Final Report for DOE Project DE-FC07-99CH11010

Energy Technology Data Exchange (ETDEWEB)

Jed Randall; Robert Kean

2003-10-22

Department of Energy award number DE-FC07-99CH11010, Enhanced Utilization of Corn Based Biomaterials, supported a technology development program sponsored by Cargill Dow LLC from September 30, 1999 through June 30, 2003. The work involved fundamental scientific studies on poly lactic acid (PLA), a new environmentally benign plastic material from renewable resources. DOE funds supported academic research at the Colorado School of Mines and the National Renewable Energy Laboratory (NREL), and industry cost share was directed towards applied research into new product development utilizing the fundamental information generated by the academic partners. Under the arrangement of the grant, the fundamental information is published so that other companies can utilize it in evaluating the applicability of PLA in their own products. The overall project objective is to increase the utilization of PLA, a renewable resource based plastic, currently produced from fermented corn sugar.

48 CFR 52.222-51 - Exemption from Application of the Service Contract Act to Contracts for Maintenance, Calibration...

Science.gov (United States)

2010-10-01

... of the Service Contract Act to Contracts for Maintenance, Calibration, or Repair of Certain Equipment....222-51 Exemption from Application of the Service Contract Act to Contracts for Maintenance... clause: Exemption From Application of the Service Contract Act to Contracts for Maintenance, Calibration...

48 CFR 52.222-48 - Exemption from Application of the Service Contract Act to Contracts for Maintenance, Calibration...

Science.gov (United States)

2010-10-01

... of the Service Contract Act to Contracts for Maintenance, Calibration, or Repair of Certain Equipment....222-48 Exemption from Application of the Service Contract Act to Contracts for Maintenance... following provision: Exemption From Application of the Service Contract Act to Contracts for Maintenance...

Fc-fusion Proteins in Therapy: An Updated View.

Science.gov (United States)

Jafari, Reza; Zolbanin, Naime M; Rafatpanah, Houshang; Majidi, Jafar; Kazemi, Tohid

2017-01-01

Fc-fusion proteins are composed of Fc region of IgG antibody (Hinge-CH2-CH3) and a desired linked protein. Fc region of Fc-fusion proteins can bind to neonatal Fc receptor (FcRn) thereby rescuing it from degradation. The first therapeutic Fc-fusion protein was introduced for the treatment of AIDS. The molecular designing is the first stage in production of Fc-fusion proteins. The amino acid residues in the Fc region and linked protein are very important in the bioactivity and affinity of the fusion proteins. Although, therapeutic monoclonal antibodies are the top selling biologics but the application of therapeutic Fc-fusion proteins in clinic is in progress and among these medications Etanercept is the most effective in therapy. At present, eleven Fc-fusion proteins have been approved by FDA. There are novel Fc-fusion proteins which are in pre-clinical and clinical development. In this article, we review the molecular and biological characteristics of Fc-fusion proteins and then further discuss the features of novel therapeutic Fc-fusion proteins. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Temporary labour contracts

CERN Document Server

2000-01-01

The five contracts for Temporary Labour assignments on the CERN site (L020/PE, L 021/PE, L 022/PE, L 023/PE and L 024/PE) approved by the Finance Committee in March 1996 (CERN/FC/3857) reached the end of their initial three-year contractual period at the end of December 1999. At CERN?s request, in September 1999 the Finance Committee approved an extension of these contracts for the year 2000 for a total amount not exceeding 6 000 000 Swiss francs (CERN/FC/4196). In December 1999, one of the five contractors, FIRCROFT, withdrew from its contract for 2000. Following the satisfactory execution of the four remaining contracts during 2000, CERN requests approval to extend them from January 2001 for the second of the two optional years provided for in the original adjudication. The Finance Committee is invited to approve the extension of the existing contracts until 31 December 2001 for a total amount not exceeding 6 000 000 Swiss francs at 2000 prices.

Thermal decomposition of FC(O)OCH3 and FC(O)OCH2CH3.

Science.gov (United States)

Berasategui, M; Argüello, G A; Burgos Paci, M A

2018-05-09

The thermal decomposition of methyl and ethyl formates has been extensively studied due to their importance in the oxidation of several fuels, pesticidal properties and their presence in interstellar space. We hitherto present the study of the thermal decomposition of methyl and ethyl fluoroformates, which could help in the elucidation of the reaction mechanisms. The reaction mechanisms were studied using FTIR spectroscopy in the temperature range of 453-733 K in the presence of different pressures of N2 as bath gas. For FC(O)OCH3 two different channels were observed; the unimolecular decomposition which is favored at higher temperatures and has a rate constant kFC(O)OCH3 = (5.3 ± 0.5) × 1015 exp[-(246 ± 10 kJ mol-1/RT)] (in units of s-1) and a bimolecular channel with a rate constant kFC(O)OCH3 = (1.6 ± 0.5) × 1011 exp[-(148 ± 10 kJ mol-1/RT)] (in units of s-1 (mol L)-1). However for ethyl formate, only direct elimination of CO2, HF and ethylene operates. The rate constants of the homogeneous first-order process fit the Arrhenius equation kFC(O)OCH2CH3 = (2.06 ± 0.09) × 1013 exp[-(169 ± 6 kJ mol-1/RT)] (in units of s-1). The difference between the mechanisms of the two fluoroformates relies on the stabilization of a six-centered transition state that only exists for ethyl formate. First principles calculations for the different channels were carried out to understand the dynamics of the decomposition.

Engineering of Immunoglobulin Fc Heterodimers Using Yeast Surface-Displayed Combinatorial Fc Library Screening.

Directory of Open Access Journals (Sweden)

Hye-Ji Choi

Full Text Available Immunoglobulin Fc heterodimers, which are useful scaffolds for the generation of bispecific antibodies, have been mostly generated through structure-based rational design methods that introduce asymmetric mutations into the CH3 homodimeric interface to favor heterodimeric Fc formation. Here, we report an approach to generate heterodimeric Fc variants through directed evolution combined with yeast surface display. We developed a combinatorial heterodimeric Fc library display system by mating two haploid yeast cell lines, one haploid cell line displayed an Fc chain library (displayed FcCH3A with mutations in one CH3 domain (CH3A on the yeast cell surface, and the other cell line secreted an Fc chain library (secreted FcCH3B with mutations in the other CH3 domain (CH3B. In the mated cells, secreted FcCH3B is displayed on the cell surface through heterodimerization with the displayed FcCH3A, the detection of which enabled us to screen the library for heterodimeric Fc variants. We constructed combinatorial heterodimeric Fc libraries with simultaneous mutations in the homodimer-favoring electrostatic interaction pairs K370-E357/S364 or D399-K392/K409 at the CH3 domain interface. High-throughput screening of the libraries using flow cytometry yielded heterodimeric Fc variants with heterodimer-favoring CH3 domain interface mutation pairs, some of them showed high heterodimerization yields (~80-90% with previously unidentified CH3 domain interface mutation pairs, such as hydrogen bonds and cation-π interactions. Our study provides a new approach for engineering Fc heterodimers that could be used to engineer other heterodimeric protein-protein interactions through directed evolution combined with yeast surface display.

