZFC one. Thus, around the peak position ZFC>FC a phenomenon seldom observed. This peak reappears after measuring the same material six months later. This behavior appears in layers with the non-chiral 1-Decanethiol and it is very similar to that obtained in sulfur doped amorphous carbon. The peak origin and the peculiar ZFC>FC case are qualitatively explained. - Highlights: • FC curve crosses ZFC curve in a 7 nm Co and thiol-based organic molecules multi-layered structure. • The ZFC>FC phenomena occurs for H perpendicular along the easy axis. • This phenomenon disappears in the second FC-ZFC run performed shortly after. • The unusual behavior reappears after six months.
Controlling DIII-D QH-Mode Particle and Electron Thermal Transport with ECH
Ernst, D. R.; Burrell, K. H.; Rhodes, T. L.; Guttenfelder, W.; McKee, G. R.; Grierson, B. A.; Holland, C.; Dimits, A.; Petty, C. C.; Schmitz, L.; Wang, G.; Zeng, L.; Doyle, E. J.; Austin, M. E.
2014-10-01
Quiescent H-mode core particle transport and density peaking are locally controlled by modulated electron cyclotron heating (ECH) at ρ ~ 0 . 2 . Gyrokinetic simulations show density gradient driven trapped electron modes (TEMs) are only unstable in the inner core, where the density profile flattens in response to ECH. Thus α-heating could reduce density peaking, providing burn control. Density fluctuations from Doppler backscattering intensify at TEM wavenumbers kθρs ~ 0 . 8 during ECH, while new quasi-coherent modes are observed with adjacent toroidal mode numbers consistent with TEMs. Separately, ECH at two-deposition locations (r / a ~ ρ = 0 . 5 & 0.7) varied the electron temperature gradient. A jump in ``heat pulse'' diffusivity during the scan indicates a critical gradient was crossed. Work supported by the US DOE under DE-FC02-08ER54966, DE-FC02-04ER54698, DE-FG02-08ER54984, DE-AC02-09CH11466, DE-FG02-89ER53296, DE-FC02-11ER55104, DE-AC52-07NA27344 & DE-FG03-97ER54415.
Directory of Open Access Journals (Sweden)
Tânia Solange Bosi de Souza Magnago
2010-06-01
Full Text Available This study aimed to evaluate the association between psychological demands and control on work and the occurrence of musculoskeletal disorders among nursing workers. This cross-sectional study involved 491 nursing workers from a University hospital in Rio Grande do Sul. Brazilian versions of the Nordic Musculoskeletal Questionnaire and the Job Content Questionnaire were used. Among the participants, 96.3% reported some pain in any given part of the body last year, 73.1% in the last seven days and 65.8% reported difficulty in their daily routine. The chances of shoulder pain (OR=1.97; CI95%=1.07-3.64, in the thoracic spine (OR=1.83; CI95%=1.02-3.35 and in the ankles (OR=2.05; CI95%=1.05-4.02 were higher in the high work demand quadrant when compared to the low demand quadrant, after adjustments for potentially confusing factors Intervention measures in the organizational structure are needed, redefining demand levels and control at work.Este estudio tuvo evaluar la asociación entre demandas psicológicas y el control sobre el trabajo y la ocurrencia de disturbio músculo-esqueléticos en trabajadores de enfermería. Se trata de un estudio transversal, envolviendo 491 trabajadores de enfermería de un hospital universitario en Rio Grande del Sur, en Brasil. Se utilizaron las versiones brasileñas del Nordic Musculoskeletal Questionnaire e del Job Content Questionnaire. De los participantes, 96,3% refirieron dolor en alguna región del cuerpo en el último año, 73,1 % en los últimos siete días y 65,8% relataron dificultades en las actividades diarias. Las probabilidades de dolor fueron: en los hombros (OR=1,97; IC95%=1,07-3,64, en la columna torácica (OR=1,83; IC95%=1,02-3,35 y en los tobillos (OR=2,05; IC95%=1,05-4,02; fueron mayores en el cuadrante de trabajo con alta exigencia si comparado al de baja exigencia, después del ajuste por potenciales factores de confusión. Es necesario adoptar medidas de intervención en la estructura
Directory of Open Access Journals (Sweden)
Gina-Maria Lilienthal
2018-05-01
Full Text Available IgG antibodies (Abs mediate their effector functions through the interaction with Fcγ receptors (FcγRs and the complement factors. The main IgG-mediated complement activation pathway is induced through the binding of complement C1q to IgG Abs. This interaction is dependent on antigen-dependent hexamer formation of human IgG1 and IgG3 to increase the affinity for the six-headed C1q molecule. By contrast, human IgG4 fails to bind to C1q. Instead, it has been suggested that human IgG4 can block IgG1 and IgG3 hexamerization required for their binding to C1q and activating the complement. Here, we show that murine IgG1, which functionally resembles human IgG4 by not interacting with C1q, inhibits the binding of IgG2a, IgG2b, and IgG3 to C1q in vitro, and suppresses IgG2a-mediated complement activation in a hemolytic assay in an antigen-dependent and IgG subclass-specific manner. From this perspective, we discuss the potential of murine IgG1 and human IgG4 to block the complement activation as well as suppressive effects of sialylated IgG subclass Abs on FcγR-mediated immune cell activation. Accumulating evidence suggests that both mechanisms seem to be responsible for preventing uncontrolled IgG (autoAb-induced inflammation in mice and humans. Distinct IgG subclass distributions and functionally opposite IgG Fc glycosylation patterns might explain different outcomes of IgG-mediated immune responses and provide new therapeutic options through the induction, enrichment, or application of antigen-specific sialylated human IgG4 to prevent complement and FcγR activation as well.
Directory of Open Access Journals (Sweden)
Rosane Fossatti Gonçalves
2003-04-01
analgésico en el período pós-operatorio fue superior para el grupo S75-R25, comparado al grupo Bupivacaína (596 ± 436 minutos versus 463 ± 270 minutos, respectivamente; p = 0,04572. La incidencia de efectos adversos fue semejante entre los grupos. CONCLUSIONES: La mezcla enantiomérica de bupivacaína (S75-R25 presentó mayor tiempo analgésico y menor grado de bloqueo motor, comparada con la solución de bupivacaína racémicaBACKGROUND AND OBJECTIVES: A bupivacaine formulation containing 25% of R(+ and 75% of S(- isomer has been used because its anesthetic properties with less toxicity than the racemic bupivacaine. This study aimed at evaluating the racemic bupivacaine as compared to B25/75 in epidural anesthesia. METHODS: Participated in this study 44 patients who were distributed in two groups (n = 22, namely Bupivacaine and S75-R25. Patients were premedicated with intravenous midazolam. Epidural anesthesia was induced at L3-L4 or L2-L3 interspace with 16 to 24 ml of the anesthetic solution. Group Bupivacaine received 0.5% bupivacaine with vasoconstrictor. Group S75-R25 received the enantiomeric mixture of 0.5% bupivacaine with vasoconstrictor. The following parameters were evaluated: lower limb temperature before and after epidural block, blockade onset, type of sensation referred by the patient, possible sensory failures, metameric sensory level and motor block level. Time for first analgesic request in the PACU was also recorded. RESULTS: Forty-one patients completed the study. Groups were demographically similar. Perioperative midazolam dose, epidural anesthetic volume, blockade onset, sensory failures at pinprick, lower limb temperature in different moments, type of paresthesia sensation and anesthetic depth in dermatomes were similar between groups. Motor block was less intense in group S75-R25 (p = 0.0117 as compared to group Bupivacaine. Time to first postoperative analgesic dose was longer for group S75-R25 as compared to group Bupivacaine (596 ± 436
Directory of Open Access Journals (Sweden)
Giovani Nogueira
2003-04-01
Full Text Available OBJECTIVE: To evaluate the microbiological quality of treated and untreated water samples came from urban and rural communities and to examine the relationship between coliforms occurrence and average water temperature, and a comparison of the rainfall levels. METHODS: A sample of 3,073 untreated and treated (chlorinated water from taps (1,594, reservoir used to store treated water (1,033, spring water (96 and private well (350 collected for routine testing between 1996 and 1999 was analyzed by the multiple dilution tube methods used to detect the most probable number of total and fecal coliforms. These samples were obtained in the region of Maringá, state of Paraná, Brazil. RESULTS: The highest numbers water samples contaminated by TC (83% and FC (48% were found in the untreated water. TC and FC in samples taken from reservoirs used to store treated water was higher than that from taps midway along distribution lines. Among the treated water samples examined, coliform bacteria were found in 171 of the 1,033 sampling reservoirs. CONCLUSIONS: Insufficient treatment or regrowth is suggested by the observation that more than 17% of these treated potable water contained coliform. TC and FC positive samples appear to be similar and seasonally influenced in treated water. Two different periods must be considered for the occurrence of both TC and FC positive samples: (i a warm-weather period (September-March with high percentage of contaminated samples; and (ii cold-weather period (April-August were they are lower. Both TC and TF positive samples declined with the decreased of water temperature.OBJETIVO: Avaliar a qualidade microbiológica de amostras de água tratada e não-tratada proveniente de comunidades urbanas e rurais e examinar a relação entre ocorrência de coliformes e a média de temperatura da água, e uma comparação dos níveis de precipitação de chuva. MÉTODOS: No período de 1996 a 1999, foram analisadas 3.073 amostras de
AREVA T and D wins de-icing contract in Quebec
Energy Technology Data Exchange (ETDEWEB)
Anon.
2005-04-01
The ice storm that struck Quebec in the winter of 1998 left millions of people without electricity because the accumulation of ice caused the collapse of hundreds of kilometres of high-voltage transmission lines and thousands of transmission towers. In order to optimize the security of its power grid, Hydro-Quebec contracted AREVA T and D to construct and install HVDCice{sup TM}, a transmission line de-icing system based on high-voltage direct current (HVDC) technology. The system is intended to ensure maximum electrical efficiency and guarantee a secure electricity supply. The system will generate up to 7200A of direct current in the transmission lines. This will raise their temperature thereby allowing the ice to melt and fall off. The system will be implemented at the Levis substation, a major connection point for the transmission lines of the province. The system also acts as a Static Var Compensator (SVC) to improve the power quality of the transmission network. The SVC will stabilize the voltage on the 735 kV power grid, which can fluctuate depending on the amount of electricity being consumed. This is the world's first HVDC-based de-icing and power quality system. The contract awarded to AREVA's T and D division is estimated at 25 million Euros. 1 fig.
Adverse or acceptable: negotiating access to a post-apartheid health care contract.
Harris, Bronwyn; Eyles, John; Penn-Kekana, Loveday; Thomas, Liz; Goudge, Jane
2014-05-15
As in many fragile and post-conflict countries, South Africa's social contract has formally changed from authoritarianism to democracy, yet access to services, including health care, remains inequitable and contested. We examine access barriers to quality health services and draw on social contract theory to explore ways in which a post-apartheid health care contract is narrated, practiced and negotiated by patients and providers. We consider implications for conceptualizing and promoting more inclusive, equitable health services in a post-conflict setting. Using in-depth interviews with 45 patients and 67 providers, and field observations from twelve health facilities in one rural and two urban sub-districts, we explore access narratives of those seeking and delivering - negotiating - maternal health, tuberculosis and antiretroviral services in South Africa. Although South Africa's right to access to health care is constitutionally guaranteed, in practice, a post-apartheid health care contract is not automatically or unconditionally inclusive. Access barriers, including poverty, an under-resourced, hierarchical health system, the nature of illness and treatment, and negative attitudes and actions, create conditions for insecure or adverse incorporation into this contract, or even exclusion (sometimes temporary) from health care services. Such barriers are exacerbated by differences in the expectations that patients and providers have of each other and the contract, leading to differing, potentially conflicting, identities of inclusion and exclusion: defaulting versus suffering patients, uncaring versus overstretched providers. Conversely, caring, respectful communication, individual acts of kindness, and institutional flexibility and leadership may mitigate key access barriers and limit threats to the contract, fostering more positive forms of inclusion and facilitating easier access to health care. Building health in fragile and post-conflict societies requires
A novel activating chicken IgY FcR is related to leukocyte receptor complex (LRC)
Viertlboeck, B.C.; Schmitt, R.; Hanczaruk, M.A.; Crooijmans, R.P.M.A.; Groenen, M.A.M.; Gobel, T.W.
2009-01-01
FcRs have multifaceted roles in the immune system. Chicken FcRs were demonstrated on macrophages decades ago; however, only recently the chicken Ig-like receptor AB1, encoded in the leukocyte receptor complex, was molecularly identified as a high-affinity FcR. The present study was initiated to
Directory of Open Access Journals (Sweden)
Jesús Rubio Campos
2016-05-01
Full Text Available Esta investigación analiza los modelos y estrategias utilizadas durante el proceso de terminación de políticas públicas, tema que ha sido poco estudiado hasta el momento. Para cumplir con dicho objetivo, se decidió utilizar un estudio de caso instrumental, el de la extinción de Luz y Fuerza del Centro (LyFC en México, a fin de identificar variables y su comportamiento en los patrones de terminación que sirvan de marco de análisis para casos similares. Los marcos teóricos sobre la terminación de políticas y organizaciones públicas descritos en la literatura sobre el tema resultaron muy apropiados para explicar el proceso de extinción de LyFC. Destacan la figura del “terminador”, la compensación por encima de lo establecido bajo condiciones normales a los afectados por la política, la desacreditación de la oposición con el uso de los medios de comunicación, el elemento sorpresa, la no intromisión del legislativo, crear divisiones organizacionales, dar claridad respecto a los pasos siguientes y el contar con una clara estrategia para la implementación del plan de terminación. Las excepciones al modelo fueron el uso sorpresivo de la fuerza pública para tomar las instalaciones de LyFC, así como el congelamiento de las cuentas bancarias del Sindicato Mexicano de Electricistas (SME por la falta de “toma de nota” y la colaboración de un grupo adverso al SME, conformado por trabajadores de la Comisión Federal de Electricidad (CFE afiliados al Sindicato Único de Trabajadores Electricistas de la República Mexicana (SUTERM. Otro aprendizaje que nos deja el caso, es que en este tipo de intervenciones para la terminación de políticas y organizaciones públicas, debería prevalecer el cuidado de la ética en el ejercicio de la función pública, pues la terminación de políticas públicas no debe abordarse solamente desde un punto de vista meramente técnico, sino que debe entenderse que las decisiones de pol
Directory of Open Access Journals (Sweden)
Hirani Nikhil
2010-10-01
Full Text Available Abstract Background A significant genetic component has been described for idiopathic pulmonary fibrosis (IPF. The R131H (rs1801274 polymorphism of the IgG receptor FcγRIIa determines receptor affinity for IgG subclasses and is associated with several chronic inflammatory diseases. We investigated whether this polymorphism is associated with IPF susceptibility or progression. Methods In a case-control study, we compared the distribution of FcγRIIa R131H genotypes in 142 patients with IPF and in 218 controls using allele-specific PCR amplification. Results No differences in the frequency of FcγRIIa genotypes were evident between IPF patients and control subjects. However, significantly impaired pulmonary function at diagnosis was observed in HH compared to RR homozygotes, with evidence of more severe restriction (reduced forced vital capacity (FVC and lower diffusing capacity for carbon monoxide (DLCO. Similarly, increased frequency of the H131 allele was observed in patients with severe disease (DLCO 10% drop in FVC and/or > 15% fall in DLCO at 12 months after baseline (0.48 vs. 0.33; p = 0.023. Conclusions These findings support an association between the FcγRIIa R131H polymorphism and IPF severity and progression, supporting the involvement of immunological mechanisms in IPF pathogenesis.
AVALIAÇÃO DE PROPRIEDADES MECÂNICAS DA MADEIRA DE Eucalyptus urograndis SECOS
Directory of Open Access Journals (Sweden)
João Marcelo Soares Pereira
2017-04-01
Full Text Available O presente trabalho teve como objetivo avaliar as propriedades mecânicas de cisalhamento e compressão de corpos de prova de Eucalyptus urograndis secos. Os seis corpos de prova utilizados no estudo foram retirados de peças de calços com quatorze anos de idade, para cada ensaio mecânico: cisalhamento (fv0, compressão paralela às fibras (fc0 e normal às fibras (fc90. Os valores médios de resistência obtidos nos ensaios de cisalhamento, compressão paralela às fibras e normal às fibras foram 10,30 MPa, 59,17 MPa e 9,20 MPa, respectivamente. Todos os valores obtidos alcançaram valores médios acima da referência estabelecidos pela NBR 7190 (1997.
Yu, Chuanfei; Gao, Kai; Zhu, Lei; Wang, Wenbo; Wang, Lan; Zhang, Feng; Liu, Chunyu; Li, Meng; Wormald, Mark R; Rudd, Pauline M; Wang, Junzhi
2016-01-29
Two non-human glycan epitopes, galactose-α-1,3-galactose (α-gal) and Neu5Gc-α-2-6-galactose (Neu5Gc) have been shown to be antigenic when attached to Fab oligosaccharides of monoclonal antibodies (mAbs) , while α-gal attached to Fc glycans was not. However, the antigenicity of Neu5Gc on the Fc glycans remains unclear in the context that most mAbs carry only Fc glycans. After studying two clinical mAbs carrying significant amounts of Fc Neu5Gc, we show that their binding activity with anti-Neu5Gc antibody resided in a small subset of mAbs carrying two or more Fc Neu5Gc, while mAbs harboring only one Neu5Gc showed no reactivity. Since most Neu5Gc epitopes were distributed singly on the Fc of mAbs, our results suggest that the potential antigenicity of Fc Neu5Gc is low. Our study could be referenced in the process design and optimization of mAb production in murine myeloma cells and in the quality control of mAbs for industries and regulatory authorities.
Directory of Open Access Journals (Sweden)
Flávia dos S Alves
2010-03-01
Full Text Available As avaliações foram realizadas em quatro substratos compostos de mistura de fibra de coco triturada (FC e substrato comercial Plantmax HT® (SC, nas proporções de 0, 25, 50 e 75% de FC, em vasos com capacidade para 35 L, em delineamento de blocos ao acaso, com quatro repetições e três vasos por parcela, com uma planta por vaso. A adubação das plantas foi feita alternando-se, a cada três meses, 25 g de 4-14-8 com 10 g de uréia por vaso, a partir do plantio e durante os 24 meses do período experimental. O crescimento foi avaliado medindo-se a altura da haste inicial (da base do caule à inserção da última folha completamente expandida, número de folhas da haste inicial, número de perfilhos, número de folhas dos perfilhos, altura dos perfilhos e teores de nutrientes da última folha completamente expandida da haste inicial. A qualidade foi avaliada através de análise sensorial visual, baseado nos critérios "gostei"(muito ou pouco e "compraria"(sim ou não. Não houve diferença entre os tratamentos sobre as características de crescimento, exceto para o número de folhas da haste inicial. As plantas com melhor aceitação foram aquelas cultivadas na mistura com 50% FC e 50% SC. Nenhuma das plantas apresentou sintoma visual de deficiência de nutrientes, sendo os teores foliares encontrados em plantas sadias com padrão de qualidade para comercialização de: 17,80 - 18,29 g kg-1 de N; 0,66 - 0,81 g kg-1 de NO-3; 2,02 - 2,34 g kg-1 de P; 18,11 - 20,40 g kg-1 de K; 11,63 - 13,84 g kg-1 de Cl; 2,69 - 4,04 g kg-1 de Ca; 1,61 - 2,07 g kg-1 de S; 1,98 - 2,64 g kg-1 de Mg.It was evaluated the quality and nutrient content of lady palm in four substrates made up of a mixture of shredded coconut fiber (FC and commercial substrate Plantmax HT® (SC, in proportions of 0, 25, 50 and 75% of FC, in 35 liters containers, in a randomized block experiment with four replicates and three pots per plot, with one plant per pot. The plants were
Macrophage colony stimulating factor (M-CSF) induces Fc receptor expression on macrophages
International Nuclear Information System (INIS)
Magee, D.M.; Wing, E.J.; Waheed, A.; Shadduck, R.K.
1986-01-01
M-CSF is a glycoprotein that stimulates bone marrow progenitor cells to proliferate and differentiate into macrophages (M theta). In addition, M-CSF can modulate the function of mature M theta. In this study, the authors determined the effect of M-CSF on expression of receptors for IgG (Fc receptors). Murine resident peritoneal M theta monolayers were incubated with either M-CSF, recombinant gamma interferon (IFN), or left untreated for 48 hrs. Expression of Fc receptors was assessed by microscopy using an antibody coated sheet erythrocytes (EA) rosette assay. The results indicated that M-CSF treated M theta had significantly higher numbers of bound EA (7.1 erythrocytes/M theta), than IFN M theta (4.4), or untreated M theta (2.5) (p 51 Cr labelled EA assay, CSF M theta (16,411 cpm), IFN M theta (10,887), untreated M theta (6897) (p < 0.001). Additionally, the maximal response was noted between 10 and 500 units M-CSF. Purified anti-M-CSF IgG, when included in the cultures, ablated the enhancement of EA binding, whereas normal rabbit IgG did not. These findings indicate that M-CSF is a potent inducer of Fc receptor expression on M theta and supports other data concerning the role of M-CSF as a biological response modifier
Directory of Open Access Journals (Sweden)
Popov I. V.
2012-11-01
Full Text Available The issue of the obligations structure concerning the breach of a contract is considered in the article. According to the author’s opinion there simultaneously exists the initial obligation in conformity with the contract and obligation of losses compensation for the contract breach. Such an approach allows to recover damages before the moment when the initial obligation is discontinued by law or by a contract provision. The correlation between the initial obligation and the obligation to compensate losses because of the contract breach is being analyzed here.
Directory of Open Access Journals (Sweden)
Wilson Rogério Boscolo
2005-12-01
Full Text Available Este experimento foi realizado com o objetivo de avaliar o efeito da inclusão de farinha de resíduos da industrialização de tilápia (FT na alimentação de alevinos de piauçu (Leporinus macrocephalus. Cento e vinte e cinco alevinos com peso e comprimento iniciais de 0,19 ± 0,004 g e 2,37 ± 0,2 cm foram distribuídos em delineamento inteiramente casualizado, com cinco tratamentos e cinco repetições. As rações testadas continham 0; 5; 10 e 15% de FT e 0% de FT suplementada com metionina. O arraçoamento foi de 10% da biomassa quatro vezes ao dia (8, 11, 14 e 17 h. As médias dos parâmetros físico-químicos da água foram 7,89 ± 0,05, 89,93 ± 0,42, 7,15 ± 0,10 e 27,10 ± 0,95 para pH, condutividade elétrica (µS.cm-1, oxigênio dissolvido (mg.L-1 e temperatura (ºC, respectivamente. Ao final do período experimental, foram avaliadas as médias de sobrevivência (SO, peso final (PF, comprimento final (CF, ganho de peso (GP, fator de condição (FC e conversão alimentar aparente (CA. Foram observadas diferenças quanto ao CF, CA e FC entre tratamentos, obtendo-se melhores resultados naqueles com inclusão de FT e suplementação de metionina. O CF apresentou aumento linear com platô em 8,56% de FT e a CA apresentou redução linear com platô de 8,19% de inclusão de FT. Os maiores teores de proteína bruta (PB na carcaça foram obtidos nos tratamentos com mais de 5% de FT e 0% de FT suplementado com metionina. Pode-se incluir até 15% de FT em rações para alevinos de piauçu, melhorando seu desempenho e deposição de PB na carcaça, o que torna a FT uma fonte protéica alternativa.This trial was carried out to evaluate the effects of feeding Tilapia fillet by-products meal (TF for piauçu (Leporinus macrocephalus fingerlings. One hundred and twenty-five fingerlings averaging weight of 0.19 ± 0.004 g and length of 2.37 ± 0.28 cm were assigned to a completely randomized design with five treatments of five replicates. The diets
Wu, Shenping; Liu, Jun; Perz-Edwards, Robert J.; Tregear, Richard T.; Winkler, Hanspeter; Franzini-Armstrong, Clara; Sasaki, Hiroyuki; Goldman, Yale E.; Reedy, Michael K.; Taylor, Kenneth A.
2012-01-01
The application of rapidly applied length steps to actively contracting muscle is a classic method for synchronizing the response of myosin cross-bridges so that the average response of the ensemble can be measured. Alternatively, electron tomography (ET) is a technique that can report the structure of the individual members of the ensemble. We probed the structure of active myosin motors (cross-bridges) by applying 0.5% changes in length (either a stretch or a release) within 2 ms to isometrically contracting insect flight muscle (IFM) fibers followed after 5–6 ms by rapid freezing against a liquid helium cooled copper mirror. ET of freeze-substituted fibers, embedded and thin-sectioned, provides 3-D cross-bridge images, sorted by multivariate data analysis into ∼40 classes, distinct in average structure, population size and lattice distribution. Individual actin subunits are resolved facilitating quasi-atomic modeling of each class average to determine its binding strength (weak or strong) to actin. ∼98% of strong-binding acto-myosin attachments present after a length perturbation are confined to “target zones” of only two actin subunits located exactly midway between successive troponin complexes along each long-pitch helical repeat of actin. Significant changes in the types, distribution and structure of actin-myosin attachments occurred in a manner consistent with the mechanical transients. Most dramatic is near disappearance, after either length perturbation, of a class of weak-binding cross-bridges, attached within the target zone, that are highly likely to be precursors of strong-binding cross-bridges. These weak-binding cross-bridges were originally observed in isometrically contracting IFM. Their disappearance following a quick stretch or release can be explained by a recent kinetic model for muscle contraction, as behaviour consistent with their identification as precursors of strong-binding cross-bridges. The results provide a detailed model
Richardson, Simone I; Chung, Amy W; Natarajan, Harini; Mabvakure, Batsirai; Mkhize, Nonhlanhla N; Garrett, Nigel; Abdool Karim, Salim; Moore, Penny L; Ackerman, Margaret E; Alter, Galit; Morris, Lynn
2018-04-01
While the induction of broadly neutralizing antibodies (bNAbs) is a major goal of HIV vaccination strategies, there is mounting evidence to suggest that antibodies with Fc effector function also contribute to protection against HIV infection. Here we investigated Fc effector functionality of HIV-specific IgG plasma antibodies over 3 years of infection in 23 individuals, 13 of whom developed bNAbs. Antibody-dependent cellular phagocytosis (ADCP), complement deposition (ADCD), cellular cytotoxicity (ADCC) and cellular trogocytosis (ADCT) were detected in almost all individuals with levels of activity increasing over time. At 6 months post-infection, individuals with bNAbs had significantly higher levels of ADCD and ADCT that correlated with antibody binding to C1q and FcγRIIa respectively. In addition, antibodies from individuals with bNAbs showed more IgG subclass diversity to multiple HIV antigens which also correlated with Fc polyfunctionality. Germinal center activity represented by CXCL13 levels and expression of activation-induced cytidine deaminase (AID) was found to be associated with neutralization breadth, Fc polyfunctionality and IgG subclass diversity. Overall, multivariate analysis by random forest classification was able to group bNAb individuals with 85% sensitivity and 80% specificity based on the properties of their antibody Fc early in HIV infection. Thus, the Fc effector function profile predicted the development of neutralization breadth in this cohort, suggesting that intrinsic immune factors within the germinal center provide a mechanistic link between the Fc and Fab of HIV-specific antibodies.
Directory of Open Access Journals (Sweden)
Jacqueline Agudelo Chaparro
2014-12-01
Full Text Available Resumen. Se estudió el efecto que tienen dos tipos de almidónmodificado, maíz ceroso y papa, en las propiedades texturalesde un queso análogo con fibra prebiótica soluble. Se elaboraronquesos semiblandos, con humedad de 48%, reemplazando el10% de proteína por los almidones modificados, dando lugar atres tratamientos: Formulación control (FC, formulación maízceroso (FMC y formulación papa (FP. Se observó que la adiciónde los almidones afecta significativamente (P<0,05 la dureza, laadhesividad, la gomosidad, la elasticidad y la masticabilidad delproducto. / Abstract. The effect they have two types of modified starch (waxycorn and potato in the textural properties of an analogue cheesewas studied. Semi-soft cheeses were made with 48% moisture,replacing the 10% protein by modified starches, resulting in threetreatments: Control formulation (CF, waxy corn formulation(WCF and potato formulation (PF. The study allowed note thatthe addition of starches significantly affect (P<0.05 the hardness,adhesiveness, gumminess, elasticity and chewiness of the product
Directory of Open Access Journals (Sweden)
Ângela da Silva Borges
2006-12-01
Full Text Available Foi avaliado o efeito do tipo de músculo e da maturação sobre algumas propriedades funcionais e sensoriais da carne caprina. Utilizaram-se os músculos longissimus dorsi, semimembranosus e biceps femoris de cabras com aproximadamente 20 meses de idade. A carne, sem maturar e maturada por sete dias, foi avaliada para perdas por cocção (PPC e força de cisalhamento (FC, por métodos instrumentais, e para dureza sensorial (DS e suculência sensorial (SS, por provadores treinados. As PPC não sofreram efeito significativo (p > 0,05 do tipo de músculo e da maturação da carne. A carne sem maturar do músculo semimembranosus apresentou maior FC que aquelas dos músculos longissimus dorsi e biceps femoris. Em relação ao tipo de músculo, após a maturação, as carnes dos músculos semimembranosus e biceps femoris se apresentaram mais macias que a do longissimus dorsi. Quanto ao efeito da maturação, a FC da carne do músculo semimembranosus diminuiu significativamente. A FC apresentou correlação positiva com DS e correlação negativa com SS. Dureza e suculência avaliadas de forma sensorial apresentaram correlação negativa. A maturação por 7 dias diminuiu a dureza, mas não afetou as PPC da carne dos músculos semimembranosus e bíceps femoris.The effect of muscle type and aging for seven days on certain functional and sensory properties of goat meat was evaluated. The experiment used meat from longissimus dorsi, semimembranosus and biceps femoris muscles from female goats that were approximately 20 months. After 24 h of being slaughtered and seven days, the aging meat was instrumentally analyzed for cooking losses (CL and shear force (SF, as well as for sensory firmness (F and juiciness (J by a trained panel. CL was not affected (p > 0.05 by the type of muscle and aging of the meat. Before aging, meat from semimembranosus muscles showed higher SF than those from longissimus dorsi or bicep femoris muscles. After aging, meat from
Necesidades de metionina + cistina para pollos de engorda en iniciación
Directory of Open Access Journals (Sweden)
J. E. Morales
2004-01-01
Full Text Available Con el fin de conocer las necesidades de aminoácidos metionina + cistina (Met + Cis de pollos de engorda, durante la etapa de iniciación se realizaron tres experimentos, bajo un diseño completamente al azar con pollitos de engorda «Indian River» sin sexar, de 1 a 21 días de edad. Cada tratamiento fue por triplicado en grupos de 12 aves cada uno. En el primer experimento, una dieta a base de sorgo y pasta de soya con 22% de proteína y 3,000 Kcal de energía metabolizable (EM por kg fue suplementada con DL-Met en distintas cantidades para contar con cinco niveles de Met + Cis; 0.69%, 0.76%, 0.83%, 0.90% y 0.97%. Los resultados obtenidos para ganancia total de peso (506b, 570ab, 578ab, 617a y 585a g y eficiencia alimenticia (0.63b, 0.69a, 0.68ab, 0.72a y 0.70a fueron diferentes (P < 0.05 entre tratamientos. En el segundo experimento se empleó una dieta similar (23% proteína; 3,000 Kcal EM/kg y suplementada con DL-Met en distintas proporciones para evaluar cinco niveles de Met + Cis (0.68%, 0.75%, 0.82%, 0.90%, y 0.97%. Los datos fueron diferentes (P < 0.05 para consumo de alimento (670c, 693ab, 725ab, 732a y 721ab g, ganancia de peso (420c, 454bc, 492ab, 508a y 493a g y eficiencia alimenticia (0.62a, 0.65ab, 0.68ab, 0.69a y 0.68ab. En el tercer experimento, una dieta semejante (22 % proteína; 3,100 kcal EM/kg fue utilizada para evaluar cinco niveles de Met + Cis (0.66%, 0.74%, 0.82%, 0.89% y 0.97%. Los resultados obtenidos fueron diferentes (P < 0.05 en consumo de alimento (654a, 691ab, 746a, 713ab y 714ab g, ganancia de peso (445ab, 493ab, 551ab, 552a y 537a g y eficiencia alimenticia (0.68a, 0.71ab, 0.74ab, 0.77b y 0.75b. De acuerdo con estos resultados, dietas para pollos de engorda en iniciación (1 a 21 días de edad con 0.90 % de Met + Cis como aminoácidos totales, equivalentes a 0.81% de Met + Cis digeribles, causan un mayor aumento de peso corporal y mejor eficiencia alimenticia
Real forms of complex quantum anti-de-Sitter algebra Uq(Sp(4;C)) and their contraction schemes
International Nuclear Information System (INIS)
Lukierski, J.; Nowicki, A.; Ruegg, H.
1991-01-01
We describe four types of inner involutions of the Cartan-Weyl basis providing (for vertical strokeqvertical stroke=1 and q real) three types of real quantum Lie algebras: U q (O(3, 2)) (quantum D=4 anti-de-Sitter), U q (O(4, 1)) (quantum D=4 de-Sitter) and U q (O(5)). We give also two types of inner involutions of the Cartan-Chevalley basis of U q (Sp(4; C)) which cannot be extended to inner involutions of the Cartan-Weyl basis. We outline twelve contraction schemes for quantum D=4 anti-de-Sitter algebra. All these contractions provide four commuting translation generators, but only two (one for vertical strokeqvertical stroke=1, the second for q real) lead to the quantum Poincare algebra with an undeformed space rotation O(3) subalgebra. (orig.)
Cagini, Carlo; Dragoni, Annalisa; Orsolini, Giampaolo; Fiore, Tito; Beccasio, Alfredo; Spadea, Leopoldo; Moretti, Amedeo; Mencacci, Antonella
2017-06-01
To assess aqueous humor antimicrobial activity in vitro after topical 0.5% chloramphenicol application. This investigation included 63 eyes from 65 cataract surgery patients. The study group of 48 eyes received preoperatively four topical applications of 0.5% chloramphenicol. The control group of 15 eyes was given no topical applications. Aqueous humor samples were collected for in vitro antimicrobial analysis using Streptococcus pneumoniae, Haemophilus influenzae, Moraxella catarrhalis, and Pasteurella multocida organisms by means of disk diffusion test. No inhibition halo was observed around all aqueous humor samples from all chloramphenicol-treated patients, irrespective of the sample quantity added to the paper disks, with no significant difference from aqueous humor from untreated control patients. Aqueous humor displayed no bactericidal effect against any of the microorganisms evaluated after topical 0.5% chloramphenicol application.
7 CFR 97.105 - Denial of an application.
2010-01-01
... certificates or rights are cited, as a reason for denial, their nationality or country, numbers and dates, and... to enable the applicant to identify the cited certificates or rights. (d) If printed publications are... shall be denied. (b) In denying an application, the examiner shall cite the reasons the application was...
Directory of Open Access Journals (Sweden)
Maria Ângela G. O. Ribeiro
2012-12-01
Full Text Available OBJETIVO: Comparar a espirometria e a capnografia volumétrica (CapV para determinar se os valores amostrados pela capnografia acrescentam informações sobre doenças pulmonares precoces em pacientes com fibrose cística (FC. MÉTODOS: Este foi um estudo do tipo corte transversal envolvendo pacientes com FC: Grupo I (42 pacientes, 6-12 anos de idade e Grupo II (22 pacientes, 13-20 anos de idade. Os grupos controle correspondentes eram formados por 30 e 50 indivíduos saudáveis, respectivamente. A capacidade vital forçada (CVF, o volume expiratório forçado no primeiro segundo (VEF1 e a relação VEF1/CVF foram determinados pela espirometria. Através da CapV, medimos a saturação periférica de oxigênio (SpO2, a frequência respiratória (FR, o tempo inspiratório (TI, o tempo expiratório (TE e o slope da fase III normalizado pelo volume corrente (slope da fase III/Vc. RESULTADOS: Em comparação com os grupos controle, todos os pacientes com FC apresentaram valores de slope da fase III/Vc (p < 0,001 mais altos independentemente do estágio de doença pulmonar. O slope da fase III/Vc foi significantemente mais alto nos 24 pacientes que tiveram resultados normais de espirometria (p = 0,018. Os pacientes do Grupo II apresentaram valores de CVF, VEF1, VEF1/CVF (p < 0,05 e SpO2 (p < 0,001 mais baixos que os pacientes do Grupo I. Os pacientes do Grupo II, comparados com os do Grupo Controle II, apresentaram FR (p < 0,001 mais alta e valores de TI e TE (p < 0,001 mais baixos. CONCLUSÕES: Todos os pacientes com FC mostraram ter valores mais altos de slope da fase III/Vc quando comparados com os pacientes dos grupos controle. A CapV identificou a heterogeneidade da distribuição da ventilação nas vias aéreas periféricas dos pacientes com FC que apresentaram espirometria normal.
Effects of CTLA4-Fc on glomerular injury in humorally-mediated glomerulonephritis in BALB/c mice.
Kitching, A R; Huang, X R; Ruth, A-J; Tipping, P G; Holdsworth, S R
2002-06-01
The effect of cytotoxic T-lymphocyte-associated molecule 4-immunoglobulin fusion protein (CTLA4-Fc) on humorally-mediated glomerulonephritis was studied in accelerated anti-glomerular basement membrane (anti-GBM) glomerulonephritis induced in BALB/c mice. This strain of mice develops antibody and complement dependent glomerulonephritis under this protocol. Sensitized BALB/c mice developed high levels of circulating autologous antibody titres, intense glomerular deposition of mouse immunoglobulin and complement, significant proteinuria, renal impairment, significant glomerular necrosis and a minor component of crescent formation 10 days after challenge with a nephritogenic antigen (sheep anti-GBM globulin). Early treatment during the primary immune response, or continuous treatment throughout the disease with CTLA4-Fc, significantly suppressed mouse anti-sheep globulin antibody titres in serum, and immunoglobulin and complement deposition in glomeruli. The degree of glomerular necrosis was improved and proteinuria was reduced, particularly in the earlier stages of disease. Late treatment by CTLA4-Fc starting one day after challenge with sheep anti-mouse GBM did not affect antibody production and did not attenuate glomerulonephritis. The low level of crescent formation found in BALB/c mice developing glomerulonephritis was not prevented by the administration of CTLA4-Fc. These results demonstrate that CTLA4-Fc is of benefit in this model of glomerulonephritis by its capacity to attenuate antibody production, without affecting the minor degree of cell-mediated glomerular injury.