Rapid desensitization of mice with anti-FcγRIIb/FcγRIII mAb safely prevents IgG-mediated anaphylaxis.

Science.gov (United States)

Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Clay, Corey D; Morris, Suzanne C; Finkelman, Fred D

2013-12-01

Stimulatory IgG receptors (FcγRs) on bone marrow-derived cells contribute to the pathogenesis of several autoimmune and inflammatory disorders. Monoclonal antibodies that block FcγRs might suppress these diseases, but they can induce anaphylaxis. We wanted to determine whether a rapid desensitization approach can safely suppress IgG/FcγR-mediated anaphylaxis. Mice were injected with serially increasing doses of 2.4G2, a rat mAb that blocks the inhibitory FcγR, FcγRIIb, and the stimulatory receptor, FcγRIII. Rectal temperature was used to detect the development of anaphylaxis. Passive and active IgG-mediated anaphylaxis were evaluated in mice that had been rapidly desensitized with 2.4G2 or mock-desensitized in mice in which monocyte/macrophages, basophils, or neutrophils had been depleted or desensitized and in mice in which FcγRI, FcγRIII, and/or FcγRIV had been deleted or blocked. Rapid desensitization with 2.4G2 prevented 2.4G2-induced shock and completely suppressed IgG-mediated anaphylaxis. Rapid desensitization of ovalbumin-sensitized mice with 2.4G2 was safer and more effective than rapid desensitization with ovalbumin. 2.4G2 treatment completely blocked FcγRIII and removed most FcγRI and FcγRIV from nucleated peripheral blood cells. Because IgG(2a)-mediated anaphylaxis was partially FcγRI and FcγRIV dependent, the effects of 2.4G2 on FcγRI and FcγRIV were probably crucial for its complete inhibition of IgG(2a)-mediated anaphylaxis. IgG(2a)-mediated anaphylaxis was partially inhibited by depletion or desensitization of monocyte/macrophages, basophils, or neutrophils. IgG-mediated anaphylaxis can be induced by ligation of FcγRI, FcγRIII, or FcγRIV on monocycte/macrophages, basophils, or neutrophils and can be safely suppressed by rapid desensitization with anti-FcγRII/RIII mAb. A similar approach may safely suppress other FcγR-dependent immunopathology. Published by Mosby, Inc.

Importance of neonatal FcR in regulating the serum half-life of therapeutic proteins containing the Fc domain of human IgG1: a comparative study of the affinity of monoclonal antibodies and Fc-fusion proteins to human neonatal FcR.

Science.gov (United States)

Suzuki, Takuo; Ishii-Watabe, Akiko; Tada, Minoru; Kobayashi, Tetsu; Kanayasu-Toyoda, Toshie; Kawanishi, Toru; Yamaguchi, Teruhide

2010-02-15

The neonatal FcR (FcRn) binds to the Fc domain of IgG at acidic pH in the endosome and protects IgG from degradation, thereby contributing to the long serum half-life of IgG. To date, more than 20 mAb products and 5 Fc-fusion protein products have received marketing authorization approval in the United States, the European Union, or Japan. Many of these therapeutic proteins have the Fc domain of human IgG1; however, the serum half-lives differ in each protein. To elucidate the role of FcRn in the pharmacokinetics of Fc domain-containing therapeutic proteins, we evaluated the affinity of the clinically used human, humanized, chimeric, or mouse mAbs and Fc-fusion proteins to recombinant human FcRn by surface plasmon resonance analysis. The affinities of these therapeutic proteins to FcRn were found to be closely correlated with the serum half-lives reported from clinical studies, suggesting the important role of FcRn in regulating their serum half-lives. The relatively short serum half-life of Fc-fusion proteins was thought to arise from the low affinity to FcRn. The existence of some mAbs having high affinity to FcRn and a short serum half-life, however, suggested the involvement of other critical factor(s) in determining the serum half-life of such Abs. We further investigated the reason for the relatively low affinity of Fc-fusion proteins to FcRn and suggested the possibility that the receptor domain of Fc-fusion protein influences the structural environment of the FcRn binding region but not of the FcgammaRI binding region of the Fc domain.

7 CFR 97.104 - Application or certificate abandoned.

Science.gov (United States)

2010-01-01

... 97.104 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) COMMODITY... abandoned certificates shall be published in the Official Journal, indicating that the variety has become...

FRACIONAMENTO DE PROTEÍNAS DE SILAGEM DE CAPIM-ELEFANTE EMURCHECIDO OU COM FARELO DE CACAU PROTEIN FRACTIONING OF SILAGE OF ELEPHANTGRASS WILTED OR WITH COCOA MEAL

Directory of Open Access Journals (Sweden)

Gleidson Giordano Pinto de Carvalho

2008-10-01

Full Text Available

Desenvolveu-se o experimento para determinar as frações que compõem as proteínas da silagem de capim-elefante (Pennisetum purpureum Schum. cv. Camaroon submetido ao emurchecimento ou à adição de diferentes níveis de farelo de cacau. O capim-elefante utilizado foi colhido aos 50 dias de rebrota após o corte de uniformização e submetido aos seguintes tratamentos: capim-elefante emurchecido ao sol por oito horas, e capim-elefante sem emurchecimento com níveis de 0 %, 7 %, 14%, 21 % e 28 % de farelo de cacau (FC (% da matéria natural. Acondicionou-se o material em silos de PVC com capacidade para 5,3 litros, que foram abertos após 45 dias. Para todas as frações de proteínas estimadas, o tratamento emurchecido apresentou valores semelhantes (P>0,05 ao do tratamento sem emurchecimento. As frações protéicas foram influenciadas pelas adições de FC, verificando-se redução dos teores das frações A e B1+B2 e aumentos das frações B3 e C, para os níveis crescentes de FC.

Immunization with avian metapneumovirus harboring chicken Fc induces higher immune responses.

Science.gov (United States)

Paudel, Sarita; Easwaran, Maheswaran; Jang, Hyun; Jung, Ho-Kyoung; Kim, Joo-Hun; Shin, Hyun-Jin

2016-07-15

In this study, we evaluated the immune responses of avian metapneumovirus harboring chicken Fc molecule. Stable Vero cells expressing chicken Fc chimera on its surface (Vero-cFc) were established, and we confirmed that aMPV grown in Vero-cFc incorporated host derived chimera Fc into the aMPV virions. Immunization of chicken with aMPV-cFc induced higher level of antibodies and inflammatory cytokines; (Interferon (IFN)-γ and Interleukin (IL)-1β) compared to those of aMPV. The increased levels of antibodies and inflammatory cytokines in chicken immunized with aMPV-cFc were statistically significantly (p<0.05) to that of aMPV and control. The aMPV-cFc group also generated the highest neutralizing antibody response. After challenges, chickens immunized with aMPV-cFc showed much less pathological signs in nasal turbinates and trachea so that we could confirm aMPV-cFc induced higher protection than that of aMPV. The greater ability of aMPV harboring chicken Fc to that of aMPV presented it as a possible vaccine candidate. Copyright © 2016 Elsevier B.V. All rights reserved.

Substituição parcial e total da proteína do farelo de soja pela proteína dos farelos de canola e algodão em dietas para alevinos de piavuçu, Leporinus macrocephalus (Garavello & Britski, 1988 Partial and total replacement of soybean meal protein by canola or cottonseed meal protein in diets of Leporinus macrocephalus (Garavello & Britski, 1988 fingerlings

Directory of Open Access Journals (Sweden)

Anna Christina Esper Amaro de Faria

2001-05-01

Full Text Available Com o objetivo de avaliar a substituição da proteína do farelo de soja (FS pela proteína do farelo de canola (FC e farelo de algodão (FA, em dietas para alevinos de piavuçu, Leporinus macrocephalus (Characiformes, Anostomidae, realizou-se um experimento com duração de 60 dias, utilizando-se 300 alevinos, com peso inicial médio de 0,10 g distribuídos em um delineamento em blocos casualizados, com seis tratamentos e cinco repetições. As dietas isoprotéicas foram formuladas de forma a terem o FS, FC, FA, FS+FC, FS+FA e FC+FA como fonte protéica. Os alevinos, alimentados com dietas contendo FS e FS+FA, apresentaram valores de peso final e taxa de eficiência protéica superiores (p 0,05 pelo uso das diferentes dietas. Observou-se redução linear dos valores de peso final, da taxa de eficiência protéica e aumento linear (p The effects of soybean meal (SB protein replacement by canola meal (CN or cottonseed meal (CT protein in diets of Leporinus macrocephalus (Characiformes, Anostomidae fingerlings are provided. Assay was carried out during 60 days. Three hundred fingerlings with mean initial weight of 1.00g were distributed in a block randomized design with six treatments and five replicates. Isoprotein diets contained SB, CN, CT, SB+CN, SB+CT and CN+CT as protein source. Fingerlings fed on diets with SB, SB+CN, SB+CT showed better final mean weight and protein efficiency rate values (p 0.05 by different diets linear reduction (p macrocephalus fingerlings, replacing 50.00% of SB protein.

Effects of microparticle size and Fc density on macrophage phagocytosis.

Directory of Open Access Journals (Sweden)

Patricia Pacheco

Full Text Available Controlled induction of phagocytosis in macrophages offers the ability to therapeutically regulate the immune system as well as improve delivery of chemicals or biologicals for immune processing. Maximizing particle uptake by macrophages through Fc receptor-mediated phagocytosis could lead to new delivery mechanisms in drug or vaccine development. Fc ligand density and particle size were examined independently and in combination in order to optimize and tune the phagocytosis of opsonized microparticles. We show the internalization efficiency of small polystyrene particles (0.5 µm to 2 µm is significantly affected by changes in Fc ligand density, while particles greater than 2 µm show little correlation between internalization and Fc density. We found that while macrophages can efficiently phagocytose a large number of smaller particles, the total volume of phagocytosed particles is maximized through the non-specific uptake of larger microparticles. Therefore, larger microparticles may be more efficient at delivering a greater therapeutic payload to macrophages, but smaller opsonized microparticles can deliver bio-active substances to a greater percentage of the macrophage population. This study is the first to treat as independent variables the physical and biological properties of Fc density and microparticle size that initiate macrophage phagocytosis. Defining the physical and biological parameters that affect phagocytosis efficiency will lead to improved methods of microparticle delivery to macrophages.

Cyclotron production of ruthenium-97 for radiopharmaceutical applications

International Nuclear Information System (INIS)

Music, S.; Gessner, M.

1980-01-01

Ruthenium-97 is of interest for clinical practice in nuclear medicine. The combination of the excellent physical and chemical properties of Ruthenium-97 make this isotope worth evaluating. Ruthenium-97 has been prepared by irradiation of a sheet of molybdenum with the internal alpha-beam of the Ruthenium-97 as a function of the alpha particle energy has been measured. The radiochemical separation and its possible clinical applications have been discussed. (author)

Corrosion rate of steel embedded in blended Portland and fluid catalytic cracking catalyst residue (FC3R cement mortars

Directory of Open Access Journals (Sweden)

Payá, J.

2008-12-01

Full Text Available This paper reports on a study of the corrosion levels in steel bars embedded in mortars made with a blend of Portland cement and (0-20% spent fluid catalytic cracking catalyst residue (FC3R, with a variable (0.3-0.7 water/binder (w/b ratio. The specimens were stored in the following conditions: relative humidity of 40, 80 or 100% and CO2 concentrations of 5 and 100%. The steel corrosion rate was measured with polarization resistance techniques. In the absence of aggressive agents, the steel was found to remain duly passivated in mortars with an FC3R content of up to 15% under all the conditions of relative humidity tested. The reinforcement corrosion level in mortars with a w/b ratio of 0.3 and 15% FC3R subjected to accelerated carbonation was similar to the level observed in the unblended Portland cement control mortar.En este trabajo se ha estudiado el nivel de corrosión de barras de acero embebidas en morteros de cemento Portland con relación agua/material cementante (a/mc variable (0,3-0,7, en los que parte del cemento (0-20% se sustituyó por catalizador de craqueo usado (FC3R. Las condiciones de conservación de las probetas elaboradas fueron las siguientes: distintas humedades relativas (40, 80 y 100% y dos concentraciones de CO2 (5 y 100%. La velocidad de corrosión de los aceros se midió mediante la técnica de resistencia de polarización. Se ha podido determinar que, bajo las distintas condiciones de humedad relativa y ausencia de agresivo, los aceros se mantuvieron correctamente pasivados en los morteros con contenidos de FC3R de hasta el 15%. El nivel de corrosión que presenta el refuerzo embebidos en morteros con sustitución de un 15% de cemento por FC3R y relación a/mc 0,3, al ser sometidos a un proceso de carbonatación acelerada, era muy similar al mostrado por el mortero patrón, sin FC3R.

The neonatal Fc receptor, FcRn, as a target for drug delivery and therapy.

Science.gov (United States)

Sockolosky, Jonathan T; Szoka, Francis C

2015-08-30

Immunoglobulin G (IgG)-based drugs are arguably the most successful class of protein therapeutics due in part to their remarkably long blood circulation. This arises from IgG interaction with the neonatal Fc receptor, FcRn. FcRn is the central regulator of IgG and albumin homeostasis throughout life and is increasingly being recognized as an important player in autoimmune disease, mucosal immunity, and tumor immune surveillance. Various engineering approaches that hijack or disrupt the FcRn-mediated transport pathway have been devised to develop long-lasting and non-invasive protein therapeutics, protein subunit vaccines, and therapeutics for treatment of autoimmune and infectious disease. In this review, we highlight the diverse biological functions of FcRn, emerging therapeutic opportunities, as well as the associated challenges of targeting FcRn for drug delivery and disease therapy. Copyright © 2015 Elsevier B.V. All rights reserved.