Oscillatory exchange bias and training effects in nanocrystalline Pr0.5Ca0.5MnO3
Directory of Open Access Journals (Sweden)
S. Narayana Jammalamadaka
2012-03-01
Full Text Available We report on exchange bias effects in 10 nm particles of Pr0.5Ca0.5MnO3 which appear as a result of competing interactions between the ferromagnetic (FM/anti-ferromagnetic (AFM phases. The fascinating new observation is the demonstration of the temperature dependence of oscillatory exchange bias (OEB and is tunable as a function of cooling field strength below the SG phase, may be attributable to the presence of charge/spin density wave (CDW/SDW in the AFM core of PCMO10. The pronounced training effect is noticed at 5 K from the variation of the EB field as a function of number of field cycles (n upon the field cooling (FC process. For n > 1, power-law behavior describes the experimental data well; however, the breakdown of spin configuration model is noticed at n ≥ 1.
41 CFR 101-25.110-2 - Tires obtained through Federal Supply Schedules or regional term contracts.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Tires obtained through Federal Supply Schedules or regional term contracts. 101-25.110-2 Section 101-25.110-2 Public Contracts... Federal Supply Schedules or regional term contracts. When tire manufacturers ship tires direct against...
Efeitos do treinamento aeróbio e resistido nas respostas cardiovasculares de idosos ativos
Directory of Open Access Journals (Sweden)
Rafaella Ribas Locks
Full Text Available OBJETIVO: Verificar os efeitos da associação do treinamento aeróbio e resistido nas respostas cardiovasculares de idosos. MÉTODOS: Onze sujeitos (ambos os gêneros, 70 ± 5 anos realizaram, duas vezes por semana, caminhada e exercícios resistidos para membros inferiores por 12 semanas. As avaliações foram realizadas antes, a cada quatro semanas de treinamento e após quatro semanas de destreinamento, por meio do teste de seis minutos de caminhada e aferição de pressão arterial (PA e frequência cardíaca (FC antes, imediatamente após e no quinto e décimo minutos subsequentes ao teste. Os resultados foram comparados pelo teste Wilcoxon (p ≤ 0,05. RESULTADOS: Quatro semanas de treinamento promoveram redução da PA sistólica e diastólica em repouso (120 ± 16 mmHg vs. 138 ± 20 mmHg, p = 0,01; 70 ± 9 mmHg vs. 84 ± 10 mmHg, p = 0,007, respectivamente e redução da PA diastólica imediatamente após o teste (78 ± 12 mmHg vs. 86 ± 9 mmHg, p = 0,01, que persistiu após dez minutos do esforço submáximo, quando comparadas ao pré-treino. Após 12 semanas, houve aumento da distância percorrida (555 ± 65m vs. 514 ± 100 m, p = 0,04 quando comparado ao pré-treino e recuperação dos valores de repouso da FC dez minutos após o esforço. CONCLUSÃO: A associação do treinamento aeróbio e resistido, em apenas quatro semanas, promoveu adaptações cardiovasculares eficientes na redução da PA sistólica e diastólica. Após 12 semanas, houve aumento da resistência à caminhada submáxima e recuperação dos valores em repouso da FC. Mesmo com o destreinamento, todos os resultados, exceto a FC, foram mantidos.
Directory of Open Access Journals (Sweden)
Hélio Bandeira Barros
2008-04-01
Full Text Available Este trabalho teve como objetivo avaliar o efeito do número de aplicações foliares de fungicidas no controle da ferrugem asiática, em cultivares de soja. O experimento foi conduzido na safra de 2003/04, em Viçosa, Estado de Minas Gerais. O delineamento experimental foi em blocos casualizados, com quatro repetições. Os tratamentos foram: testemunha sem aplicação, uma aplicação realizada no estádio R5, duas aplicações (R4 e R6 e três aplicações (R4, R5 e R6, utilizando-se a mistura de fungicidas (pyraclostrobin + epoxiconazole e carbendazin. Após a analise de variância e teste de médias, verificaram-se reduções significativas de 91,6 e 97,5% naseveridade de ferrugem asiática e de 100 e 86,8% na porcentagem de desfolha, no tratamento de três aplicações (R4, R5 e R6 da mistura dos fungicidas (pyraclostrobin + epoxiconazole, nas cultivares Vencedora e Conquista, respectivamente. Houve retardamento do ciclo, redução na porcentagem de abortamento de vagens e aumento no massa de 100 sementes nos tratamentos com aplicações de fungicidas em ambas as variedades. Altas produtividades foram obtidas nos tratamentos com três aplicações da mistura de fungicidas (pyraclostrobin + epoxiconazole, não sendo, entretanto, verificadas diferenças significativas entre os tratamentos com uma, duas ou três aplicações do fungicida carbendazin.This work aimed to evaluate the effect of the number of leafapplications of fungicides on the control of the Asian soybean rust. The experiment was carried out at the 2003/04 cropping season, in Viçosa, state of Minas Gerais, Brazil. The experimental design was a randomized block design, consisting of four replicates. The following treatments: control without application, one application at stage R5; two applications at R4 and R6; and three applications at R4, R5 and R6. The fungicides pyraclostrobin + epoxiconazole and carbendazin. After it analyzes her of variance and test of averages, it was
Directory of Open Access Journals (Sweden)
Fábio Neves de Carvalho da Silva Maia
2010-01-01
Full Text Available Este trabalho avalia os retornos e os riscos de estratégias de hedge para as dez principais regiões produtoras de soja do Brasil em relação aos contratos futuros de soja da Chicago Board of Trade (CBOT. Verificou-se que as bases apresentaram padrão bem definido: fortalecimento entre maio e novembro, seguido por enfraquecimento nos seis meses subsequentes. Os hedgers de compra possuem oportunidades de obter retornos brutos maiores, mas os riscos envolvidos nas estratégias de hedge de compra também são maiores. Conclui-se que os contratos de soja em grão da CBOT apresentam diferentes possibilidades de retornos brutos em função do tipo de hedge, do período hedgeado e do contrato utilizado. Logo, as informações disponibilizadas neste trabalho se apresentam como importante subsídio ao processo de tomada de decisão por parte dos agentes da cadeia agroindustrial da soja.This paper analyzes the return and risks of hedging strategies of the major ten soybean producing regions in Brazil concerning Chicago Board of Trade (CBOT future contracts. It was verified that the bases presented a well defined pattern characterized by strengthening from May to November and weakening in the remaining months. Long hedging had larger returns and larger risks comparing with short hedging. The conclusion of this study is that the CBOT soybean contracts present different returns depending on the type of hedging, on the period of hedging, and on the contract used. Therefore, the information presented in this paper is very important to support the decision making process in the Brazilian soybean agricultural system.
Vaughan, Andrew T.; Chan, Claude H. T.; Klein, Christian; Glennie, Martin J.; Beers, Stephen A.; Cragg, Mark S.
2015-01-01
Type I anti-CD20 mAb such as rituximab and ofatumumab engage with the inhibitory FcγR, FcγRIIb on the surface of B cells, resulting in immunoreceptor tyrosine-based inhibitory motif (ITIM) phosphorylation. Internalization of the CD20·mAb·FcγRIIb complex follows, the rate of which correlates with FcγRIIb expression. In contrast, although type II anti-CD20 mAb such as tositumomab and obinutuzumab also interact with and activate FcγRIIb, this interaction fails to augment the rate of CD20·mAb internalization, raising the question of whether ITIM phosphorylation plays any role in this process. We have assessed the molecular requirements for the internalization process and demonstrate that in contrast to internalization of IgG immune complexes, FcγRIIb-augmented internalization of rituximab-ligated CD20 occurs independently of the FcγRIIb ITIM, indicating that signaling downstream of FcγRIIb is not required. In transfected cells, activatory FcγRI, FcγRIIa, and FcγRIIIa augmented internalization of rituximab-ligated CD20 in a similar manner. However, FcγRIIa mediated a slower rate of internalization than cells expressing equivalent levels of the highly homologous FcγRIIb. The difference was maintained in cells expressing FcγRIIa and FcγRIIb lacking cytoplasmic domains and in which the transmembrane domains had been exchanged. This difference may be due to increased degradation of FcγRIIa, which traffics to lysosomes independently of rituximab. We conclude that the cytoplasmic domain of FcγR is not required for promoting internalization of rituximab-ligated CD20. Instead, we propose that FcγR provides a structural role in augmenting endocytosis that differs from that employed during the endocytosis of immune complexes. PMID:25568316
48 CFR 916.306 - Cost-plus-fixed-fee contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Cost-Reimbursement Contracts 916.306 Cost-plus-fixed-fee... application of the statutory price or fee limitations. [49 FR 11955, Mar. 28, 1984, as amended at 59 FR 9105...
Alemán, Omar Rafael; Mora, Nancy; Cortes-Vieyra, Ricarda; Uribe-Querol, Eileen; Rosales, Carlos
2016-01-01
Neutrophils (PMN) are the most abundant leukocytes in the blood. PMN migrate from the circulation to sites of infection, where they are responsible for antimicrobial functions. PMN use phagocytosis, degranulation, and formation of neutrophil extracellular traps (NETs) to kill microbes. NETs are fibers composed of chromatin and neutrophil-granule proteins. Several pathogens, including bacteria, fungi, and parasites, and also some pharmacological stimuli such as phorbol 12-myristate 13-acetate (PMA) are efficient inducers of NETs. Antigen-antibody complexes are also capable of inducing NET formation. However the particular Fcγ receptor involved in triggering this function is a matter of controversy. In order to provide some insight into what Fcγ receptor is responsible for NET formation, each of the two human Fcγ receptors was stimulated individually by specific monoclonal antibodies and NET formation was evaluated. FcγRIIa cross-linking did not promote NET formation. Cross-linking other receptors such as integrins also did not promote NET formation. In contrast FcγRIIIb cross-linking induced NET formation similarly to PMA stimulation. NET formation was dependent on NADPH-oxidase, PKC, and ERK activation. These data show that cross-linking FcγRIIIb is responsible for NET formation by the human neutrophil.
Directory of Open Access Journals (Sweden)
Omar Rafael Alemán
2016-01-01
Full Text Available Neutrophils (PMN are the most abundant leukocytes in the blood. PMN migrate from the circulation to sites of infection, where they are responsible for antimicrobial functions. PMN use phagocytosis, degranulation, and formation of neutrophil extracellular traps (NETs to kill microbes. NETs are fibers composed of chromatin and neutrophil-granule proteins. Several pathogens, including bacteria, fungi, and parasites, and also some pharmacological stimuli such as phorbol 12-myristate 13-acetate (PMA are efficient inducers of NETs. Antigen-antibody complexes are also capable of inducing NET formation. However the particular Fcγ receptor involved in triggering this function is a matter of controversy. In order to provide some insight into what Fcγ receptor is responsible for NET formation, each of the two human Fcγ receptors was stimulated individually by specific monoclonal antibodies and NET formation was evaluated. FcγRIIa cross-linking did not promote NET formation. Cross-linking other receptors such as integrins also did not promote NET formation. In contrast FcγRIIIb cross-linking induced NET formation similarly to PMA stimulation. NET formation was dependent on NADPH-oxidase, PKC, and ERK activation. These data show that cross-linking FcγRIIIb is responsible for NET formation by the human neutrophil.
Directory of Open Access Journals (Sweden)
Simone I Richardson
2018-04-01
Full Text Available While the induction of broadly neutralizing antibodies (bNAbs is a major goal of HIV vaccination strategies, there is mounting evidence to suggest that antibodies with Fc effector function also contribute to protection against HIV infection. Here we investigated Fc effector functionality of HIV-specific IgG plasma antibodies over 3 years of infection in 23 individuals, 13 of whom developed bNAbs. Antibody-dependent cellular phagocytosis (ADCP, complement deposition (ADCD, cellular cytotoxicity (ADCC and cellular trogocytosis (ADCT were detected in almost all individuals with levels of activity increasing over time. At 6 months post-infection, individuals with bNAbs had significantly higher levels of ADCD and ADCT that correlated with antibody binding to C1q and FcγRIIa respectively. In addition, antibodies from individuals with bNAbs showed more IgG subclass diversity to multiple HIV antigens which also correlated with Fc polyfunctionality. Germinal center activity represented by CXCL13 levels and expression of activation-induced cytidine deaminase (AID was found to be associated with neutralization breadth, Fc polyfunctionality and IgG subclass diversity. Overall, multivariate analysis by random forest classification was able to group bNAb individuals with 85% sensitivity and 80% specificity based on the properties of their antibody Fc early in HIV infection. Thus, the Fc effector function profile predicted the development of neutralization breadth in this cohort, suggesting that intrinsic immune factors within the germinal center provide a mechanistic link between the Fc and Fab of HIV-specific antibodies.
International Nuclear Information System (INIS)
Yao Xu; Ping Gu; Guang-Hui Zhang; Jun Zhao; Lu Wang; Xiang-Zhu Xiao; Fei Han
2017-01-01
To use copper ferrocyanide (CuFC) more efficiently in wastewater treatment, the method of isotope carrying used in "1"3"7Cs removal was investigated. A calculation model based on Freundlich isotherm was established to determine the optimum initial cesium concentration, at which the highest decontamination factor (DF) could be obtained at a certain CuFC dosage. An accurate DF prediction model was developed to describe synergistic effects of sodium and potassium. A novel index called volumetric distribution coefficient (K_v_d) was proposed to evaluate adsorption performance in terms of DF and concentration factor. (author)
Directory of Open Access Journals (Sweden)
Herymá Giovane de Oliveira Silva
2005-10-01
Full Text Available Foram avaliados o consumo e a produção de leite de cabras recebendo dietas contendo farelo de cacau (FC ou torta de dendê (TD em substituição ao milho e ao farelo de soja da ração concentrada. Foram utilizadas cinco cabras da raça Saanen, com produção média diária de 2,0 kg de leite e aos 60 dias de lactação, distribuídas em um quadrado latino 5 x 5. Os períodos experimentais tiveram duração de 14 dias, em que os dez primeiros foram destinados à adaptação e os quatro últimos, à coleta de amostras. As rações foram isoprotéicas, com 13,2% de proteína bruta. As dietas constituíram-se de 36% de volumoso (silagem de milho e 64% de concentrado na matéria seca. Os tratamentos consistiram de concentrado à base de milho e soja com 0, 15 e 30% de FC ou TD. Os consumos de matéria seca, matéria orgânica, proteína bruta, nutrientes digestíveis totais, carboidratos totais e carboidratos não-fibrosos reduziram com a inclusão de 30% de FC. Os consumos de fibra em detergente neutro e extrato etéreo (EE não foram alterados pelas dietas. O consumo de fibra em detergente ácido diferiu apenas entre os tratamentos com 30% de TD e 30% de FC, sendo 0,94 e 0,59% do peso vivo animal, respectivamente. O tratamento com 30% de FC proporcionou menor produção de leite (1,208 kg/dia, se assemelhando apenas ao tratamento com inclusão de 30% de TD quando a produção foi corrigida para 3,5% de gordura. O FC e a TD apresentam viabilidade de uso como alternativa na dieta de cabras em lactação em até 9,13 e 18,81% da matéria seca, respectivamente.The effects of replacing corn and soybean meal with cocoa meal (CF or palm kernel cake (PKC in the concentrate on milk intake and yield of goats were evaluated. Five Saanen goats, averaging 2 kg daily milk yield at 60 days of lactation, were assigned to a 5 x 5 Latin square experimental design. The experiment lasted 14 days, with 10 days for adaptation period and four days for sample
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.355 Section 97.355 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... System § 97.355 Banking. (a) CAIR NOX Ozone Season allowances may be banked for future use or transfer in...
CT-FC: more Comprehensive Traversal Focused Crawler
Directory of Open Access Journals (Sweden)
NFN Kuspriyanto
2012-03-01
Full Text Available In todays world, people depend more on the WWW information, including professionals who have to analyze the data according their domain to maintain and improve their business. A data analysis would require information that is comprehensive and relevant to their domain. Focused crawler as a topical based Web indexer agent is used to meet this applications information need. In order to increase the precision, focused crawler face the problem of low recall. The study on WWW hyperlink structure characteristics indicates that many Web documents are not strong connected but through co-citation & co-reference. Conventional focused crawler that uses forward crawling strategy could not visit the documents in these characteristics. This study proposes a more comprehensive traversal framework. As a proof, CT-FC (a focused crawler with the new traversal framework ran on DMOZ data that is representative to WWW characteristics. The results show that this strategy can increase the recall significantly.
Galilean contractions of W-algebras
Directory of Open Access Journals (Sweden)
Jørgen Rasmussen
2017-09-01
Full Text Available Infinite-dimensional Galilean conformal algebras can be constructed by contracting pairs of symmetry algebras in conformal field theory, such as W-algebras. Known examples include contractions of pairs of the Virasoro algebra, its N=1 superconformal extension, or the W3 algebra. Here, we introduce a contraction prescription of the corresponding operator-product algebras, or equivalently, a prescription for contracting tensor products of vertex algebras. With this, we work out the Galilean conformal algebras arising from contractions of N=2 and N=4 superconformal algebras as well as of the W-algebras W(2,4, W(2,6, W4, and W5. The latter results provide evidence for the existence of a whole new class of W-algebras which we call Galilean W-algebras. We also apply the contraction prescription to affine Lie algebras and find that the ensuing Galilean affine algebras admit a Sugawara construction. The corresponding central charge is level-independent and given by twice the dimension of the underlying finite-dimensional Lie algebra. Finally, applications of our results to the characterisation of structure constants in W-algebras are proposed.
Prolonged activity of a recombinant factor VIII-Fc fusion protein in hemophilia A mice and dogs
Dumont, Jennifer A.; Liu, Tongyao; Low, Susan C.; Zhang, Xin; Kamphaus, George; Sakorafas, Paul; Fraley, Cara; Drager, Douglas; Reidy, Thomas; McCue, Justin; Franck, Helen W. G.; Merricks, Elizabeth P.; Nichols, Timothy C.; Bitonti, Alan J.; Pierce, Glenn F.
2012-01-01
Despite proven benefits, prophylactic treatment for hemophilia A is hampered by the short half-life of factor VIII. A recombinant factor VIII-Fc fusion protein (rFVIIIFc) was constructed to determine the potential for reduced frequency of dosing. rFVIIIFc has an ∼ 2-fold longer half-life than rFVIII in hemophilia A (HemA) mice and dogs. The extension of rFVIIIFc half-life requires interaction of Fc with the neonatal Fc receptor (FcRn). In FcRn knockout mice, the extension of rFVIIIFc half-life is abrogated, and is restored in human FcRn transgenic mice. The Fc fusion has no impact on FVIII-specific activity. rFVIIIFc has comparable acute efficacy as rFVIII in treating tail clip injury in HemA mice, and fully corrects whole blood clotting time (WBCT) in HemA dogs immediately after dosing. Furthermore, consistent with prolonged half-life, rFVIIIFc shows 2-fold longer prophylactic efficacy in protecting HemA mice from tail vein transection bleeding induced 24-48 hours after dosing. In HemA dogs, rFVIIIFc also sustains partial correction of WBCT 1.5- to 2-fold longer than rFVIII. rFVIIIFc was well tolerated in both species. Thus, the rescue of FVIII by Fc fusion to provide prolonged protection presents a novel pathway for FVIII catabolism, and warrants further investigation. PMID:22246033
Contract types for nuclear power projects, non-turnkey type contracts in particular
International Nuclear Information System (INIS)
Nyte'n, T.
1975-01-01
A non-turnkey contract differs from a turnkey contract in no special formal way. The way the buyer chooses to exercise his project leadership must be concretized in the contract. The way and extent he wishes to exercise technical checking must be laid down in the form of clear rules. The way information has to flow from one contractor over buyer to others and vice versa has to be laid down in detail and the consequences of non conformance fixed in such a manner that optimum project performance is reached. (orig./FW) [de
2010-07-01
... Secretary, Department of Education PROTECTION OF HUMAN SUBJECTS Federal Policy for the Protection of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.103 Assuring compliance with this... responsibilities for protecting the rights and welfare of human subjects of research conducted at or sponsored by...
DEFF Research Database (Denmark)
Walters, Benjamin T; Jensen, Pernille Foged; Larraillet, Vincent
2016-01-01
Crystallographic evidence suggests that the pH-dependent affinity of IgG molecules for the neonatal Fc receptor (FcRn) receptor primarily arises from salt bridges involving IgG histidine residues, resulting in moderate affinity at mildly acidic conditions. However, this view does not explain the ......H-dependent affinity in IgG-FcRn interactions and exemplify the important and often ignored role of intrinsic conformational dynamics in a protein ligand, to dictate affinity for biologically important receptors.......Crystallographic evidence suggests that the pH-dependent affinity of IgG molecules for the neonatal Fc receptor (FcRn) receptor primarily arises from salt bridges involving IgG histidine residues, resulting in moderate affinity at mildly acidic conditions. However, this view does not explain...... the diversity in affinity found in IgG variants, such as the YTE mutant (M252Y,S254T,T256E), which increases affinity to FcRn by up to 10×. Here we compare hydrogen exchange measurements at pH 7.0 and pH 5.5 with and without FcRn bound with surface plasmon resonance estimates of dissociation constants and Fc...
Directory of Open Access Journals (Sweden)
Juan Hirzel
2010-03-01
Full Text Available Optimum application rates of poultry litter (PL spread out on the farmer´s field is a valuable source of available plant nutrients. The aim of this study was to compare the effect of two rates of PL and conventional fertilization (CF on N mineralization and P, K, Zn, and Cu availability in an Andisol from Southern Chile under controlled conditions. Aerobic incubation was carried out for a 16-wk period. N mineralization rates were higher (61.5% with the two PL treatments than with conventional fertilizer (23%. CF was associated with high N availability prior to the start of incubation and slight immobilization during the first week, perhaps due to a more rapid conversion of urea into NH4 which was then temporarily immobilized by the microbial biomass. At the start and end of the incubation period, Olsen-extractable P content was generally higher in CF. Due to the high fixation capacity of the soil studied, extractable P values were slightly increased suggesting that PL mineralization is only associated with a low risk of P contamination in volcanic soil. In PL, K, Zn, and Cu availability were higher than in CF. However, values obtained for Cu and Zn were average in relation to referential values used in agricultural soil. The results indicated that PL could be an alternative to conventional fertilizer under the conditions of the present study.En sistemas agrícolas que utilizan dosis correctas de insumos, la cama de broiler (CB puede constituir una fuente económica de nutrientes para las plantas. El objetivo de este trabajo fue estudiar el efecto de CB en dos dosis y fertilización convencional (FC sobre la mineralización de N y la disponibilidad de P, K, Zn y Cu en un suelo volcánico de la zona centro-sur de Chile en condiciones controladas. Una incubación aeróbica fue realizada durante un período de 16 semanas. Las tasas de mineralización de N fueron mayores con los tratamientos de CB utilizados (61,5% respecto al uso de FC (23%. La FC
(Na, K)NbO3-Based Ceramics for Self-Powered Energy Harvesting Applications.
Kim, Jinhwan; Koh, Jung-Hyuk
2015-03-01
Self-powered energy harvesting technologies have been intensively investigated by employ- ing Pb-free piezoelectric materials. One such Pb-free piezoelectric material, the ceramic 0.97(Na0.5K0.5)NbO3-0.03(Bi0.5Na0.5)TiO3, was prepared by employing the conventional mixed oxide method. 0.97(Na0.5K0.5)NbO3-0.03(Bi0.5Na0.5)TiO3 ceramics were prepared and the effect of sintering temperature on the microstructure, piezoelectric and ferroelectric properties were system- atically investigated for energy harvesting applications. The crystal structure of 0.97(Na0.5K0.5)NbO3- 0.03(Bi0.5Na0.5) TiO3 Pb-free piezoelectric ceramics, sintered at temperatures between 1080 °C and 1160 °C, was examined by X-ray diffraction analysis. The dielectric properties of 0.97(Na0.5K0.5)NbO3-0.03(Bi0.5Na0.5)TiO3 ceramics were measured from 1 kHz to 1 MHz for the various sintering temperatures. We expect that optimization of sintering parameters can improve the piezoelectric and ferroelectric properties of 0.97 (Na0.5K0.5)NbO3-0.03(Bi0.5Na0.5)TiO3 ceramics for energy harvesting.
Tradtrantip, Lukmanee; Felix, Christian M; Spirig, Rolf; Morelli, Adriana Baz; Verkman, A S
2018-05-01
Intravenous human immunoglobulin G (IVIG) may have therapeutic benefit in neuromyelitis optica spectrum disorders (herein called NMO), in part because of the anti-inflammatory properties of the IgG Fc region. Here, we evaluated recombinant Fc hexamers consisting of the IgM μ-tailpiece fused with the Fc region of human IgG1. In vitro, the Fc hexamers prevented cytotoxicity in aquaporin-4 (AQP4) expressing cells and in rat spinal cord slice cultures exposed to NMO anti-AQP4 autoantibody (AQP4-IgG) and complement, with >500-fold greater potency than IVIG or monomeric Fc fragments. Fc hexamers at low concentration also prevented antibody-dependent cellular cytotoxicity produced by AQP4-IgG and natural killer cells. Serum from rats administered a single intravenous dose of Fc hexamers at 50 mg/kg taken at 8 h did not produce complement-dependent cytotoxicity when added to AQP4-IgG-treated AQP4-expressing cell cultures. In an experimental rat model of NMO produced by intracerebral injection of AQP4-IgG, Fc hexamers at 50 mg/kg administered before and at 12 h after AQP4-IgG fully prevented astrocyte injury, complement activation, inflammation and demyelination. These results support the potential therapeutic utility of recombinant IgG1 Fc hexamers in AQP4-IgG seropositive NMO. Copyright © 2018 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Manoel Henrique Klein Júnior
2006-08-01
Full Text Available Objetivou-se avaliar a qualidade da carne por meio da determinação da composição centesimal e das características físicas da paleta e do lombo de 20 cordeiros mestiços Ideal, não-castrados (NC e castrados (C, submetidos a fotoperíodos curto, de 12 horas (FC, e longo, de 18 horas (FL. Os animais foram divididos ao acaso em esquema fatorial 2 x 2 (condição sexual x fotoperíodo, em quatro tratamentos (NC em FC; C em FC; NC em FL; e C em FL, com cinco repetições, sendo terminados em confinamento individual até que atingissem 37 kg de PV. A qualidade da carne foi determinada em amostras da paleta e do músculo Longissimus lumborum (LL. Os mais baixos teores de umidade e os mais altos de EE, tanto na paleta como no lombo, foram determinados na carne dos animais castrados. O fotoperíodo longo influenciou significativamente os teores de EE e proteína total do músculo LL. A capacidade de retenção de água foi afetada pelo FL, no qual foram encontrados percentuais mais baixos. Não houve efeito do fotoperíodo nem da condição sexual sobre a capacidade de absorção de água e a perda de peso por cozimento do músculo LL. Os valores de força de cisalhamento (FoCi na carne de cordeiros NC e dos submetidos ao FL foram superiores aos da carne dos animais castrados ou expostos ao FC.The objective of this study was to evaluate muscle composition and physical-chemical characteristics of 20 intact and castrated crossbred Ideal male lambs exposed to either a short photoperiod (SP of 12 h or to a long photoperiod (LP of 18 h. Animals were randomly assigned to four treatments (T in a 2 x 2 factorial arrangement with five repetitions as follows: intact lambs exposed to a SP; castrated lambs exposed to a SP; intact lambs exposed to a LP or castrated lambs exposed to a LP. Animals were maintained in individual pens until they reached 37 kg of body weight. Meat quality was determined in meat samples from the blade and from the Longissimus lumborum
48 CFR 48.201 - Clauses for supply or service contracts.
2010-10-01
... production, based on planning and programming or production documentation at the time the VECP is accepted... production, based on planning and programming or production documentation at the time the VECP is accepted... low-rate-initial-production or early production units, the contracting officer must modify the clause...
Army Contracting Command Workforce Model Analysis
2012-02-09
Empresas in Madrid. His Air Force contracting experience includes F-22 Fighter, C-17 Cargo Transport , and a contingency deployment as director of Joint...and the University of Maryland (University College). He has also conducted visiting seminars at American University in Cairo and Instituto de ...the long total process times that are sometimes involved in weapon system contracting, such an assessment may equate to a de facto future work
International Nuclear Information System (INIS)
Hirata, Y.; Suzuki, T.
1987-01-01
The properties of protein kinase activity associated with Fc receptor specific for IgG/sub 2a/(Fcγ/sub 2a/R) of a murine macrophage like cell line, P388D 1 , were investigated. IgG/sub 2a/-binding protein isolated from the detergent lysate of P388D 1 cells by affinity chromatography of IgG-Sepharose was found to contain four distinct proteins of M/sub r/ 50,000, 43,000, 37,000, and 17,000, which could be autophosphorylated upon incubation with [γ- 32 P]ATP. The autophosphorylation of Fcγ/sub 2a/ receptor complex ceased when exogenous phosphate acceptors (casein or histone) were added in the reaction mixture. Phosphorylation of casein catalyzed by Fcγ/sub 2a/ receptor complex was dependent on casein concentration, increased with time or temperature, was dependent on the concentration of ATP and Mg 2+ , and was maximum at pH near 8. Casein phosphorylation was significantly inhibited by a high concentration of Mn 2+ or KCl or by a small amount of heparin and was enhanced about 2-fold by protamine. Casein kinase activity associated with Fcγ/sub 2a/ receptor used ATP as substrate with an apparent K/sub m/ of 2 μM as well as GTP with an apparent K/sub m/ of 10 μM. Prior heating (60 0 C for 15 min) or treatment with protease (trypsin or Pronase) of Fcγ/sub 2a/ receptor complex almost totally abolished casein kinase activity. Thin-layer chromatography of a partial acid hydrolysate of the phosphorylated casein showed that the site of phosphorylation is at a seryl residue. These results suggest that Fcγ 2 /sub a/ receptor forms a molecule complex with protein kinase, whose characteristics resemble those of type II casein kinase but are different from those of cyclic nucleotide dependent protein kinase or from those of C protein kinase
Directory of Open Access Journals (Sweden)
Prado Eloi Elias do
2001-01-01
Full Text Available Este trabalho teve o objetivo de avaliar o desempenho, a estabilidade e a adaptabilidade de 21 cultivares de soja (Glycine max (L. Merrill, em cinco épocas de plantio no cerrado de Rondônia. O delineamento experimental foi blocos ao acaso, com três repetições. Os ensaios foram conduzidos no ano de 1996/97 pelo Centro de Pesquisa Agroflorestal de Rondônia, no Campo Experimental de Vilhena em Rondônia, RO. Os métodos utilizados apresentaram concordância entre os resultados alcançados, sendo que o comportamento das cultivares nas diferentes épocas de semeadura pode ser representado por um modelo linear. O coeficiente de resposta linear beta1i não apresentou diferença significativa (P<0,05 da unidade pelo teste t (beta1i = 1 em todas as cultivares testadas. As cultivares que apresentaram desvios de regressão sigma²(d i significativos (P<0,05 foram MT/BR50 e EMBRAPA 31, com R² = 58,56% e 74,43%, respectivamente. As demais cultivares não apresentaram desvios de regressão significativos.
48 CFR 970.3102-05-28 - Other business expenses.
2010-10-01
..., but not limited to, service charges, the cost of disbursing cash, necessary guards, cashiers, and... AGENCY SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05-28 Other business expenses. (i) Reasonable costs associated with the establishment and...
IAEA research contracts. Second annual report
International Nuclear Information System (INIS)
1962-01-01
patients with parasitic infections and in cases losing iron through sweat or desquamation; Research Contract No. 41, Non-destructive analysis of irradiated fuel elements using a flux integrating monitor; Research Contract No. 42, Mechanism of proteolysis of I-131-labelled fibrinogen; Research Contract No.45, An investigation of the radiosensitivity of spermatogonia of Drosophila melanogaster; Research Contract No. 47, Non-destructive analysis of irradiated fuel elements by gamma ray scanning; Research Contract No. 57, An investigation of the factors which influence the movement of radioactive strontium from soils to plants; Research Contract No. 59, Studies on the biological concentration of fission products in molluscs from water, with special reference to an index of radioactivity in water; Research Contract No. 72/US, Investigation of the decay scheme of Tl-210 (RaC); Research Contract No. 78, Calcium balance studies in metabolic bone disease; Research Contract No. 84, The development of radioactive drugs with special reference to tritiated drugs as radiotherapeutic agents; Research Contract No. 97, Physico-chemical requirements for the disposal of low-activity liquid radioactive wastes in soil'
IAEA research contracts. Second annual report
Energy Technology Data Exchange (ETDEWEB)
NONE
1962-07-01
patients with parasitic infections and in cases losing iron through sweat or desquamation; Research Contract No. 41, Non-destructive analysis of irradiated fuel elements using a flux integrating monitor; Research Contract No. 42, Mechanism of proteolysis of I-131-labelled fibrinogen; Research Contract No.45, An investigation of the radiosensitivity of spermatogonia of Drosophila melanogaster; Research Contract No. 47, Non-destructive analysis of irradiated fuel elements by gamma ray scanning; Research Contract No. 57, An investigation of the factors which influence the movement of radioactive strontium from soils to plants; Research Contract No. 59, Studies on the biological concentration of fission products in molluscs from water, with special reference to an index of radioactivity in water; Research Contract No. 72/US, Investigation of the decay scheme of Tl-210 (RaC); Research Contract No. 78, Calcium balance studies in metabolic bone disease; Research Contract No. 84, The development of radioactive drugs with special reference to tritiated drugs as radiotherapeutic agents; Research Contract No. 97, Physico-chemical requirements for the disposal of low-activity liquid radioactive wastes in soil'.
Vaughan, Andrew T; Chan, Claude H T; Klein, Christian; Glennie, Martin J; Beers, Stephen A; Cragg, Mark S
2015-02-27
Type I anti-CD20 mAb such as rituximab and ofatumumab engage with the inhibitory FcγR, FcγRIIb on the surface of B cells, resulting in immunoreceptor tyrosine-based inhibitory motif (ITIM) phosphorylation. Internalization of the CD20·mAb·FcγRIIb complex follows, the rate of which correlates with FcγRIIb expression. In contrast, although type II anti-CD20 mAb such as tositumomab and obinutuzumab also interact with and activate FcγRIIb, this interaction fails to augment the rate of CD20·mAb internalization, raising the question of whether ITIM phosphorylation plays any role in this process. We have assessed the molecular requirements for the internalization process and demonstrate that in contrast to internalization of IgG immune complexes, FcγRIIb-augmented internalization of rituximab-ligated CD20 occurs independently of the FcγRIIb ITIM, indicating that signaling downstream of FcγRIIb is not required. In transfected cells, activatory FcγRI, FcγRIIa, and FcγRIIIa augmented internalization of rituximab-ligated CD20 in a similar manner. However, FcγRIIa mediated a slower rate of internalization than cells expressing equivalent levels of the highly homologous FcγRIIb. The difference was maintained in cells expressing FcγRIIa and FcγRIIb lacking cytoplasmic domains and in which the transmembrane domains had been exchanged. This difference may be due to increased degradation of FcγRIIa, which traffics to lysosomes independently of rituximab. We conclude that the cytoplasmic domain of FcγR is not required for promoting internalization of rituximab-ligated CD20. Instead, we propose that FcγR provides a structural role in augmenting endocytosis that differs from that employed during the endocytosis of immune complexes. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Directory of Open Access Journals (Sweden)
Rubiela Flórez Manrique
2004-02-01
Full Text Available Objetivo: determinar la magnitud de la ingesta ad libitum de tres bebidas hidratantes de diferente osmolaridad y establecer sus efectos sobre el porcentaje de pérdida del peso corporal (PC, el aumento de la frecuencia cardíaca (FC y la reducción porcentual del volumen plasmático (VP en nueve deportistas con entrenamiento aeróbico, sometidos, bajo condiciones ambientales neutras, a una actividad física de alta intensidad 80% de la FC de reserva (FCR80 y larga duración 88 minutos. Metodología: el protocolo experimental se realizó en banda rodante, luego de nueve minutos de calentamiento, a una velocidad equivalente al 50% de la FCR y con una pendiente del 1%; siguieron 88 minutos de carrera, en tres intervalos, los dos iniciales de 29 minutos y el último de 30; la pendiente se mantuvo y la velocidad se incrementó al 80% de la FCR; finalmente, 90 minutos de recuperación, en tres intervalos de 30 minutos cada uno. No se hizo reposición hídrica durante el tratamiento deshidratado (DH; durante los tratamientos con hidratación se empleó un volumen similar de tres bebidas de diferente osmolaridad (H-I, H-II, H-III, el cual fue ingerido ad libitum. Resultados: durante la etapa de ejercicio la pérdida hídrica fue de 1.440 ml/h mientras que el volumen ingerido fue de 407 ml/h. Se observó, en cada uno de los tratamientos, una pérdida porcentual del PC (p<0,001; un incremento de la FC (p<0,05, y excepto con H-II y H-III una reducción porcentual del VP (p<0,05. No hubo diferencias intertratamientos en el porcentaje de la pérdida del PC, en el aumento de la FC ni en la reducción porcentual del VP. Conclusiones: la ingesta ad libitum fue menor que la cantidad recomendada internacionalmente por lo que, probablemente, no se pudieron establecer los efectos de la osmolaridad de las bebidas hidratantes sobre las variables estudiadas. Estos hallazgos nos obligan a revisar las prácticas de hidratación de nuestros deportistas ya que, al parecer
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlement. 9.7 Section 9.7... DISCIPLINARY, ACCESS DENIAL OR OTHER ADVERSE ACTIONS General Provisions § 9.7 Settlement. At any time before... accordance with § 9.20, the parties may file a stipulation for dismissal based on a settlement agreement...