Acidentes de trabalho não fatais: diferenças de gênero e tipo de contrato de trabalho Non-fatal occupational injuries: gender and job contract differences

Directory of Open Access Journals (Sweden)

Vilma Santana

2003-04-01

Full Text Available No Brasil, trabalhadores sem vínculo formal de trabalho representam mais da metade da força de trabalho, cuja maioria é composta por mulheres. Neste estudo, estima-se a incidência anual de acidentes ocupacionais não fatais, e a sua distribuição por gênero e tipo de contrato de trabalho, em uma área urbana do Brasil. Dados provêm de um inquérito de base comunitária conduzido com uma amostra aleatória dos habitantes de Salvador, capital do Estado da Bahia. A população deste estudo compreende o total de pessoas entre 18 e 65 anos que referiram trabalho remunerado (n = 2.947. A coleta de dados baseada em entrevistas domiciliares individuais. A incidência anual de acidentes foi estimada em 5,80%, discretamente maior entre os homens (6,05% do que entre as mulheres (5,53%, ou entre trabalhadores sem contrato formal de trabalho (5,92% do que no grupo de comparação (5,67%, diferenças não estatisticamente significantes. A semelhança entre as freqüências de acidentes de trabalho entre mulheres e homens independentemente do tipo de contrato de trabalho apontam para a necessidade de maior atenção a estes eventos no sexo feminino, e entre os trabalhadores informais, amplamente ignorados nas estatísticas oficiais do país.In Brazil, workers without a formal job contract comprise more than half of the labor force, a contingent formed mainly by women. This study presents estimates of the annual incidence of non-fatal work-related injuries and their distribution by gender and type of job contract in an urban area of Brazil. This was a community-based study with a random cluster area sample of the inhabitants from the city of Salvador, capital of the State of Bahia. The study population included all individuals from 18 to 65 years of age who reported having a paid job (n = 2,947. Data were obtained through individual household interviews. The overall estimated annual incidence rate was 5.80%, with a non-statistically significant

Influência do nível de performance na estratégia de ritmo de corrida em prova de 10 km de corredores recreacionais

Directory of Open Access Journals (Sweden)

Francisco de Assis MANOEL

2015-09-01

Full Text Available ResumoO objetivo do estudo foi verificar a influência do nível de performance na estratégia de ritmo de corrida de corredores recreacionais. Adicionalmente, objetivou-se descrever o comportamento da frequência cardíaca (FC obtida em prova de 10 km em pista de atletismo. Participaram 39 corredores recreacionais (31,5 ± 6,7 anos, experientes em provas de 10 km que realizaram uma performance nesta distância em pista de atletismo (400 m. A FC foi constantemente monitorada (Polar RS800 e o tempo a cada 400 m foi registrado para determinação da velocidade média (VM, posteriormente analisada a cada 2 km. Os participantes foram divididos em dois grupos de acordo com a VM alcançada nos testes: G1 = VM 10 km ≤ 11,81 (n = 20 e G2 = VM 10 km > 11,81 (n = 19. A comparação entre os valores de VM e FC obtidos nos diferentes momentos da performance para os dois grupos foi realizada pela Anova mista, adotando-se nível de significância de p < 0,05. Os valores de VM foram diferentes entre os grupos em todos os momentos analisados, com aumento significante da VM do momento 6-8 km para 8-10 km para o mesmo grupo. Os valores de FC foram diferentes apenas intra-grupos. No G1, houve aumento significante da FC a cada 2 km de prova. Para o G2, a FC aumentou do 2º ao 4º km e permaneceu estável até o 8º km, aumentando novamente nos últimos 2 km da performance. Concluímos que o nível de performance não influencia a estratégia de corrida de corredores recreacionais.

Aplicação de dessecantes na cultura de soja: teor de umidade nas sementes e biomassa nas plantas Application dissecants in soybean: degree of humidity in the plant's seeds and biomass

Directory of Open Access Journals (Sweden)

A.L.S. Lacerda

2003-12-01

Full Text Available Os objetivos deste trabalho foram avaliar a eficácia dos dessecantes e determinar a melhor época de aplicação na cultura de soja. O delineamento experimental utilizado foi em blocos casualizados, estando os tratamentos dispostos em esquema fatorial 3x3 e 4x4 de produtos (dessecantes e épocas de aplicação, nos anos agrícolas 1996/97 e 1997/98, respectivamente. Os dessecantes utilizados foram: paraquat, diquat e paraquat + diquat em 1996/97 e paraquat, diquat, paraquat + diquat e glufosinato de amônio em 1997/98, respectivamente nas dosagens de 0,4, 0,3 e 0,2 + 0,15; e 0,4, 0,3, 0,2 + 0,15 e 0,4 kg i.a. ha¹. Como épocas, foram realizadas três aplicações em 1996/97 e quatro em 1997/98, com intervalos de cinco dias a partir do estádio R6. Após análise e interpretação dos resultados, concluiu-se que os dessecantes foram eficazes na dessecação e que o teor de umidade das sementes entre 50 e 60%, as plantas com baixa incidência de vagens amarelas e marrons e a relação peso de biomassa verde de vagens/biomassa verde total de cerca de 0,5 foram características marcantes na determinação da melhor época de aplicação dos dessecantes.The objectives of this work were to evaluate dissecant efficiency and determine the best application time for soybean crop. The experimental design was randomized blocks in factorial schemes 3x3 and 4x4 (dissecants x application time, in 1996/1997 and 1997/1998, respectively. The dissecants applied were: paraquat, diquat and paraquat + diquat in 1996/97 and paraquat, diquat, paraquat + diquat and ammonium glufosinate in 1997/1998, respectively, in the following doses: 0.4; 0.3 and 0.2 + 0.15 and 0.4; 0.3; 0.2 + 0.15 and 0.4 kg a.i. ha-1 Three application times were used in 1996/1997 and four in 1997/1998, with intervals of five days starting from stage R6. Analysis and interpretation of the results allowed to conclude that the dissecants were efficient and that seed moisture between 50 and 60

Comparison of the Fc fragment from a human IgG1 and its CH2, pFc', and tFc' subfragments. A study using reductive methylation and 13C NMR

International Nuclear Information System (INIS)

Jentoft, J.E.; Rayford, R.