2010-07-01
... aggregate fair market value upon termination or completion of the award, and if the supplies are not needed... 29 Labor 1 2010-07-01 2010-07-01 true Supplies. 97.33 Section 97.33 Labor Office of the Secretary... GOVERNMENTS Post-Award Requirements Changes, Property, and Subawards § 97.33 Supplies. (a) Title. Title to...
CAPACIDADE DE DESENVOLVER TRABALHO FÍSICO PROGRESSIVO EM CONDIÇÕES DE HIPOTERMIA BRANDA
Directory of Open Access Journals (Sweden)
Bárbara Regina Alvarez
2008-07-01
Full Text Available O propósito deste estudo determinar, em 12 voluntários do Grupo de Busca e Salvamento da Polícia Militar de Santa Catarina, a capacidade de desenvolver trabalho físico na bicicleta ergométrica (cargas escalonadas de 50, 100 e 150 watt em condições ambientais neutras (28 graus e subnormal (20 graus, com varredura ampliada da temperatura cutânea (7 sensores periféricos, da temperatura central (sensor piloto e da temperatura ambiental (sensor referência, a estimativa do VO2 máximo foi efetuada com auxílio do nomograma desenvolvido por Astrand (1960, empregando um cicloergômetro de frenagem magnética da FUNBEC. Já o % de mobilização do VO2 max foi predito pela equação proposta por Katch (1978, empregando o % da mobilidade da FC. Os dados foram tratados através da ferramenta eletrônica MICROSTAT, empregando o artifício estático "t" de student monocaudal. Foi observada uma variação significativa (P < 0.05 na temperatura de repouso entre as duas condições (%= -0.52. Considerando a estimativa do valor padrão (3 watt/Kg, a PWC170 apresentou uma diferença significativa entre médias (%=-14.29. A sobreposição dos pontos térmicos evidenciou um marcado estado de equilíbrio na FC nos minutos finais de cada desempenho biológico, corroborando a hipótese de ajustamento imediato dos sistemas cardiorrespiratório e metabólico para atender a demanda tecidual de oxigênio e nutrientes. Para estudos complementares, sugerimos a utilização da banda inferior da zona hipotérmica (flutuação de 20 a 5 graus Celsius para que o impacto da condição subnormal produza alterações mais importantes na temperatura central.
Directory of Open Access Journals (Sweden)
Edison Valvasori
1998-01-01
Full Text Available Silagens de sorgo granífero (tratamento SS e de cana-de-açúcar (tratamento SC, suplementadas com farelo de algodão para ajustar o nível protéico das dietas a 16%, foram fornecidas a bezerros da raça Holandesa variedade malhada de preto, para avaliação de seus desempenhos em termos de consumo de alimentos, ganhos de peso e conversões alimentares. Os animais apresentaram média de peso de 97,7 ± 1,0 kg ao início do período de adaptação, de 14 dias, ao qual seguiu-se período experimental de 70 dias. Os resultados mostraram que o tratamento com silagem de sorgo granífero foi superior ao com cana-de-açúcar (p;0,05.
Fc engineering of anti-Nectin-2 antibody improved thrombocytopenic adverse event in monkey.
Directory of Open Access Journals (Sweden)
Tsutomu Oshima
Full Text Available Nectin-2 is a transmembrane glycoprotein which is involved in the process of Ca2+-independent cell-cell adhesion. In our previous study, we have demonstrated that Nectin-2 is over-expressed in breast and ovarian cancer tissues by using gene expression analysis and immunohistochemistry. Furthermore, we discovered multiple anti-Nectin-2 fully human monoclonal antibodies which inhibited tumor growth in in vivo subcutaneous xenograft models with antibody-dependent cellular cytotoxicity (ADCC as the principal mechanism of action. In this report, we assessed the toxicity of Y-443, a fully human IgG1/kappa anti-Nectin-2 monoclonal antibody exhibiting strong in vitro ADCC and in vivo anti-tumor activity in cynomolgus monkeys (Macaca fascicularis (Cynos. Unexpectedly, upon administration, Y-443 induced strong thrombocytopenia through Nectin-2 expressed on Cyno platelets, presumably followed by phagocytosis in the mononuclear phagocytic system. To mitigate the adverse safety profile, we mutated the Fc region of Y-443 to reduce the Fc binding activity to Fcγ receptor I, which is the primary receptor for phagocytosis on macrophages. Moreover, we further engineered the Fc through defucosylation to maintain ADCC activity. The resultant Fc engineered antibody, termed Y-634, demonstrated diminished thrombocytopenia in Cyno toxicological studies and maintained anti-tumor activity in a mouse xenograft model. These findings suggest that Y-634 may have a therapeutic potential for the treatment of Nectin-2 positive cancers, and moreover, Fc engineering is a potential mitigation strategy to ameliorate safety liabilities in antibody induced thrombocytopenia while maintaining antibody potency.
More, Apurva S; Toprani, Vishal M; Okbazghi, Solomon Z; Kim, Jae H; Joshi, Sangeeta B; Middaugh, C Russell; Tolbert, Thomas J; Volkin, David B
2016-02-01
As part of a series of articles in this special issue describing 4 well-defined IgG1-Fc glycoforms as a model system for biosimilarity analysis (high mannose-Fc, Man5-Fc, GlcNAc-Fc and N297Q-Fc aglycosylated), the focus of this work is comparisons of their physical properties. A trend of decreasing apparent solubility (thermodynamic activity) by polyethylene glycol precipitation (pH 4.5, 6.0) and lower conformational stability by differential scanning calorimetry (pH 4.5) was observed with reducing size of the N297-linked oligosaccharide structures. Using multiple high-throughput biophysical techniques, the physical stability of the Fc glycoproteins was then measured in 2 formulations (NaCl and sucrose) across a wide range of temperatures (10°C-90°C) and pH (4.0-7.5) conditions. The data sets were used to construct 3-index empirical phase diagrams and radar charts to visualize the regions of protein structural stability. Each glycoform showed improved stability in the sucrose (vs. salt) formulation. The HM-Fc and Man5-Fc displayed the highest relative stability, followed by GlcNAc-Fc, with N297Q-Fc being the least stable. Thus, the overall physical stability profiles of the 4 IgG1-Fc glycoforms also show a correlation with oligosaccharide structure. These data sets are used to develop a mathematical model for biosimilarity analysis (as described in a companion article by Kim et al. in this issue). Copyright © 2016 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Competition in Contracting Act of 1984, as amended (CICA), applicable to lease acquisition? 102-73.100 Section 102-73.100... Contracting Act of 1984 § 102-73.100 Is the Competition in Contracting Act of 1984, as amended (CICA...
Directory of Open Access Journals (Sweden)
Huseyin Isik
2017-03-01
Full Text Available The goal of the present article to introduce the notion of generalized Meir-Keeler type ψ-contractions and prove some coupled common fixed point results for such type of contractions. The theorems proved herein extend, generalize and improve some results of the existing literature. Several examples and an application to integral equations are also given in order to illustrate the genuineness of our results.
Efecto del BiFeO3 en las propiedades del sistema ferroeléctrico libre de plomo K0.5Na0.5NbO3
Directory of Open Access Journals (Sweden)
Pinza, Billy N.
2014-10-01
Full Text Available In order to obtain a multiferroic material, powders and ceramic pieces, of the lead-free ferroelectric (1-x-x K0.5Na0.5NbO3 (Bi0.8La0.2FeO3 (KNN-BLFO (x = 0.005, 0.010, 0.015, 0.020, 0.025 system were prepared using the combustion reaction method. For all the studied perovskite phase, stoichiometries feature KNN was obtained. Using characterisation techniques, it was determined that the BLFO is incorporated in the crystal structure of KNN without modifying present a phase transition. Moreover, It was also proved that the addition of the BLFO to KNN, alters the particle size of the obtained powders and generates magnetic behavior in this ferroelectric.En la búsqueda de un material multiferroico, se prepararon polvos y piezas cerámicas del sistema ferroeléctrico libre de plomo (1-xK0.5Na0.5NbO3-x(Bi0.8La0.2FeO3 (KNN-BLFO (x=0.005, 0.010, 0.015, 0.020, 0.025, mediante el método de reacción por combustión. Para todas las estequiometrias estudiadas se obtuvo la fase perovskita característica del KNN. Con las diferentes caracterizaciones se determinó que el BLFO se incorpora en la estructura cristalina del KNN modificándola sin que se presente una transición de fase. Se comprobó además que la adición del BLFO al KNN, altera el tamaño de partícula de los polvos obtenidos y genera comportamiento magnético en este ferroeléctrico.
To tender, re-negotiate or partner: Strategies for contracting service companies
International Nuclear Information System (INIS)
Gouldie, T.A.
1994-01-01
The contracting of oilfield service companies by petroleum exploration and production operating companies is different than the contracting of civil engineering, construction or other project-oriented contractors. The relationship between operating companies and oilfield service companies has had a long and unique history which has evolved since the first oil wells were drilled over a century ago. The process of contracting service companies by operating companies for petroleum exploration and production work can be split into three distinct stages: (1) decide what it is that should be contracted out and what should be kept in house; (2) determine the method to use to select the contractor(s) to perform the work; and (3) agree to the contractual structure to best reflect the relationship the operating company and the service company with to initiate and maintain. As there are ongoing changes to the business structures and corporate thinking of both operating and service companies, there are also evolving changes to what are considered core businesses and the methods of selecting and contracting service companies by operating companies. Operating companies are recognizing the high costs of tendering for contractor services in terms of personnel time and administrative effort, and are relying more on negotiating and rolling-over existing contracts with their suitable, capable contractors. Partnering, in its many forms and levels, is increasingly being recognized as a useful method to get better work done at cheaper overall costs
International Nuclear Information System (INIS)
Loeffler, G.
1975-01-01
The contract is the last and final step of project planning and the first step of project implementation. The contract has to specify in detail and to the point, as concisely as possible, the complete scope of supplies and work, define all technical particulars and requirements, put forward the conditions of legal, regulatory, administrative and financial procedure, prepare for operating and maintenance instructions to be issued after commissioning. In short, the contract is expected to be a reliable instrument during the manufacturing and construction period as well as a guide-book to assist the owner afterwards in the operation and maintenance of the plant. (orig./FW) [de
Field induced ferromagnetic fraction enlargement in phase separated La_0.5Ca_0.5MnO_3
Ghivelder, Luis; Freitas, R. S.; Sacanel, J.; Parisi, F.; Levy, P.
2001-03-01
A systematic study of the magnetic and transport properties of a series of phase separated La_0.5Ca_0.5MnO3 compounds is reported. The investigated samples all have the same composition but different grain sizes, which modifies the volume fraction of the coexisting ferromagnetic (FM) and antiferromagnetic charge-ordered (AFM-CO) phases. Magnetoresistance and magnetization measurements were performed with two different experimental procedures: a standard field-cooled cooling (FC) mode, and a second method in which the field is turned on only while measuring each data point, and switched off while cooling the samples. Magnetization and magnetoresistance measurements display big differences when comparing the data obtained with the different procedures. The overall results are interpret in terms of a field induced FM fraction enlargement. In transport measurements this effect yield a percolative transition. Magnetization data shows evidence for the formation of AFM-CO regions within the FM phase. * e-mail: luisghiv@if.ufrj.br
Esophageal contractions in type 3 achalasia esophagus: simultaneous or peristaltic?
Kim, Tae Ho; Patel, Nirali; Ledgerwood-Lee, Melissa; Mittal, Ravinder K
2016-05-01
Absence of peristalsis and impaired relaxation of lower esophageal sphincter are the hallmarks of achalasia esophagus. Based on the pressurization patterns, achalasia has been subdivided into three subtypes. The goal of our study was to evaluate the esophageal contraction pattern and bolus clearance in type 3 achalasia esophagus. High-resolution manometry (HRM) recordings of all patients diagnosed with achalasia esophagus in our center between the years 2011 and 2013 were reviewed. Recordings of 36 patients with type 3 achalasia were analyzed for the characteristics of swallow-induced "simultaneous esophageal contraction." The HRM impedance recordings of 14 additional patients with type 3 achalasia were analyzed for bolus clearance from the impedance recording. Finally, the HRM impedance along with intraluminal ultrasound imaging was conducted in six patients to further characterize the simultaneous esophageal contractions. Among 187 achalasia patients, 30 were type 1, 121 type 2, and 36 type 3. A total of 434 swallows evaluated in type 3 achalasia patients revealed that 95% of the swallow-induced contractions met criteria for simultaneous esophageal contraction, based on the onset of contraction. Interestingly, the peak and termination of the majority of simultaneous esophageal contractions were sequential. The HRM impedance revealed that 94% of the "simultaneous contractions" were associated with complete bolus clearance. Ultrasound image analysis revealed that baseline muscle thickness of patients in type 3 achalasia is larger than normal but the pattern of axial shortening is similar to that in normal subjects. The majority of esophageal contractions in type 3 achalasia are not true simultaneous contractions because the peak and termination of contraction are sequential and they are associated with complete bolus clearance.
Intramuscular fatty acid metabolism in contracting and non-contracting human skeletal muscle
DEFF Research Database (Denmark)
Sacchetti, M; Saltin, B; Osada, T
2002-01-01
The present study was undertaken to investigate the fate of blood-borne non-esterified fatty acids (NEFA) entering contracting and non-contracting knee extensor muscles of healthy young individuals. [U-(13)C]-palmitate was infused into a forearm vein during 5 h of one-legged knee extensor exercis...... and degraded and that the metabolic fate of plasma NEFA entering the muscle is influenced by muscle contraction, so that a higher proportion is directed towards oxidation at the expense of storage in mTAG.......The present study was undertaken to investigate the fate of blood-borne non-esterified fatty acids (NEFA) entering contracting and non-contracting knee extensor muscles of healthy young individuals. [U-(13)C]-palmitate was infused into a forearm vein during 5 h of one-legged knee extensor exercise.......05) in the contracting muscle, whereas it was unchanged in the non-contracting muscle. The uptake of plasma NEFA, as well as the proportion directed towards oxidation, was higher in the exercising compared to the non-exercising leg, whereas the rate of palmitate incorporation into mTAG was fourfold lower (0.70 +/- 0...
Agribusiness and Contract Farming: the Case of Small-Scale Cucumber Producers in Mexico
Directory of Open Access Journals (Sweden)
Flavia Echánove Huacuja
2010-11-01
Full Text Available La agricultura por contrato constituye un mecanismo de abasto de las agroindustrias que se ha expandido rápidamente en los últimos años. Entre los factores que han motivado esta expansión se encuentran los cambios en el consumo alimentario, el crecimiento y fortalecimiento de las agroindustrias y otros distribuidores y la aplicación de políticas de ajuste estructural. El objetivo de este artículo es el análisis de las características del régimen contractual bajo el cual se produce cierta hortaliza de exportación ('el pepinillo', así como sus efectos en los productores, en los mercados de trabajo y tierras, y en el medio ambiente. Encontramos que el ingreso obtenido por los productores contratados no los ha exentado de la necesidad de diversificar sus actividades y que, en general, su situación como productores de bienes no-tradicionales es vulnerable y dependiente de los cambios en los mercados mundiales. English: Contract farming comprises an agribusiness supply mechanism that has undergone rapid expansion in recent years. Among the factors influencing that expansion are changes in consumption, the growth and strengthening of agribusinesses and other distributors, and the application of structural adjustment policies. The objective of this article is the analysis of the characteristics of the type of contract farming practiced with regard to the production of an export vegetable crop (pickling cucumbers, as well as its effects on producers, labor and land markets, and the environment. We find that the income obtained by contracted producers has not freed them from the necessity of diversifying their activities, and that in general, their situation as producers of non-traditional commodities is vulnerable and dependent upon the changing scenarios of global markets.
HARMONIZATION OF THE CONSUMER CONTRACT DISPOSITIONS WITH THE GENERAL CONTRACT RULES
Directory of Open Access Journals (Sweden)
Alexandru MATEESCU
2016-05-01
Full Text Available This work contains and mainly tackles the contract of consumption, its differences and similitudes to a general contract, manners of applying it, and the way in which the former can be better coordinated and correlated to the general contracting terms, established by the civil law. Along the years, the consumption contract has undergone several addenda and it has come to represent an instrument of both refference and regulation for the socio-economical relations between two parties who have a commercial agreement. The general law frame has had a great influence in the development of the consumption contract, as well as on its applicability conditions and its manner of deployment. Through the development of the judicial law concerning the contract of concumption, this type of agreement has influenced, through its human and social nature, both the general contract, and the specific frame it relates to. The relationship between the two types of contract is one of interdependence, which is determined by the need of judicial regulation in the Romanian and European economy. The ceaselees development of interhuman relations pushes society towards maintaining a continuous study of the advancement of specific legislation and judicial regulation. The main purpose of this work is analyzing the general judicial frame and the way in which the differences between the general contract and the consumption one may represent a benefic and mutual influence on protecting the citizens’ rights, which in the case of the consumption contract encompasses the protection of consumers’ rights. Also, it will analyze the aspects that determine the manner of application and the the differences that can be surmounted in order to achieve a better cohesion between these types of contracts.
Alezzandrini, Arturo; Hubatsch, Douglas; Alfaro, Rene
2014-09-01
Fixed-combination glaucoma medications are commonly used to achieve target intraocular pressure (IOP) reduction in patients uncontrolled with monotherapy; however, ocular discomfort associated with eye drops can decrease adherence. This study assessed the efficacy and tolerability of twice-daily fixed-combination brinzolamide 1%/timolol 0.5% (BRINZ/TIM-FC) in Latin American patients transitioned from fixed-combination brimonidine 0.2%/timolol 0.5% (BRIM/TIM-FC) because of insufficient IOP control or treatment intolerance. This 8-week, open-label, prospective study was conducted at six sites in Argentina, Chile, and Mexico. Enrolled patients were aged ≥18 years with open-angle glaucoma (including primary, exfoliative, or pigment-dispersion glaucoma) or ocular hypertension with IOP of 19-35 mmHg in ≥1 eye at baseline (on BRIM/TIM-FC). Patients self-administered BRINZ/TIM-FC to both eyes at 8 a.m. and 8 p.m. daily for 8 weeks. The primary and secondary efficacy endpoints were mean IOP change from baseline at week 8 and percentage of patients achieving target IOP (≤18 mmHg) at week 8, respectively. Exploratory endpoints included patient and investigator preference for treatment at week 8. Adverse events (AEs) were assessed as the safety endpoint. Fifty patients (mean ± SD age, 66.7 ± 11.5 years) received BRINZ/TIM-FC, and 49 were included in the intent-to-treat population. Mean ± SD IOP was significantly reduced from baseline after 8 weeks of treatment with BRINZ/TIM-FC (-3.6 ± 3.0 mmHg; P Wilcoxon signed-rank test; 17.1% reduction). Overall, 55.3% of patients achieved IOP ≤18 mmHg at week 8. Significantly more patients (89.4%) and investigators (95.7%) preferred BRINZ/TIM-FC to BRIM/TIM-FC (both P test). Of the 13 AEs observed, 8 were related to BRINZ/TIM-FC; the most common treatment-related AEs were eye irritation (n = 4) and abnormal sensation in the eye (n = 2). BRINZ/TIM-FC provides an effective and well-tolerated treatment
Avery, Lindsay B.; Wang, Mengmeng; Kavosi, Mania S.; Joyce, Alison; Kurz, Jeffrey C.; Fan, Yao-Yun; Dowty, Martin E.; Zhang, Minlei; Zhang, Yiqun; Cheng, Aili; Hua, Fei; Jones, Hannah M.; Neubert, Hendrik; Polzer, Robert J.; O'Hara, Denise M.
2016-01-01
ABSTRACT Therapeutic antibodies continue to develop as an emerging drug class, with a need for preclinical tools to better predict in vivo characteristics. Transgenic mice expressing human neonatal Fc receptor (hFcRn) have potential as a preclinical pharmacokinetic (PK) model to project human PK of monoclonal antibodies (mAbs). Using a panel of 27 mAbs with a broad PK range, we sought to characterize and establish utility of this preclinical animal model and provide guidance for its application in drug development of mAbs. This set of mAbs was administered to both hemizygous and homozygous hFcRn transgenic mice (Tg32) at a single intravenous dose, and PK parameters were derived. Higher hFcRn protein tissue expression was confirmed by liquid chromatography-high resolution tandem mass spectrometry in Tg32 homozygous versus hemizygous mice. Clearance (CL) was calculated using non-compartmental analysis and correlations were assessed to historical data in wild-type mouse, non-human primate (NHP), and human. Results show that mAb CL in hFcRn Tg32 homozygous mouse correlate with human (r2 = 0.83, r = 0.91, p PK studies, enhancement of the early selection of lead molecules, and ultimately a decrease in the time for a drug candidate to reach the clinic. PMID:27232760
Minerals Industry' 97. Survey report
International Nuclear Information System (INIS)
1997-01-01
The aim of this annual survey is to provide timely and accurate financial data such as production, price movements, profitability, distribution of assets by activity, employment and labour cost and taxation on the Australian minerals industry. It aims to facilitate more informed debate on the industry's role and importance in the economy. The report also includes information on the safety and health performance and overseas exploration expenditure of the minerals industry. This twenty-first survey relates to the year ended 30 June 1997. The proportion of activity covered in this year's survey is comparable with the 1996 survey. The mineral industry is defined as including exploration for, extraction and primary processing of minerals in Australia. The oil, gas, iron and steel industries are excluded. As for the uranium industry, increased mine capacity over the medium term saw a switch away from spot market purchases to long term contracts for uranium in 1996. This, coupled with announced releases from the US stockpile, saw downward pressure on spot market prices for uranium during 1996/97. The average spot market price for U 3 O 8 fell by an average of 6 percent during 1996/97 and was approximately 16 percent lower than three years ago. General uncertainty over the future profitability of coal industry is compounded by the likely softness of future coal prices
Location, Location: Jurisdiction & Conflicts in Transborder Contract Litigation
DEFF Research Database (Denmark)
Lookofsky, Joseph
In transborder contract litigation place-based factors are often decisive, both as regards jurisdiction to adjudicate as well as the rules which determine the applicable substantive law. Relevant locations include the place where the contract was made, where the parties reside, transact business...... or own property, the place of delivery, payment or other performance etc. Using concrete case-based examples, Professor Lookofsky explains how rules of jurisdiction and contract conflicts in Europe are tied to rigidly defined, single-place-based factors. In the United States, by contrast...
HAL/S-FC compiler system functional specification
1974-01-01
Compiler organization is discussed, including overall compiler structure, internal data transfer, compiler development, and code optimization. The user, system, and SDL interfaces are described, along with compiler system requirements. Run-time software support package and restrictions and dependencies are also considered of the HAL/S-FC system.
48 CFR 811.104-72 - Limited application of brand name or equal.
2010-10-01
... brand name or equal. 811.104-72 Section 811.104-72 Federal Acquisition Regulations System DEPARTMENT OF... Requirements Documents 811.104-72 Limited application of brand name or equal. If the contracting officer determines that the clause at 852.211-73, Brand name or equal, applies to only certain line items of a...
Transition de dépiégeage élastique de vortex supraconducteurs*
Directory of Open Access Journals (Sweden)
Fily Yaouen
2012-04-01
Full Text Available We present 2D numerical simulation results of superconductor vortex lattices driven over a random disorder. The vortex dynamics at the depinning threshold Fc is studied at zero temperature in the case of weak disorder. The dynamics is elastic and the depinning transition is analysed in the framework of a second order phase transition where the velocity response v to the driving force F behaves like v ~ (F − Fcβ. The analysis of the critical region of several large lattice sizes leads to the result that β = 0.27 ± 0.04. Nous présentons des résultats de simulations numériques à deux dimensions sur des réseaux de vortex dans les supraconducteurs que l’on met en mouvement dans un potentiel aléatoire. On étudie la dynamique des vortex au seuil de dépiégeage Fc dans le cas d’un faible désordre à température nulle. Les régimes élastiques au seuil de dépiégeage sont analysés dans le cadre des transitions de phase continues (transitions du second ordre. La réponse en vitesse v à la force d’entraînement F se comporte comme v ~ (F − Fcβ au voisinage immédiat du seuil de dépiégeage. Dans la région critique obtenue pour différentes grandes tailles du système simulé, nous mesurons l’exposant critique β = 0.27 ± 0.04.
DEFF Research Database (Denmark)
Andersen, Jan T; Justesen, Sune; Fleckenstein, Burkhard
2008-01-01
knowledge gives incentives for the design of IgG and albumin-based diagnostics and therapeutics. To study FcRn in vitro and to select and characterize FcRn binders, large quantities of soluble human FcRn are needed. In this report, we explored the impact of two free cysteine residues (C48 and C251......) of the FcRn heavy chain on the overall structure and function of soluble human FcRn and described an improved bacterial production strategy based on removal of these residues, yielding approximately 70 mg.L(-1) of fermentation of refolded soluble human FcRn. The structural and functional integrity...... was proved by CD, surface plasmon resonance and MALDI-TOF peptide mapping analyses. The strategy may generally be translated to the large-scale production of other major histocompatibility complex class I-related molecules with nonfunctional unpaired cysteine residues. Furthermore, the anti-FcRn response...
Directory of Open Access Journals (Sweden)
Alvaro J. Idrovo
2011-06-01
Full Text Available The objective of this ecological study was to ascertain the effects of physical environment on life expectancy at birth, using data from all 32 Mexican states. 50 environmental indicators with information about demography, housing, poverty, water, soils, biodiversity, forestry resources, and residues were included in exploratory factor analysis. Four factors were extracted: population vulnerability/susceptibility, and biodiversity (FC1, urbanization, industrialization, and environmental sustainability (FC2, ecological resilience (FC3, and free-plague environments (FC4. Using OLS regressions, FC2, FC3, and FC4 were found to be positively associated with life expectancy at birth, while FC1 was negatively associated. This study suggests that physical environment is an important macro-determinant of the health of the Mexican population, and highlights the usefulness of ecological concepts in epidemiological studies.Para indagar los efectos del ambiente físico sobre la esperanza de vida al nacer se diseñó un estudio ecológico con datos de los estados mexicanos. Cincuenta indicadores ambientales con información sobre demografía, vivienda, pobreza, agua, suelos, biodiversidad, recursos forestales y residuos fueron incluidos en un análisis factorial exploratorio. Cuatro factores fueron extraídos: vulnerabilidad/susceptibilidad poblacional y biodiversidad (FC1, urbanización, industrialización y sustentabilidad ambiental (FC2, resiliencia ecológica (FC3 y ambientes libres de plagas (FC4. En regresiones lineales se observó que FC2, FC3 y FC4 se asociaron positivamente con la esperanza de vida al nacer, mientras FC1 estuvo asociado negativamente. Este estudio sugiere que el ambiente físico es un macro-determinante importante de la salud poblacional mexicana, y muestra la utilidad de los conceptos ecológicos en estudios epidemiológicos.
33 CFR 211.109 - Contract of sale.
2010-07-01
... Navigation Project in Oklahoma, to Former Owners § 211.109 Contract of sale. Upon determination of the price... and deliver it to the applicant for acceptance. The contract of sale shall provide for the deposit of earnest money equal to twenty (20) percent of the price at which the land will be sold or the estimated...
Directory of Open Access Journals (Sweden)
Wagner Jou Hisaba
2003-07-01
Full Text Available OBJETIVO: avaliar a influência das alterações ultra-sonográficas pré-natais e das contrações uterinas de trabalho de parto na evolução motora neonatal em fetos portadores de espinha bífida aberta. MÉTODOS: foram analisados fetos portadores de espinha bífida aberta. Estes fetos foram acompanhados nos serviços de Medicina Fetal do Hospital São Paulo (Universidade Federal de São Paulo e do Hospital e Maternidade Santa Joana. Todos os partos foram realizados nestes serviços e a avaliação neonatal foi realizada pela equipe de Neurocirurgia comum a ambas as instituições Foi observada a influência das alterações ultra-sonográficas (macrocrania, microcrania, nível da falha de fechamento da coluna, pé torto e tipo de apresentação fetal na força muscular de membros inferiores no período neonatal. Foi analisada, também, a influência das contrações uterinas sobre a movimentação dos membros inferiores. Todos os partos foram realizados por cesárea. Foram utilizados os testes de c² e Fisher para comparações categóricas, com pPURPOSE: to determine whether prenatal sonographic findings and uterine contractions can predict neonatal motor outcome in fetuses with open spina bifida. METHODS: we evaluated retrospectively 53 fetuses with open spina bifida from 1993 to 2001. These fetuses were born and followed-up at the fetal medicine units of the Hospital São Paulo ("Universidade Federal de São Paulo" and the "Hospital Santa Joana". The influence of the alterations observed through ultrasound scan on neonatal muscular strength (macrocrania, microcrania, level of the spinal column opening, clubfoot and type of fetus position was evaluated. The influence of uterine contractions on neonatal motor outcome was also evaluated. All deliveries were made through cesarian section. c² and Fisher tests were used for categorical comparisons. A p<0.05 was considered significant. RESULTS: Fifty-three cases of isolated open spina bifida
Directory of Open Access Journals (Sweden)
Carlos Alexandre Fett
2004-02-01
Full Text Available PROPÓSITO: Este estudo compara os efeitos do treinamento de força (TF com ou sem a suplementação de lipídios ômega 3 (W-3 ou triglicérides de cadeia média (TCM, nos indicadores metabólicos em um teste de exaustão (TE. MÉTODOS: Grupo W-3 (GW-3: n = 7, 26,7 ± 6 anos de idade; 82,6 ± 10kg e grupo TCM (GTCM: n = 5, 18,8 ± 1,3 ano de idade; 74,6 ± 9,7kg com 11 meses mínimos em TF. Houve dois momentos de TE: depois de 28 dias somente com TF e coletas de sangue antes (M1a e após (M1d, e após mais 28 dias de TF mais a suplementação com W-3 ou TCM e repetindo o mesmo procedimento (M2a e M2d. RESULTADOS: O hematócrito (Ht, osmolalidade (Os, sódio (Na+ e pressão de dióxido de carbono (PCO2 não tiveram mudanças significativas em nenhum momento, grupo ou D M2 (P > 0,05. A pressão de oxigênio (PO2 aumentou significativamente após TE nos dois momentos e grupos (P PROPÓSITO: Este estudio compara los efectos de entrenamiento de fuerza (TF con o sin la suplementación de lípidos omega 3 (W-3 o triglicéridos de cadena media (TCM, los indicadores metabólicos en un test de agotamiento (TE. MÉTODOS: Grupo W-3 (GW-3: n = 7, 26,7 ± 6 años de idade; 82,6 ± 10 kg y grupo TCM (GTCM: n = 5, 18,8 ± 1,3 año de edad; 74,6 ± 9,7 kg con 11 meses mínimos en TF. Hubo 2 momentos de TE: después de 28 días solamente con TF y colectas de sangre antes (M1a y después (M1d, y después de mas de 28 días de TF más la suplementación con W-3 o TCM y repitiendo el mismo procedimiento (M2a e M2d. RESULTADOS: El hematocrito (Ht, osmolalidad (Os, sodio (Na+ y presión de dióxido de carbono (PCO2 no tuvieron cambios significativos en ningún momento, grupo de D M2 (P > 0,05. La presión de oxígeno (PO2 aumentó significativamente después TE los dos momentos y grupos (P OBJECTIVE: This study compares the effects of strength training (ST with or without supplementation of omega-3 lipids (W-3 or medium chain triglycerides (MCT in metabolic
48 CFR 822.305 - Contract clause.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 822.305... PROGRAMS APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS Contract Work Hours and Safety Standards Act 822.305 Contract clause. The contracting officer shall insert the clause at 852.222-70, Contract Work...
Directory of Open Access Journals (Sweden)
Severino Gonzaga Neto
2004-10-01
Full Text Available Objetivando avaliar o efeito da adição de feno de catingueira (FC sobre os balanços de nitrogênio e de energia em ovinos Morada Nova, foram utilizados 15 animais machos, castrados, durante 22 dias. O delineamento estatístico foi inteiramente casualizado, com três tratamentos e cinco repetições. Os tratamentos consistiram da inclusão de 0, 50 e 100% de FC à ração, na base da matéria seca. Os níveis de inclusão do FC às dietas não influenciaram nenhum dos parâmetros de balanço de nitrogênio. A perda média total de nitrogênio foi de 75,60% do ingerido e através da urina, de 61,31%. Não se observou efeito dos níveis de inclusão de FC sobre os parâmetros de balanço de energia, exceto para a energia bruta perdida pelas fezes, que diminuiu linearmente, à medida que se aumentou a participação do FC às dietas. A perda média total de energia foi de 58,40% da ingerida. Os resultados permitem indicar o feno de catingueira como fonte estratégica de alimento para os animais do semi-árido nordestino, sobretudo no período seco.The objective of this study was to determine the effect of "catingueira" hay (CH addition on nutritional balance by sheep. Fifteen "Morada Nova" males castrated sheep were used in a complete randomized design with three treatments (0, 50 and 100% CH addition and five replications. The inclusion of CH did not influence the apparent nitrogen balance. The energy retained as percentage of the ingested energy was not affected by treatment, however, the energy retained as percentage of the digested energy declined linearly in function of the CH inclusion level. Considering the nutrititonal demands of the experimental animals, it was concluded that the average intake observed at the intermediary levels of CH, showed that the "catingueira" have a reasonable nutritive value, being a strategic forage plant to the herd in the dry season in the semi-arid region.
Directory of Open Access Journals (Sweden)
Carlos E. Perles
2008-01-01
Full Text Available Embora não seja tecnologia recente, as células a combustível ou Fuel Cells (FC continuam recebendo grande atenção, pois são consideradas como "fontes de energia do futuro" devido a características como alto rendimento energético e baixa emissão de poluentes, permitindo a extensão o tempo de vida das reservas fósseis e contribuindo para a melhoria da qualidade de vida. Atualmente, as pesquisas estão direcionadas, principalmente, ao desenvolvimento de FC para aplicações em sistemas móveis e portáteis. De todas as tecnologias existentes, a mais promissora para essa finalidade é a célula a combustível de eletrólito polimérico, conhecida como PEMFC (Polymer Electrolyte Fuel Cell cuja pesquisa encontra-se focada, principalmente, no desenvolvimento de membranas poliméricas, com o objetivo de reduzir os custos de produção. Este trabalho será focado nos aspectos físico-químicos do desenvolvimento de membranas poliméricas. Serão discutidos aspectos estruturais do Nafion® relacionado-os as seguintes propriedades físico-químicas: fluxo eletrosmótico, permeabilidade gasosa, transporte de água através da membrana, estabilidade química e térmica. Toda a discussão será realizada para polímeros perfluorados, utilizando o Nafion® como modelo representante dessa classe de polímeros.Fuel Cells (FC continue to receive growing attention, in spite of not being a new technology, for they are considered as the "energy source of the future" owing to characteristics such as high energetic yield and low emission of pollutants. FC technology may lead to a reduction in the negative impact from energy sources on the enviroment, thus improving the quality of life and extending the lifetime of fossil combustible reserves. The mainstream of research in FC is now directed at mobile, portable systems, for which the most promising technology is the Polymer Electrolyte Fuel Cells, also known as PEMFC (Polymer Electrolyte Fuel Cell. Research
ADIABATIC HEATING OF CONTRACTING TURBULENT FLUIDS
International Nuclear Information System (INIS)
Robertson, Brant; Goldreich, Peter
2012-01-01
Turbulence influences the behavior of many astrophysical systems, frequently by providing non-thermal pressure support through random bulk motions. Although turbulence is commonly studied in systems with constant volume and mean density, turbulent astrophysical gases often expand or contract under the influence of pressure or gravity. Here, we examine the behavior of turbulence in contracting volumes using idealized models of compressed gases. Employing numerical simulations and an analytical model, we identify a simple mechanism by which the turbulent motions of contracting gases 'adiabatically heat', experiencing an increase in their random bulk velocities until the largest eddies in the gas circulate over a Hubble time of the contraction. Adiabatic heating provides a mechanism for sustaining turbulence in gases where no large-scale driving exists. We describe this mechanism in detail and discuss some potential applications to turbulence in astrophysical settings.
Application of Contraction Mappings to the Control of Nonlinear Systems. Ph.D. Thesis
Killingsworth, W. R., Jr.
1972-01-01
The theoretical and applied aspects of successive approximation techniques are considered for the determination of controls for nonlinear dynamical systems. Particular emphasis is placed upon the methods of contraction mappings and modified contraction mappings. It is shown that application of the Pontryagin principle to the optimal nonlinear regulator problem results in necessary conditions for optimality in the form of a two point boundary value problem (TPBVP). The TPBVP is represented by an operator equation and functional analytic results on the iterative solution of operator equations are applied. The general convergence theorems are translated and applied to those operators arising from the optimal regulation of nonlinear systems. It is shown that simply structured matrices and similarity transformations may be used to facilitate the calculation of the matrix Green functions and the evaluation of the convergence criteria. A controllability theory based on the integral representation of TPBVP's, the implicit function theorem, and contraction mappings is developed for nonlinear dynamical systems. Contraction mappings are theoretically and practically applied to a nonlinear control problem with bounded input control and the Lipschitz norm is used to prove convergence for the nondifferentiable operator. A dynamic model representing community drug usage is developed and the contraction mappings method is used to study the optimal regulation of the nonlinear system.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Contract. 252.13 Section 252.13 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS OPERATING... Contract. Upon approval by the Board of an application for ODS, the applicant and the United States may...
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.155 Section 97.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. (a) CAIR NOX allowances may be banked for future use or transfer in a compliance account or a...