1989-01-01

The Fc fragment of a human monoclonal IgG1 was compared with subfragments containing (a) the intact CH2 domain (CH2 fragment) or (b) the intact CH3 domain (pFc' and tFc' fragments). All fragments were reductively 13 C-methylated and their resulting dimethyllysyl resonances characterized in 0.1 M KCl as a function of pH by 13 C NMR spectroscopy. Seven resonances were characterized for the 18 lysine residues of the Fc fragment, eight for the 12 lysines of the CH2 fragment, and five each for the 9 lysines of the pFc' and the 6 lysines of the tFc' fragments, respectively. The multiplicity of resonances indicates that the lysine residues in each fragment exist in a variety of microenvironments and that the fragments are all highly structured. The correspondence between 6 of the 12 or 13 perturbed lysine residues in the Fc fragment and the smaller subfragments indicates that the conformation of the CH2 and CH3 domains is largely unchanged in the smaller fragments. However, in addition to three lysines at the CH2-CH3 domain interface, whose environments were known to be disrupted in the smaller fragments, three or four lysine residues have somewhat different properties in the Fc fragment and in the subfragments, indicating that some local perturbations are included in the domain structure in the subfragments

Experimental investigation of small diameter two-phase closed thermosyphons charged with water, FC-84, FC-77 and FC-3283

International Nuclear Information System (INIS)

Jouhara, Hussam; Robinson, Anthony J.

2010-01-01

An experimental investigation of the performance of thermosyphons charged with water as well as the dielectric heat transfer liquids FC-84, FC-77 and FC-3283 has been carried out. The copper thermosyphon was 200 mm long with an inner diameter of 6 mm, which can be considered quite small compared with the vast majority of thermosyphons reported in the open literature. The evaporator length was 40 mm and the condenser length was 60 mm which corresponds with what might be expected in compact heat exchangers. With water as the working fluid two fluid loadings were investigated, that being 0.6 ml and 1.8 ml, corresponding to approximately half filled and overfilled evaporator section in order to ensure combined pool boiling and thin film evaporation/boiling and pool boiling only conditions, respectively. For the Fluorinert TM liquids, only the higher fill volume was tested as the aim was to investigate pool boiling opposed to thin film evaporation. Generally, the water-charged thermosyphon evaporator and condenser heat transfer characteristics compared well with available predictive correlations and theories. The thermal performance of the water-charged thermosyphon also outperformed the other three working fluids in both the effective thermal resistance as well as maximum heat transport capabilities. Even so, FC-84, the lowest saturation temperature fluid tested, shows marginal improvement in the heat transfer at low operating temperatures. All of the tested Fluorinert TM liquids offer the advantage of being dielectric fluids, which may be better suited for sensitive electronics cooling applications and were all found to provide adequate thermal performance up to approximately 30-50 W after which liquid entrainment compromised their performance.

48 CFR 53.301-1437 - Settlement Proposal for Cost-Reimbursement Type Contracts.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Settlement Proposal for Cost-Reimbursement Type Contracts. 53.301-1437 Section 53.301-1437 Federal Acquisition Regulations...-1437 Settlement Proposal for Cost-Reimbursement Type Contracts. ER09DE97.012 [62 FR 64951, Dec. 9, 1997] ...

Positron emission tomography/computed tomographic and magnetic resonance imaging in a murine model of progressive atherosclerosis using (64)Cu-labeled glycoprotein VI-Fc.

Science.gov (United States)

Bigalke, Boris; Phinikaridou, Alkystis; Andia, Marcelo E; Cooper, Margaret S; Schuster, Andreas; Schönberger, Tanja; Griessinger, Christoph M; Wurster, Thomas; Onthank, David; Ungerer, Martin; Gawaz, Meinrad; Nagel, Eike; Botnar, Rene M

2013-11-01

Plaque erosion leads to exposure of subendothelial collagen, which may be targeted by glycoprotein VI (GPVI). We aimed to detect plaque erosion using (64)Cu-labeled GPVI-Fc (fragment crystallized). Four-week-old male apolipoprotein E-deficient (ApoE(-/-)) mice (n=6) were fed a high-fat diet for 12 weeks. C57BL/6J wild-type (WT) mice served as controls (n=6). Another group of WT mice received a ligation injury of the left carotid artery (n=6) or sham procedure (n=4). All mice received a total activity of ≈12 MBq (64)Cu-GPVI-Fc by tail vein injection followed by delayed (24 hours) positron emission tomography using a NanoPET/computed tomographic scanner (Mediso, Hungary; Bioscan, USA) with an acquisition time of 1800 seconds. Seventy-two hours after positron emission tomography/computed tomography, all mice were scanned 2 hours after intravenous administration of 0.2 mmol/kg body weight of a gadolinium-based elastin-specific MR contrast agent. MRI was performed on a 3-T clinical scanner (Philips Healthcare, Best, The Netherlands). In ApoE(-/-) mice, the (64)Cu-GPVI-Fc uptake in the aortic arch was significantly higher compared with WT mice (ApoE(-/-): 13.2±1.5 Bq/cm(3) versus WT mice: 5.1±0.5 Bq/cm(3); P=0.028). (64)Cu-GPVI-Fc uptake was also higher in the injured left carotid artery wall compared with the intact right carotid artery of WT mice and as a trend compared with sham procedure (injured: 20.7±1.3 Bq/cm(3) versus intact: 2.3±0.5 Bq/cm(3); P=0.028 versus sham: 12.7±1.7 Bq/cm(3); P=0.068). Results were confirmed by ex vivo histology and in vivo MRI with elastin-specific MR contrast agent that measures plaque burden and vessel wall remodeling. Higher R1 relaxation rates were found in the injured carotid wall with a T1 mapping sequence (injured: 1.44±0.08 s(-1) versus intact: 0.91±0.02 s(-1); P=0.028 versus sham: 0.97±0.05 s(-1); P=0.068) and in the aortic arch of ApoE(-/-) mice compared with WT mice (ApoE(-/-): 1.49±0.05 s(-1) versus WT: 0.92±0.04 s

A Scientific Calculator for Exact Real Number Computation Based on LRT, GMP and FC++

Directory of Open Access Journals (Sweden)

J. A. Hernández

2012-03-01

Full Text Available Language for Redundant Test (LRT is a programming language for exact real number computation. Its lazy evaluation mechanism (also called call-by-need and its infinite list requirement, make the language appropriate to be implemented in a functional programming language such as Haskell. However, a direction translation of the operational semantics of LRT into Haskell as well as the algorithms to implement basic operations (addition subtraction, multiplication, division and trigonometric functions (sin, cosine, tangent, etc. makes the resulting scientific calculator time consuming and so inefficient. In this paper, we present an alternative implementation of the scientific calculator using FC++ and GMP. FC++ is a functional C++ library while GMP is a GNU multiple presicion library. We show that a direct translation of LRT in FC++ results in a faster scientific calculator than the one presented in Haskell.El lenguaje de verificación redundante (LRT, por sus siglas en inglés es un lenguaje de programación para el cómputo con números reales exactos. Su método de evaluación lazy (o mejor conocido como llamada por necesidad y el manejo de listas infinitas requerido, hace que el lenguaje sea apropiado para su implementación en un lenguaje funcional como Haskell. Sin embargo, la implementación directa de la semántica operacional de LRT en Haskell así como los algoritmos para funciones básicas (suma, resta, multiplicación y división y funciones trigonométricas (seno, coseno, tangente, etc hace que la calculadora científica resultante sea ineficiente. En este artículo, presentamos una implementación alternativa de la calculadora científica usando FC++ y GMP. FC++ es una librería que utiliza el paradigma Funcional en C++ mientras que GMP es una librería GNU de múltiple precisión. En el artículo mostramos que la implementación directa de LRT en FC++ resulta en una librería más eficiente que la implementada en Haskell.