Directory of Open Access Journals (Sweden)
Kang Shin
2011-01-01
Full Text Available Abstract In this paper, the existence, uniqueness and iterative approximations of fixed points for contractive mappings of integral type in complete metric spaces are established. As applications, the existence, uniqueness and iterative approximations of solutions for a class of functional equations arising in dynamic programming are discussed. The results presented in this paper extend and improve essentially the results of Branciari (A fixed point theorem for mappings satisfying a general contractive condition of integral type. Int. J. Math. Math. Sci. 29, 531-536, 2002, Kannan (Some results on fixed points. Bull. Calcutta Math. Soc. 60, 71-76, 1968 and several known results. Four concrete examples involving the contractive mappings of integral type with uncountably many points are constructed. 2010 Mathematics Subject Classfication: 54H25, 47H10, 49L20, 49L99, 90C39
EPDL97: the evaluated photon data library, '97 version. Summary documentation
International Nuclear Information System (INIS)
Pronyaev, V.G.; McLaughlin, P.
1998-01-01
The Evaluated Photon Data Library, 1997 version (EPDL97), is designed for use in photon transport calculations at Lawrence Livermore National Laboratory. This library includes photon interaction data for all elements with atomic number between Z = 1 (hydrogen) and 100 (fermium), including: photoionization, photoexcitation, coherent and incoherent scattering, and pair and triplet production cross sections. For use in applications data is provided for all elements over the energy range 1 eV to 100 GeV. EPDL97 completely supersedes the earlier 1989 version of EPDL(89) (see IAEA-NDS-158, Summary documentation to the EPDL) and it is highly recommended that users only use the most recent version of this library. The Evaluated Atomic Data Library (EADL), Evaluated Electron Data Library (EEDL) an Evaluated Excitation Data Library (EXDL) are included to allow consistent coupled photon-electron transport calculations. The data package is available from the IAEA Nuclear Data Section on CD-ROM (12 files, 74.2 MB). (author)
Directory of Open Access Journals (Sweden)
Leonardo Teixeira Domingues Duarte
2009-06-01
diferentes bloqueos de nervios periféricos. El objetivo de este estudio, fue comparar la eficacia de la analgesia postoperatoria, resultante de la administración en dosis única de la bupivacaína a 0,5% o de la ropivacaína a 0,5% en el bloqueo del plexo lumbar por la vía posterior en la artroplastia total de la cadera. MÉTODO: Treinta y siete pacientes fueron ubicados aleatoriamente en dos grupos según el anestésico local utilizado en el bloqueo: Grupo B - bupivacaína a 0,5% con epinefrina 1:200.000 o Grupo R - ropivacaína a 0,5%. Durante el período postoperatorio, los puntajes de dolor y el consumo de morfina en la analgesia controlada por el paciente, fueron comparados entre los grupos. El sangramiento durante la operación y la incidencia de efectos adversos y de complicaciones también fueron comparados. RESULTADOS: Pese a que los puntajes de dolor hayan sido menores en el Grupo R 8 horas, 12 horas y 24 horas después del bloqueo, esas diferencias no fueron clínicamente significativas. La regresión lineal múltiple no identificó el anestésico local como una variable independiente. No hubo diferencia en el consumo de morfina, en el sangramiento intraoperatorio y en la incidencia de complicaciones y efectos adversos entre los dos grupos. CONCLUSIONES: La bupivacaína a 0,5% y la ropivacaína a 0,5%, ofrecieron un alivio eficaz y prolongado del dolor postoperatorio después de la artroplastia total de la cadera, sin diferencia clínica, cuando dosis equivalentes fueron administradas en el bloqueo del plexo lumbar por la vía posteriorBACKGROUND AND OBJECTIVES: Posterior lumbar plexus block promotes effective postoperative analgesia in total knee arthroplasty. Ropivacaine and bupivacaine do not show differences in analgesic efficacy when used in different peripheral nerve blocks. The objective of this study was to compare the efficacy of postoperative analgesia resulting from the administration of a single dose of 0.5% bupivacaine or 0.5% ropivacaine in
Armour, Kathryn L; Smith, Cheryl S; Turner, Craig P; Kirton, Christopher M; Wilkes, Anthony M; Hadley, Andrew G; Ghevaert, Cedric; Williamson, Lorna M; Clark, Michael R
2014-01-01
G1Δnab is a mutant human IgG1 constant region with a lower ability to interact with FcγR than the natural IgG constant regions. Radiolabelled RBCs and platelets sensitised with specific G1Δnab Abs were cleared more slowly from human circulation than IgG1-sensitised counterparts. However, non-destructive splenic retention of G1Δnab-coated RBCs required investigation and plasma radioactivities now suggest this also occurred for platelets sensitised with an IgG1/G1Δnab mixture. In vitro assays with human cells showed that G1Δnab-sensitised RBCs did not cause FcγRI-mediated monocyte activation, FcγRIIIa-mediated antibody-dependent cell-mediated cytotoxicity (ADCC) or macrophage phagocytosis although they did adhere to macrophages. Thus, FcγRII was implicated in the adhesion despite the Δnab mutation reducing the already low-affinity binding to this receptor class. Additional contacts via P-selectin enhance the interaction of sensitised platelets with monocytes and this system provided evidence of FcγRII-dependent activation by G1Δnab. These results emphasise the physiological relevance of low-affinity interactions: It appears that FcγRII interactions of G1Δnab allowed splenic retention of G1Δnab-coated RBCs with inhibitory FcγRIIb binding preventing RBC destruction and that FcγRIIb engagement by G1Δnab on IgG1/G1Δnab-sensitised platelets overcame activation by IgG1. Considering therapeutic blocking Abs, G1Δnab offers lower FcγR binding and a greater bias towards inhibition than IgG2 and IgG4 constant regions. PMID:24285214
17 CFR 256.01-4 - Construction or service contracts, and centralized procurement accounting.
2010-04-01
... contracts, and centralized procurement accounting. 256.01-4 Section 256.01-4 Commodity and Securities... § 256.01-4 Construction or service contracts, and centralized procurement accounting. (a) Specific accounts have not been provided in which to classify expenditures made in the performance of construction...
Quebec-USA electricity export contracts
International Nuclear Information System (INIS)
Labbe, J.-F.
1993-06-01
Electricity exports from Hydro-Quebec to utilities in the USA significantly affects the economy and environment of Quebec. These exports may be arranged under interconnection agreements to sell excess capacity and production during off-peak periods or under firm sales contracts. Hydro-Quebec exports could also replace power plants that would otherwise be needed in the USA. The economic environment for Hydro-Quebec exports to the USA is reviewed along with the regulatory environment applicable to international trade (General Agreement on Tariffs and Trade, Canada-USA Free Trade Agreement, North American Free Trade Agreement), Quebec (Canadian federal and provincial law), and the USA (federal and state law). A jurisdictional analysis of power export contracts is then presented, citing examples of contracts already signed by Hydro-Quebec with utilities in New York and New England. Contract law and contract provisions are discussed, including common clauses and particular clauses. Suggestions are made for new clauses that would improve the electricity trade. 215 refs., 13 figs., 3 tabs
International Nuclear Information System (INIS)
Dominguez, C Ruiz; Kachenoura, N; Cesare, A De; Delouche, A; Lim, P; Gerard, O; Herment, A; Diebold, B; Frouin, F
2005-01-01
The computerized study of the regional contraction of the left ventricle has undergone numerous developments, particularly in relation to echocardiography. A new method, parametric analysis of main motion (PAMM), is proposed in order to synthesize the information contained in a cine loop of images in parametric images. PAMM determines, for the intensity variation time curves (IVTC) observed in each pixel, two amplitude coefficients characterizing the continuous component and the alternating component; the variable component is generated from a mother curve by introducing a time shift coefficient and a scale coefficient. Two approaches, a PAMM data driven and a PAMM model driven (simpler and faster), are proposed. On the basis of the four coefficients, an amplitude image and an image of mean contraction time are synthesized and interpreted by a cardiologist. In all cases, both PAMM methods allow better IVTC adjustment than the other methods of parametric imaging used in echocardiography. A preliminary database comprising 70 segments is scored and compared with the visual analysis, taken from a consensus of two expert interpreters. The levels of absolute and relative concordance are 79% and 97%. PAMM model driven is a promising method for the rapid detection of abnormalities in left ventricle contraction
Energy Technology Data Exchange (ETDEWEB)
Kenniston, Jon A.; Taylor, Brandy M.; Conley, Gregory P.; Cosic, Janja; Kopacz, Kris J.; Lindberg, Allison P.; Comeau, Stephen R.; Atkins, Kateri; Bullen, Jameson; TenHoor, Christopher; Adelman, Burt A.; Sexton, Daniel J.; Edwards, Thomas E.; Nixon, Andrew E. (Beryllium); (Dyax)
2017-09-06
The neonatal Fc receptor FcRn plays a critical role in the trafficking of IgGs across tissue barriers and in retaining high circulating concentrations of both IgG and albumin. Although generally beneficial from an immunological perspective in maintaining IgG populations, FcRn can contribute to the pathogenesis of autoimmune disorders when an abnormal immune response targets normal biological components. We previously described a monoclonal antibody (DX-2507) that binds to FcRn with high affinity at both neutral and acidic pH, prevents the simultaneous binding of IgG, and reduces circulating IgG levels in preclinical animal models. Here, we report a 2.5 Å resolution X-ray crystal structure of an FcRn–DX-2507 Fab complex, revealing a nearly complete overlap of the IgG–Fc binding site in FcRn by complementarity-determining regions in DX-2507. This overlap explains how DX-2507 blocks IgG binding to FcRn and thereby shortens IgG half-life by preventing IgGs from recycling back into circulation. Moreover, the complex structure explains how the DX-2507 interaction is pH-insensitive unlike normal Fc interactions and how serum albumin levels are unaffected by DX-2507 binding. These structural studies could inform antibody-based therapeutic approaches for limiting the effects of IgG-mediated autoimmune disease.
Regulation of Monoclonal Antibody Immunotherapy by FcγRIIB.
Stopforth, Richard J; Cleary, Kirstie L S; Cragg, Mark S
2016-05-01
Monoclonal antibodies (mAb) are revolutionising the treatment of many different diseases. Given their differing mode of action compared to most conventional chemotherapeutics and small molecule inhibitors, they possess the potential to be independent of common modes of treatment resistance and can typically be combined readily with existing treatments without dose-limiting toxicity. However, treatments with mAb rarely result in cure and so a full understanding of how these reagents work and can be optimised is key for their subsequent improvement. Here we review how an understanding of the biology of the inhibitory Fc receptor, FcγRIIB (CD32B), is leading to the development of improved mAb treatments.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Banking. 97.255 Section 97.255 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) FEDERAL NOX... Banking. (a) CAIR SO2 allowances may be banked for future use or transfer in a compliance account or a...
Alexander, E L; Titus, J A; Segal, D M
1978-01-01
When mononuclear leukocytes are isolated directly from whole human blood using Ficoll-Hypaque or Plasmagel, cytophilic immunoglobulin is detected on cell surfaces. Upon incubation at 37 degrees C, this cell-associated immunoglobulin is shed slowly into the medium. However, when cells are prewashed in phosphate-buffered saline prior to isolation, they appear to be free of cytophilic immunoglobulin. Compared to prewashed cells, populations retaining cytophilic immunoglobulin on their surfaces demonstrate a decreased binding of soluble immune complexes and radiolabelled trimeric rabbit IgG. The data suggest that Ficoll-Hypaque and Plasmagel cause serum IgG to bind with abnormally high affinity to human mononuclear leukocytes, probably via Fc receptors. This artifact of preparation can lead to erroneous estimates of the numbers of cells bearing Fc receptors or intrinsic membrane immunoglobulin within a given population of cells and to an inaccurate assessment of the average number of Fc receptors per cell.
Directory of Open Access Journals (Sweden)
Lourdes Arruzazabala Valmaña
2009-12-01
Full Text Available D-004, un extracto lipídico de las frutas de Roystonea regia, inhibe la contracción provocada por la norepinefrina en el vas deferens de las ratas. No obstante, el efecto de D-004 sobre las respuestas contráctiles adrenérgicas a1 en las preparaciones aisladas de la próstata no ha sido estudiado. Por lo tanto, este estudio investigó los efectos de D-004 sobre las contracciones provocadas por la fenilefrina en las extracciones aisladas de la próstata de la rata. D-004 (125-500 mg/mL fue adicionado a las preparaciones a partir de la próstata en la que las contracciones fueron provocadas por la fenilefrina (10-6-10-4 M o por CIK (50 mM. D-004 (250-500 mg/mL en forma significativa y la dosis en forma dependiente inhibieron las contracciones provocadas por la fenilefrina mediante un mecanismo no competetitivo, reduciendo así (12-60 % la contracción máxima por la fenilefrina con respecto a las preparaciones controles. D-004 a 500 µg/mL inhibieron de la misma forma tanto CIK como las respuestas contráctiles-fenilefrina. Tamsulosin (0,01 mg/mL eliminó la acción de la fenilefrina (100 % de inhibición, pero no afectó las contracciones provocadas por CIK.D-004, a lipid extract of Roystonea regia fruits, inhibits norepinephrine-elicited contraction in rat vas deferens. Nevertheless, the effect of D-004 on a1-adrenergic contractile responses in isolated prostate preparations had not been studied. Therefore, this study investigated the effects of D-004 on phenylephrine-induced contractions in isolated rat prostate strips. D-004 (125-500 mg/mL was added to prostate preparations in which contractions were induced with phenylephrine (10-6-10-4 M or with ClK (50 mM. D-004 (250-500 mg/mL significantly (p < 0,01.and dose-dependently inhibited the phenylephrine-induced contractions through a non-competitive mechanism, since it reduced (12-60 % the maximal contraction to phenyle phrine with respect to control preparations. D-004 at 500 mg/mL inhibited
Montenegro Viera, Efren; Sandoya Tinoco, Eduardo; Ponguillo Intriago, Ronald Alberto
2009-01-01
El trabajo presentado en este artículo fue desarrollado para demostrar la aplicación de los recursos tecnológicos de dispositivos como el Microcontrolador PIC 18F97J60 en la Domótica. Existen diferentes maneras de implementar la domótica, motivo por el cual, hemos decidido optar por una nueva tecnología como lo es la de los PICs con sistemas embebidos para el desarrollo de una aplicación que reduzca en costo y tamaño lo que actualmente podemos encontrar en el mercado. Con la ayuda de di...
Directory of Open Access Journals (Sweden)
José Delfino
2001-12-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: A cardiotoxicidade da bupivacaína racêmica (50:50 ainda é a grande variável relacionada à segurança de indicação nos bloqueios regionais que exigem massas e volumes elevados. Recentes experimentações em animais sugerem que a modificação da relação enantiomérica da bupivacaína racêmica poderia contribuir para sua eficácia terapêutica e diminuição de sua toxicidade potencial. O objetivo do presente estudo foi comparar a eficiência da mistura enantiomérica de bupivacaína (S75-R25 com a levógira pura S(-100 na anestesia peridural lombar para cirurgias de varizes dos membros inferiores. MÉTODO: O estudo envolveu 30 pacientes do sexo feminino com idades entre 15 e 65 anos, estado físico ASA I ou II, programados para cirurgia eletiva de varizes. Em teste aleatório e duplamente encoberto, os pacientes foram divididos em dois grupos de 15: Grupo S75-R25 - 20 ml (100 mg de mistura enantiomérica de bupivacaína a 0,5% (S75-R25 - e Grupo Levógiro - 20 ml (100 mg de bupivacaína levógira S(-100% a 0,5% sem adjuvante. Foram comparadas as características dos bloqueios sensitivo e motor bem como a incidência de efeitos colaterais. RESULTADOS: Foram detectadas diferenças intergrupais relacionadas às características demográficas e um maior tempo cirúrgico no grupo S75-R25. A dispersão mais rápida e a menor potência analgésica da mistura isomérica exibiram significância estatística. Não houve diferença significativa relacionada à ocorrência de efeitos colaterais. O grupo levógiro apresentou menor relaxamento muscular. CONCLUSÕES: A redução da incidência de efeitos colaterais, a receptividade do método pelos pacientes, a ausência de sintomatologia neurológica transitória pós-operatória apontam para a aplicação segura de ambas as soluções em anestesia peridural lombar para cirurgia de varizes dos membros inferiores. A casuística, entretanto, não é ainda suficiente para
Informal Progress Report Contract Number: DE-FG03-02NA00074/A000
International Nuclear Information System (INIS)
Brune, Carl R.; Grimes, Steven M.
2003-01-01
OAK B127 We report on work performed under contract DE-FG03-03NA00074 since January 1,2003. The research is in the area of low energy nuclear reactions and nuclear structure. The progress on research on level densities and improvement to R-Matrix calculations are presented. The preparations to begin high resolution experiments on p-shell nuclei are reviewed
El cooperativismo de consumo: orígenes y actualidad
Directory of Open Access Journals (Sweden)
Javier Divar Garteiz-Aurrecoa
2011-12-01
Full Text Available Los estatutos de la Cooperativa de Consumo de los Probos Pioneros de Rochdale, en 1844, marcan el inicio de los llamados principios cooperativos, que han venido sirviendo, actualizados por la Alianza Cooperativa Internacional, para delimitar los caracteres jurídicos de las sociedades cooperativas. Sin embargo, la legislación de cooperativas debe determinar, en cada caso, expresamente, los caracteres que delimitan la naturaleza jurídica de estas sociedades, basándose en precisiones jurídicas y sin atender a inseguros enunciados históricos, generalistas y filosóficos.Recibido: 03.05.11Aceptado: 26.05.11
Take-or-pay contracts for renewables deployment
International Nuclear Information System (INIS)
Johnston, Angus; Kavali, Amalia; Neuhoff, Karsten
2008-01-01
Renewables require support policies to deliver the European 20% target. We discuss the requirements for least-cost development and efficient operation and quantify how different schemes (i) allow for the development of a renewable energy technology portfolio; (ii) reduce rent transfers to infra-marginal technologies or better than marginal resource bases and (iii) minimise regulatory risk and thus capital costs for new projects. Long-term take-or-pay contracts minimise regulatory uncertainty, create appropriate incentives for location and operation, allow for efficient system operation and seem compatible with European state aid. We discuss how property rights legislation protects existing renewables investors, and thus can ensure ongoing investment during a transition towards the new scheme
Impregnación de la perovskita La0.8Sr0.2Cr0.5Mn0.5O3-δ como ánodo en celdas SOFC
Directory of Open Access Journals (Sweden)
José Juan Alvarado Flores
2015-09-01
Full Text Available Se han sintetizado a través del método sol-gel, y caracterizado por varias técnicas, nuevos compósitos tipo perovskita de La0,8Sr0,2Cr0,5Mn0,5O3-δ (LSCM, utilizando cobre (XCu; X = 25, 35 y 45% como aditivo formador del cermet LSCM + Cu para utilizarse como ánodos alternativos en celdas de combustible de óxido sólido de temperatura intermedia (IT-SOFC. Se confirma por difracción de rayos X (XRD la formación de fase de los cermets LSCM-Cu. La conductividad eléctrica obtenida desde temperatura ambiente hasta 800 °C indica la presencia de 2 tipos de comportamiento tanto semiconductor como metálico. Cuando la concentración de Cu fue del 25 y del 35%, el comportamiento que dominó fue del tipo semiconductor. La determinación de los coeficientes de expansión térmica (TEC mostró una dependencia lineal inversamente proporcional a la concentración de Cu. Nuestros resultados de conductividad eléctrica, análisis morfológico y TEC sugieren que los ánodos con 25 y 35% de Cu tienen la mayor posibilidad para aplicarse en las celdas tipo SOFC-IT.