Brain Functional Connectivity is Different during VoluntaryConcentric and Eccentric Muscle Contraction

Directory of Open Access Journals (Sweden)

Wan X Yao

2016-11-01

Full Text Available Previous studies report greater activation in the cortical motor network in controlling eccentric contraction (EC than concentric contraction (CC of human skeletal muscles despite lower activation level of the muscle associated with EC. It is unknown, however, whether the strength of functional coupling between the primary motor cortex (M1 and other involved areas in the brain differs as voluntary movements are controlled by a network of regions in the primary, secondary and association cortices. Examining fMRI-based functional connectivity (FC offers an opportunity to measure strength of such coupling. To address the question, we examined functional MRI (fMRI data acquired during EC and CC (20 contractions each with similar movement distance and speed of the right first dorsal interosseous (FDI muscle in 11 young (20-32 years and healthy individuals and estimated FC between the M1 and a number of cortical regions in the motor control network. The major findings from the behavioral and fMRI-based FC analysis were that (1 no significant differences were seen in movement distance, speed and stability between the EC and CC; (2 significantly stronger mean FC was found for CC than EC. Our finding provides novel insights for a better understanding of the control mechanisms underlying voluntary movements produced by EC and CC. The finding is potentially helpful for guiding the development of targeted sport training and/or therapeutic programs for performance enhancement and injury prevention.

FcγRll: Characterisation of novel Fc receptor interactions and a new receptor form.

OpenAIRE

JESSICA CLAIRE ANANIA

2018-01-01

Leukocyte Fc receptors (FcR) bind to immunogloulins (Ig) to link the innate and humoral immune system to help balance the immune system and clear infections. We have characterised a novel FcR for IgG (FcγR) form, designated FcγRIIa3, which contains a 19 amino acid insert. This insert interacts with cytoskeletal structures allowing the receptor to be retained for longer periods of time at the cells surface upon activation, higher cell signalling which causes greater cellular activation. Theref...

Human FcγRIIA induces anaphylactic and allergic reactions.

Science.gov (United States)

Jönsson, Friederike; Mancardi, David A; Zhao, Wei; Kita, Yoshihiro; Iannascoli, Bruno; Khun, Huot; van Rooijen, Nico; Shimizu, Takao; Schwartz, Lawrence B; Daëron, Marc; Bruhns, Pierre

2012-03-15

IgE and IgE receptors (FcεRI) are well-known inducers of allergy. We recently found in mice that active systemic anaphylaxis depends on IgG and IgG receptors (FcγRIIIA and FcγRIV) expressed by neutrophils, rather than on IgE and FcεRI expressed by mast cells and basophils. In humans, neutrophils, mast cells, basophils, and eosinophils do not express FcγRIIIA or FcγRIV, but FcγRIIA. We therefore investigated the possible role of FcγRIIA in allergy by generating novel FcγRIIA-transgenic mice, in which various models of allergic reactions induced by IgG could be studied. In mice, FcγRIIA was sufficient to trigger active and passive anaphylaxis, and airway inflammation in vivo. Blocking FcγRIIA in vivo abolished these reactions. We identified mast cells to be responsible for FcγRIIA-dependent passive cutaneous anaphylaxis, and monocytes/macrophages and neutrophils to be responsible for FcγRIIA-dependent passive systemic anaphylaxis. Supporting these findings, human mast cells, monocytes and neutrophils produced anaphylactogenic mediators after FcγRIIA engagement. IgG and FcγRIIA may therefore contribute to allergic and anaphylactic reactions in humans.

FcεRI γ-Chain Negatively Modulates Dectin-1 Responses in Dendritic Cells

Directory of Open Access Journals (Sweden)

Yi-Gen Pan

2017-10-01

Full Text Available The inhibitory effect of immunoreceptor tyrosine-based activation motif (ITAM-containing adapters DAP12 and FcεRI γ-chain (FcRγ has been found in many immune functions. Herein, we have further explored the role of these adapters in C-type lectin receptors response. We identified that FcRγ, but not DAP12, could negatively regulate the Dectin-1 responses in dendritic cells (DCs. Loss of FcRγ or both DAP12 and FcRγ enhanced the maturation and cytokine production in DCs upon Dectin-1 activation compared to normal cells, whereas DCs lacking only DAP12 showed little changes. In addition, increments of T cell activation and T helper 17 polarization induced by FcRγ-deficient DCs were observed both in vitro and in vivo. Examining the Dectin-1 signaling, we revealed that the activations of several signaling molecules were augmented in FcRγ-deficient DCs stimulated with Dectin-1 ligands. Furthermore, we demonstrated that the association of phosphatases SHP-1 and PTEN with FcRγ may contribute to the negative regulation of FcRγ in Dectin-1 activation in DCs. These results extend the inhibitory effect of ITAM-containing adapters to Dectin-1 response in immune functions, even though Dectin-1 contains an ITAM-like intracellular domain. According to the role of Dectin-1 in responding to microbes and tumor cells, our finding may have applications in the development of vaccine and cancer therapy.

48 CFR 1819.7302 - NASA contract clauses.

Science.gov (United States)

2010-10-01

... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...

Types of contracts and contracting procedures

International Nuclear Information System (INIS)

Zijl, N.A. van

1977-01-01

Contracting for a nuclear power plant can be carried out in many different ways, from a bilateral agreement between two countries to an international open bidding competition. Also the kind of contracts (turnkey, split-package or multi-contract type) are discussed with their pros and cons as well as the contracting procedures which can be followed to come to the conclusion of a contract. (orig.) [de

Processing and characterization of AlCoFeNiXTi{sub 0,5} (X = Mn, V) high entropy alloys; Processamento e caracterizacao de ligas de alta entropia AlCoFeNixTi{sub 0,5} (X = Mn, V)

Energy Technology Data Exchange (ETDEWEB)

Triveno Rios, C., E-mail: carlos.triveno@ufabc.edu.br [Universidade Federal do ABC (CECS/UFABC), Santo Andre, SP (Brazil). Engenharia de Materiais; Lopes, E.S.N.; Caram, R. [Universidade Estadual de Campinas (FEM/DEMA/UNICAMP), Campinas, SP (Brazil); Kiminami, C.S. [Universidade Federal de Sao Carlos (DEMa/UFSCar), Sao Carlos, SP (Brazil). Departamento de Engenharia de Materiais

2014-07-01

The microstructure of high entropy alloys consists of solid solution phases with FC and BCC simple structures, contrary to classical metallurgy where they form complex structures of intermetallic compounds. Because of this they have several attractive properties for engineering applications. In this work the AlCoFeNiMnTi{sub 0,5} and AlCoFeNiVTi{sub 0,5} alloys were processed by melting arc. Since the main objective was the microstructural and mechanical characterization of ingots as-cast. The alloys were characterized by scanning electron microscopy, X-ray diffraction, microhardness and cold compression test. The results showed that the microstructure consists mainly of dendrites and interdendritic regions consisting of metastable crystalline phases. It was also observed that the AlCoFeNiVTi{sub 0,5} alloy showed better mechanical properties than the AlCoFeNiMnTi{sub 0,5} alloy. This may be associated with differences in the parameters of formation of simple solid solution phases between the two alloys. (author)

Fuel cell based integrated and distributed energy applications (FC-IDEA)

International Nuclear Information System (INIS)

Kotak, D.B.; Wu, S.; Fleetwood, M.S.; Tamoto, H.