Zhang, Di; Whitaker, Brian; Derebe, Mehabaw G; Chiu, Mark L
2018-04-01
Immunostimulatory antibodies against the tumor necrosis factor receptors (TNFR) are emerging as promising cancer immunotherapies. The agonism activity of such antibodies depends on crosslinking to Fc gamma RIIB receptor (FcγRIIB) to enable the antibody multimerization that drives TNFR activation. Previously, Fc engineering was used to enhance the binding of such antibodies to Fcγ receptors. Here, we report the identification of Centyrins as alternative scaffold proteins with binding affinities to homologous FcγRIIB and FcγRIIA, but not to other types of Fcγ receptors. One Centyrin, S29, was engineered at distinct positions of an anti-OX40 SF2 antibody to generate bispecific and tetravalent molecules named as mAbtyrins. Regardless of the position of S29 on the SF2 antibody, SF2-S29 mAbtyrins could bind FcγRIIB and FcγRIIA specifically while maintaining binding to OX40 receptors. In a NFκB reporter assay, attachment of S29 Centyrin molecules at the C-termini, but not the N-termini, resulted in SF2 antibodies with increased agonism owing to FcγRIIB crosslinking. The mAbtyrins also showed agonism in T-cell activation assays with immobilized FcγRIIB and FcγRIIA, but this activity was confined to mAbtyrins with S29 specifically at the C-termini of antibody heavy chains. Furthermore, regardless of the position of the molecule, S29 Centyrin could equip an otherwise Fc-silent antibody with antibody-dependent cellular phagocytosis activity without affecting the antibody's intrinsic antibody-dependent cell-meditated cytotoxicity and complement-dependent cytotoxicity. In summary, the appropriate adoption FcγRII-binding Centyrins as functional modules represents a novel strategy to engineer therapeutic antibodies with improved functionalities.
Construction of a bimolecular fluorescence complementation (BiFC ...
African Journals Online (AJOL)
DR. NJ TONUKARI
2012-08-02
Aug 2, 2012 ... Accepted 8 June, 2012. Protein–protein interactions are essential for signal transduction in cells. ... BiFC is a novel technology that is used for identifying .... occasional fluorescence was observed, it was very weak ... Light field.
27 CFR 8.22 - Contracts to purchase distilled spirits, wine, or malt beverages.
2010-04-01
... AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXCLUSIVE OUTLETS Prohibited..., or malt beverages from the industry member beyond a single sales transaction is prohibited. Examples of such contracts are: (a) An advertising contract between an industry member and a retailer with the...
Energy Technology Data Exchange (ETDEWEB)
Wurzburg, Beth A.; Kim, Beomkyu; Tarchevskaya, Svetlana S.; Eggel, Alexander; Vogel, Monique; Jardetzky, Theodore S. [Bern; (Stanford-MED)
2013-08-02
IgE antibodies interact with the high affinity IgE Fc receptor, FcϵRI, and activate inflammatory pathways associated with the allergic response. The IgE-Fc region, comprising the C-terminal domains of the IgE heavy chain, binds FcϵRI and can adopt different conformations ranging from a closed form incompatible with receptor binding to an open, receptor-bound state. A number of intermediate states are also observed in different IgE-Fc crystal forms. To further explore this apparent IgE-Fc conformational flexibility and to potentially trap a closed, inactive state, we generated a series of disulfide bond mutants. Here we describe the structure and biochemical properties of an IgE-Fc mutant that is trapped in the closed, non-receptor binding state via an engineered disulfide at residue 335 (Cys-335). Reduction of the disulfide at Cys-335 restores the ability of IgE-Fc to bind to its high affinity receptor, FcϵRIα. The structure of the Cys-335 mutant shows that its conformation is within the range of previously observed, closed form IgE-Fc structures and that it retains the hydrophobic pocket found in the hinge region of the closed conformation. Locking the IgE-Fc into the closed state with the Cys-335 mutation does not affect binding of two other IgE-Fc ligands, omalizumab and DARPin E2_79, demonstrating selective blocking of the high affinity receptor binding.
Directory of Open Access Journals (Sweden)
Rodrigo Abensur Athanazio
2010-08-01
Full Text Available OBJETIVO: Conhecer o perfil de pacientes adultos com bronquiectasias, comparando portadores de fibrose cística (FC com aqueles com bronquiectasias de outra etiologia, a fim de determinar se é racional extrapolar terapêuticas instituídas em fibrocísticos para aqueles com bronquiectasias de outras etiologias. MÉTODOS: Análise retrospectiva dos prontuários de 87 pacientes adultos com diagnóstico de bronquiectasia em acompanhamento em nosso serviço. Pacientes com doença secundária a infecção por tuberculose corrente ou no passado foram excluídos. Foram avaliados dados clínicos, funcionais e terapêuticos dos pacientes. RESULTADOS: Dos 87 pacientes com bronquiectasias, 38 (43,7% tinham diagnóstico confirmado de FC através de dosagem de sódio e cloro no suor ou análise genética, enquanto 49 (56,3% apresentavam a doença por outra etiologia, 34 (39,0% desses com bronquiectasia idiopática. Os pacientes com FC apresentavam média de idade ao diagnóstico mais baixa (14,2 vs. 24,2 anos; p OBJECTIVE: To profile the characteristics of adult patients with bronchiectasis, drawing comparisons between cystic fibrosis (CF patients and those with bronchiectasis from other causes in order to determine whether it is rational to extrapolate the bronchiectasis treatment given to CF patients to those with bronchiectasis from other causes. METHODS: A retrospective analysis of the medical charts of 87 patients diagnosed with bronchiectasis and under follow-up treatment at our outpatient clinic. Patients who had tuberculosis (current or previous were excluded. We evaluated the clinical, functional, and treatment data of the patients. RESULTS: Of the 87 patients with bronchiectasis, 38 (43.7% had been diagnosed with CF, through determination of sweat sodium and chloride concentrations or through genetic analysis, whereas the disease was due to another etiology in 49 (56.3%, of whom 34 (39.0% had been diagnosed with idiopathic bronchiectasis. The mean
Frustration of contract e impossibility of performance en el common law inglés
José Félix Chamie
2009-01-01
Sumario: i. Premisa. Formación de la doctrina de la frustration of contract. ii. Implied term theory. iii. Just and reasonable solution theory. iv. Foundation of contract theory. v. Radical change in the obligation: The “Construction theory”. vi. Efectos de la aplicación de la doctrine of frustration. vii. Límites de la jurisprudencia a la aplicación de la doctrine of frustration of contract
Directory of Open Access Journals (Sweden)
Salatiér Buzetti
2011-04-01
Full Text Available
A aplicação de reguladores vegetais, com a finalidade de aumentar a produtividade das culturas, tem merecido, nos últimos anos, grande atenção de pesquisadores. No entanto, alguns resultados têm se mostrado contraditórios. Em face disto, este estudo teve como objetivo verificar os efeitos da aplicação de regulador vegetal sobre os componentes da produção e a produtividade de grãos de duas cultivares de feijão de inverno, em condições de Cerrado. O experimento foi realizado no outono-inverno de 2007, na Fazenda Experimental da Unesp, Campus de Ilha Solteira, localizada no município de Selvíria (MS. O delineamento experimental foi o de blocos casualizados, no esquema em faixas, com quatro repetições. Os tratamentos constituíram-se da combinação de cinco doses do regulador vegetal (0 L ha-1; 0,5 L ha-1; 1,0 L ha-1; 1,5 L ha-1; e 2,0 L ha-1, que é composto por três hormônios vegetais (cinetina, ácido giberélico e ácido indolbutírico, em duas épocas de aplicação: no estádio vegetativo (V4 e reprodutivo (R5. Características vegetativas como altura das plantas de feijão, altura de inserção da primeira vagem, número de grãos por vagem e massa de 100 grãos não foram afetadas pela aplicação do produto. No entanto, sua aplicação no estádio reprodutivo (R5 aumentou o número de grãos por planta e a produtividade de grãos das cultivares de feijoeiro Carioca Precoce e IAC Apuã. Para este aumento, a melhor dose foi 2 L ha-1 do regulador vegetal.
PALAVRAS-CHAVE: Phaseolus vulgaris; componentes da produção; época de aplicação.
Li, Xian; Lee, Youn Ju; Jin, Fansi; Park, Young Na; Deng, Yifeng; Kang, Youra; Yang, Ju Hye; Chang, Jae-Hoon; Kim, Dong-Young; Kim, Jung-Ae; Chang, Young-Chae; Ko, Hyun-Jeong; Kim, Cheorl-Ho; Murakami, Makoto; Chang, Hyeun Wook
2017-07-25
Sirt1, a key regulator of metabolism and longevity, has recently been implicated in the regulation of allergic reactions, although the underlying mechanism remains unclear. Here we show that Sirt1 negatively regulates FcεRI-stimulated mast cell activation and anaphylaxis through two mutually regulated pathways involving AMP-activated protein kinase (AMPK) and protein tyrosine phosphatase 1B (PTP1B). Mast cell-specific knockout of Sirt1 dampened AMPK-dependent suppression of FcεRI signaling, thereby augmenting mast cell activation both in vitro and in vivo. Sirt1 inhibition of FcεRI signaling also involved an alternative component, PTP1B, which attenuated the inhibitory AMPK pathway and conversely enhanced the stimulatory Syk pathway, uncovering a novel role of this phosphatase. Moreover, a Sirt1 activator resveratrol stimulated the inhibitory AMPK axis, with reciprocal suppression of the stimulatory PTP1B/Syk axis, thus potently inhibiting anaphylaxis. Overall, our results provide a molecular explanation for the beneficial role of Sirt1 in allergy and underscore a potential application of Sirt1 activators as a new class of anti-allergic agents.
Directory of Open Access Journals (Sweden)
João Restle
2009-12-01
Full Text Available The performance and development of Charolais (CH and 5/8Nellore 3/8Charolais (5/8NC female calves, feedlot fed with silage of high moisture grain or dry grain of sorghum, were evaluated. The roughage (corn silage:concentrate ratio was 60:40, dry matter (DM basis. Calves average initial weight and age was 96.9±8.5kg and five months. The experimental design was complete randomized, with a 2 x 2 factorial arrangement (types of sorghum grains conservation x genetic groups. No significant interaction was observed between type of sorghum grain conservation and genetic group, for the variables studied. No difference (P>.05 was observed between high moisture and dry grain for daily intake of DM (DMI 3.83 and 3.84 kg DM/day, and digestible energy (DEI 14.59 and 14.92 Mcal/day, respectively. Average daily weight gain (ADW .80 and .83 kg, final weight (FW 165.0 and 166.5 kg, and feed conversion (FC 4.78 and 4.63, were similar for high moisture and dry grain sorghum, respectively. Calves growth parameters according to sorghum grains conservation did not differ (P>.05. The gain of body condition (GBC was higher (P<.05 for the treatment of high moisture grain (.33 points in comparison to dry grain (.22 points. No difference (P>.05 was observed between genetic groups for DMI, DEI, ADW, FC and FW. The 5/8NC compared to the CH calves showed higher (P<.05 final body condition score (3.1 vs 3.0 points, initial (91.12 vs 83.62 cm and final withers height (102.62 vs 94.84 cm and initial (99.37 vs 89.69 cm and final rump height (108.87 vs 101.37 cm. The CH calves had higher (P<.05 thoracic perimeter (24.94 vs 20.56 cm.
THE CONSUMER’S RIGHT OF WITHDRAWAL FROM CONTRACTS CONCLUDED BY ELECTRONIC MEANS IN ROMANIAN LAW
Directory of Open Access Journals (Sweden)
MIHAELA GIURANIUC (TUDORACHE
2011-04-01
Full Text Available The purpose of this paper is to analyse the legislation, doctrinal opinions and relevant case law regarding the consumer's right of withdrawal from contracts concluded by electronic means (e-contracts.The objectives pursued by the author are:- establishing the juridical nature of consumer's right of withdrawal from e-contracts;- identification of problems that could arise from law’s interpretation,- issuing of the de lege ferenda proposals.Governmental Ordinance no. 130/2000 introduces a new exception to the principle of irrevocability of contracts in Romanian law: the consumer's right of withdrawal from distance contracts. The same Ordinance sets the scope and conditions for the applicability of this right.Consumer's right of withdrawal from e-contracts, as a type of distance contracts, can be exercised without the need to give any specific reason and without penalties, within 10 working days from the date of receiving the goods or from the another moment depending on the specifics set out in GO no. 130/2000. If consumer cancels the distance contract on the basis that he does not like the goods, the withdrawal from the contract is valid, even if the withdrawal solely depended on the will of the consumer, this sets out a legal exception from the provisions of art. 1010 of Civil Code which stipulate the nullity of the obligations undertook by the liable person under the condition “if I want”.Sales of goods by electronic means, as a particular case of a distance contracts, is, therefore, a new form of selling, governed by its own specific legal regime.
29 CFR 4.145 - Extended term contracts.
2010-07-01
...'Hara Service Contract Act Changes in Contract Coverage § 4.145 Extended term contracts. (a) Sometimes... purposes of this Act, a contract shall be deemed entered into upon the contract anniversary date which... period is a wholly new contract with respect to application of the Act's provisions and the regulations...
Frustration of contract e impossibility of performance en el common law inglés
Directory of Open Access Journals (Sweden)
José Félix Chamie
2009-06-01
Full Text Available Sumario: i. Premisa. Formación de la doctrina de la frustration of contract. ii. Implied term theory. iii. Just and reasonable solution theory. iv. Foundation of contract theory. v. Radical change in the obligation: The “Construction theory”. vi. Efectos de la aplicación de la doctrine of frustration. vii. Límites de la jurisprudencia a la aplicación de la doctrine of frustration of contract
Directory of Open Access Journals (Sweden)
Fernando Carvalho Oliveira
2002-04-01
Full Text Available Experimento de campo foi conduzido, nos anos agrícolas 1996/97 e 1997/98, para avaliar os efeitos de aplicações sucessivas de composto de lixo urbano sobre os teores de carbono orgânico, condutividade elétrica, pH e capacidade de troca de cátions (CTC ao pH atual de um Latossolo Amarelo distrófico em que foi cultivada cana-de-açúcar. No primeiro ano agrícola, além dos tratamentos calagem + adubação mineral e testemunha, o composto de lixo foi aplicado nas doses de 20, 40 e 60 Mg ha-1 (base seca. No segundo ano, o composto foi reaplicado nas doses de 24, 48 e 72 Mg ha-1. Todas as propriedades químicas do solo estudadas aumentaram com as doses do composto, em ambos os anos agrícolas. Os incrementos observados nesses atributos, da primeira para a segunda aplicação, foram significativos, exceto a condutividade elétrica, que, embora tenha aumentado logo após a aplicação do resíduo, não atingiu níveis críticos e teve seus valores reduzidos com o tempo. Acúmulos nos teores de C orgânico do solo foram diretamente proporcionais às doses de aplicação. O aumento da CTC do solo foi conseqüência direta dos incrementos nos teores de C orgânico e nos valores de pH.A field experiment was conducted, during the years of 1996/97 and 1997/98, to evaluate the effects of the successive application of solid urban waste compost on organic carbon, electrical conductivity, pH, and cation exchange capacity (CEC at field pH in a Typic Hapludox cropped with sugarcane. In the first year, besides lime + mineral fertilizer and control treatments, the compost was applied at a rate of 0, 20, 40, and 60 Mg ha-1 (dry basis. In the second year, the compost was reapplied at a rate of 24, 48, and 72 Mg ha-1. All studied soil properties increased with rate of compost application in both years. Attributes increments from the first to the second application were significant, except for electrical conductivity, which increased soon after the residue
Energy Technology Data Exchange (ETDEWEB)
Quintella, Josie; Braga, Luciana [Agencia Nacional do Petroleo, Gas Natural e Biocombustiveis (ANP), Rio de Janeiro, RJ (Brazil)
2008-07-01
The opening of the oil and gas market (Constitutional Amendment n. 9, from 1995 and Law n. 9.478/97 - Petroleum Law), inserted in our order some elements and practices already existing in world oil industry, among which we point out the farm in/farm out contracts. It made possible that the company which has the concession of exploratory and production of oil, to give total or partial rights to other participants, through approval of regulatory institution. In Brazil, this practice is identified as 'Cessao de Direitos'. This work will present the proceedings adopted by the National Agency of Petroleum, Natural Gas and Biofuels (ANP) for executing this current practice (89 requests within the last twelve months) in the Brazilian Petroleum Industry. (author)
Directory of Open Access Journals (Sweden)
AA Lima
2011-03-01
Full Text Available Este trabalho foi realizado com o objetivo de avaliar o estado nutricional e a produtividade do tomateiro, híbrido Vênus, cultivado em substratos, com aplicação de ácidos húmicos (AH e fertirrigação. Foram avaliadas quatro doses de AH (0, 20, 40 e 80 L ha-1 e quatro substratos: S1 (fibra de coco (FC, S2 (FC + casca de café carbonizada (CC na proporção 1:3, S3 (FC + CC na proporção 2:3 e S4 (CC. O delineamento experimental foi em blocos casualizados distribuídos em esquema fatorial 4x4. As mudas foram transplantadas com 35 dias para sacolas plásticas com capacidade de 7,0 L. Os AH foram aplicados quatro vezes em um intervalo de oito dias, sendo a primeira aplicação oito dias após o transplantio. Não houve efeito significativo dos tratamentos nos teores de N, K e S nas folhas e na produção de frutos não comerciais. No entanto, houve efeito significativo dos substratos nos teores de P, Ca, Mg e sobre a produção de frutos total e comercial. Doses crescentes de AH induziram redução de forma linear dos teores de B e Cu (em S1; porém, induziram aumento dos teores de Zn. Em doses de 31 a 49 L ha-1 de AH, ocorreu o máximo teor foliar de Fe, Cu e o mínimo de Mn. As maiores produtividades comerciais foram obtidas com a fibra de coco (S1 com média de 5,6 kg planta-1, apresentando incremento médio de produtividade de 22,9%, 38,7% e 49,7% em relação a S2, S3 e S4, respectivamente.We evaluated the nutritional status and yield of tomato hybrid "Vênus", grown on substrates, with application of humic acids (AH and fertigation. Four doses of AH (0, 20, 40 and 80 L-1 ha and four substrates: S1 (coconut fiber (CF, S2 (FC + carbonized coffee husk (CC in the ratio 1:3, S3 (CF + CC - in the ratio 2:3 and S4 (CC were evaluated following the randomized blocks design in factorial 4x4 scheme with four replications. The 35-day old seedlings were transplanted into plastic bags of 7 L. The humic acids were applied four times in eight