2004-01-01

'Full text:' The commercial success of fuel cells will depend upon their adaptation to mobile (e.g., cars, wheelchairs, mopeds, bicycles), stationary (e.g., remote or distributed power), and portable energy applications. Typically such applications are capital intensive and involve a lot of unknowns given that they use new and emergent technology. Also many applications (e.g., hydrogen fuelling station) can be achieved using different technologies and 'pathways'. Thus it is important that a full assessment of possible alternatives be carried out taking into consideration factors such as: capital, operating and maintenance costs; equipment performance, utilization, reliability and scalability; effectiveness to meet the energy demand. NRC is developing a generic software tool which industry experts can use to facilitate assessment of alternative solutions to fulfill the energy requirements for their specific application. We call this tool FC-IDEA (Fuel Cell-based Integrated and Distributed Energy Applications). The system has the following key components: - A Web-based Human-Machine Interface designed for the industry expert to configure and assess alternative designs and operational approaches to satisfy their energy needs (e.g., hydrogen demand profile for a fuelling station, electricity demand profile for a stationary power application); - A Comprehensive Database containing the performance characteristics of energy devices (e.g., electrolysers, hydrogen storage tanks, compressors, dispensers, fuel cells, reformers) that may be used to configure the required application; - A Simulation Model capable of representing the physical system in full 3D to enable ' what-if' analysis of design and operational alternatives and measuring such parameters as performance, utilization, failure and maintenance, shift schedules, and costs. Using this system the expert would be able to configure alternative energy nodes (e.g., remote power) consisting of energy devices. Similarly

Endurance race equines performance fed diets with oil levels Desempenho de equinos submetidos a enduro alimentados com níveis de óleo de soja na dieta

Directory of Open Access Journals (Sweden)

José Correa de Lacerda Neto

2009-06-01

Full Text Available In order to study the endurance equine performance, experimental diets composed by five increasing soybean oil levels (control, 6, 12, 18, 24% of the concentrate were given. The following variables were analyzed: lactate concentration (LA, Glucose (GL, Cardiac frequency (FC and rectal temperature (TR. Twenty Arabian horses were used, 9.5 ±5.5 years old, weight 400 ± 30 kg, undergone to an 80 Km endurance race simulation in a treadmill. The endurance was divided in four rings (phases with 20 km each. There was no effect (p>0.05 of the oil addition but there was an effect (P<0.05 of distance on the LA, TR, GL variables. For the FC variable, we observed the effect (p<0.05 of the soybean addition and the distance. The soybean oil addition upper than 6% in the concentrate maintained lower the cardiac frequency, favoring the endurance horse performance. This lower cardiac frequency could suggest that animal lasted longer time in aerobic metabolism, situation that was confirmed by the non exponential increase in the lactate concentration and the increase in the glucose concentration. The oil favored the endurance horse performance.Com o objetivo de estudar o desempenho de cavalos de enduro, foram fornecidas dietas compostas por cinco níveis crescentes de óleo de soja (controle – sem adição de óleo, 6, 12, 18 e 24% do concentrado. As seguintes variáveis foram analisadas: concentração de lactato sangüíneo (LA, glicemia (GL, freqüência cardíaca (FC e temperatura retal (TR. Foram utilizados 20 eqüinos da raça Árabe, idades 9,5 ±5,5 anos, pesos de 400 ± 30 kg, submetidos à simulação de prova de enduro de 80 km em esteira rolante. O enduro foi dividido em quatro anéis (fases de 20 km cada. Não foi observado efeito (p>0,05 da adição de óleo de soja, porém observou-se efeito (p<0,05 da distância percorrida sobre as variáveis LA, TR e GL. Para a variável FC foi observado efeito (p<0,05 da distância percorrida bem como da adi

19 CFR 12.100 - Importations in good faith; common or contract carriage.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Importations in good faith; common or contract... Importations in good faith; common or contract carriage. (a) Exportation in lieu of seizure. Upon a claim that the importer acted in good faith without knowledge of applicable laws and regulations, Customs...

Fc-mediated immune precipitation. III. Visualization by electron microscopy

DEFF Research Database (Denmark)

Møller, NPH; Christiansen, Gunna

1983-01-01

with either rabbit anti-KLH IgG or anti-KLH F(ab')2 fragments. The Fc-Fc interactions were investigated by reacting these surface-adsorbed antibody-rich KLH immune complexes with soluble, antigen-rich ferritin-anti-ferritin complexes using either rabbit anti-ferritin IgG or the corresponding isomolar F(ab')2...... fragments as antibody. Fc-Fc interactions were indicated by the formation of clusters or ring structures of ferritin molecules, which were only seen when using KLH anti-KLH IgG and ferritin-anti-ferritin IgG complexes. When F(ab')2 fragments were used as antibody, no reaction between KLH anti-KLH complexes...

INTENSIDAD DE LA MUSICA: EFECTO SOBRE LA FRECUENCIA CARDIACA Y EL ESFUERZO PERCIBIDO DURANTE LA ACTIVIDAD FISICA

Directory of Open Access Journals (Sweden)

Jorge Marín Hernández

2001-12-01

Full Text Available La música ha sido ampliamente utilizada en la práctica de ejercicios aeróbicos en la industria deportiva. El propósito de este estudio fue comparar el efecto de diferentes intensidades de la música sobre la frecuencia cardiaca (FC y el esfuerzo percibido (EP durante ejercicio estandarizado en un cicloergómetro. 13 hombres y 5 mujeres voluntarios, físicamente activos (edad 20.6 ± 2.2 años realizaron una prueba bajo tres condiciones en diferentes días, asignadas en un diseño contrabalanceado de medidas repetidas: no música (NM, música a 70 dB, (M70 y música a 85 dB (M85. Ellos se ejercitaron por 20 min. con una carga de trabajo constante predeterminada y equivalente al 80% de su FCMax (kp = 1.47 ± 0.4, 90 rev/min. La música utilizada fue del tipo 'Merengue House' en español con un tempo de 131 ± 4.30 bpm, las diferentes intensidades fueron calibradas con un sonómetro. La FC y el EP fueron registrados a los 10 y 20 min. con un monitor de FC Polar y la escala EP-15 de Borg. Prueba FC 10 min. FC 20 min. EP 10 min. EP 20 min. NM 164.78 ± 8.37 172.11 ± 8.54 12.06 ±1.92 13.78 ±2.58 M70 165.11 ±11.16 173.00 ±12.05 12.00 ±2.11 13.56 ±2.89 M85 163.00 ± 7.58 170.17 ± 7.87 11.50 ±1.55 12.94 ±2.07 Tanto para FC como para EP un ANOVA 3 x 2 con medidas repetidas indicó que los promedios a los 20 min. fueron significativamente mayores que a los 10 min. (p<0.05. Las diferencias en FC y EP entre las tres condiciones no fueron significativas (p >0.05. Los resultados indican que los rangos de intensidades de música estudiados M70 y M85 no produjeron un efecto sobre el EP y la FC cuando se realizó ejercicio estandarizado en un cicloergómetro comparado con una condición sin música NM.

24 CFR 983.206 - HAP contract amendments (to add or substitute contract units).

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HAP contract amendments (to add or... Contract § 983.206 HAP contract amendments (to add or substitute contract units). (a) Amendment to substitute contract units. At the discretion of the PHA and subject to all PBV requirements, the HAP contract...

Influência do uso do forno de microondas ou convencional na síntese de ZrO2 Influence of the use of microwave oven or conventional furnace on the synthesis of ZrO2

Directory of Open Access Journals (Sweden)

V. dos Santos

2008-12-01

Full Text Available O presente trabalho tem como objetivo descrever a síntese de óxido de zircônio, variando as condições de síntese com o uso de forno convencional (FC ou forno de microondas (FM, através do método Pechini. As características estruturais dos óxidos sintetizados foram determinadas por difração de raios X, infravermelho e análises térmicas. As propriedades morfológicas foram determinadas por microscopia eletrônica de varredura com emissão de campo e por isotermas de adsorção/desorção. O uso de FM ou FC, ou o uso de ambos para um mesmo óxido (FM + FC ou FC + FM apresentaram uma grande influência sobre o grau de cristalinidade dos materiais sintetizados.The present work deals with the synthesis of zirconium oxide under varying conditions of synthesis using conventional furnace (CF or microwave oven (MO, by the Pechini method. This study was carried out with the primary aim of studying the possible influence of the above parameters as synthesis variables on the structural and morphologic properties of ZrO2. The structural characteristics of the synthesized oxides were determined by X-ray diffractio, infrared and thermal analysis. The morphologic properties were determined by FEG-SEM and isothermal gas adsorption/desorption. The use of MO or CF, or both for the same oxide (MO+CF or CF+MO has great influence on the degree of crystallinity of the synthesized materials.

46 CFR 9.7 - Rate for Sunday or holiday services.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Rate for Sunday or holiday services. 9.7 Section 9.7... COMPENSATION FOR OVERTIME SERVICES § 9.7 Rate for Sunday or holiday services. The rate of extra compensation for Sunday or holiday services is hereby fixed at twice the gross daily rate of regular pay of the...

Field flow fractionation for assessing neonatal Fc receptor and Fcγ receptor binding to monoclonal antibodies in solution.

Science.gov (United States)

Pollastrini, Joey; Dillon, Thomas M; Bondarenko, Pavel; Chou, Robert Y-T

2011-07-01

Analysis of the strength and stoichiometry of immunoglobulin G (IgG) binding to neonatal Fc receptor (FcRn) and Fcγ receptor (FcγR) is important for evaluating the pharmacokinetics and effector functions of therapeutic monoclonal antibody (mAb) products, respectively. The current standard for assessing FcγR and FcRn binding is composed of cell-based and surface plasmon resonance (SPR) assays. In this work, asymmetrical flow field flow fractionation (AF4) was evaluated to establish the true stoichiometry of IgG binding in solution. AF4 and liquid chromatography-mass spectrometry (LC-MS) were applied to directly observe IgG/FcγR and IgG/FcRn complexes, which were not observed using nonequilibrium size exclusion chromatography (SEC) analysis. Human serum albumin (HSA), an abundant component of human blood and capable of binding FcRn, was studied in combination with FcRn and IgG. AF4 demonstrated that the majority of large complexes of IgG/FcRn/HSA were at an approximate 1:2:1 molar ratio. In addition, affinity measurements of the complex were performed in the sub-micromolar affinity range. A significant decrease in binding was detected for IgG molecules with increased oxidation in the Fc region. AF4 was useful in detecting weak binding between full-length IgG/Fc fragments and Fc receptors and the effect of chemical modifications on binding. AF4 is a useful technique in the assessment of mAb product quality attributes. Copyright © 2011 Elsevier Inc. All rights reserved.

Dicty_cDB: FC-BS11 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS11 (Link to dictyBase) - - - Contig-U16517-1 FC-BS11Z (Li...nk to Original site) - - FC-BS11Z 683 - - - - Show FC-BS11 Library FC (Link to library) Clone ID FC-BS11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS11Q.Seq.d/ Representative seq. ID FC-BS...11Z (Link to Original site) Representative DNA sequence >FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS11Q.Seq....s producing significant alignments: (bits) Value FC-BS11 (FC-BS11Q) /CSM/FC/FC-BS/FC-BS

Dicty_cDB: FC-BS10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS10 (Link to dictyBase) - - - Contig-U16283-1 FC-BS10Z (Li...nk to Original site) - - FC-BS10Z 720 - - - - Show FC-BS10 Library FC (Link to library) Clone ID FC-BS10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS10Q.Seq.d/ Representative seq. ID FC-BS...10Z (Link to Original site) Representative DNA sequence >FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq.d/

Dicty_cDB: FC-BS21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS21 (Link to dictyBase) - - - Contig-U15764-1 FC-BS21Z (Li...nk to Original site) - - FC-BS21Z 723 - - - - Show FC-BS21 Library FC (Link to library) Clone ID FC-BS21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS21Q.Seq.d/ Representative seq. ID FC-BS...21Z (Link to Original site) Representative DNA sequence >FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.Seq.... Score E Sequences producing significant alignments: (bits) Value FC-BS21 (FC-BS21Q) /CSM/FC/FC-BS/FC-BS21Q.

Dicty_cDB: FC-BS19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS19 (Link to dictyBase) - - - Contig-U16583-1 FC-BS19E (Li...nk to Original site) - - - - - - FC-BS19E 604 Show FC-BS19 Library FC (Link to library) Clone ID FC-BS19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS19Q.Seq.d/ Representative seq. ID FC-BS...19E (Link to Original site) Representative DNA sequence >FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS19 (FC-BS19Q) /CSM/FC/FC-BS/FC-BS19Q.Seq.d/

Dicty_cDB: FC-AI01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

Dicty_cDB: FC-BS09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS09 (Link to dictyBase) - - - Contig-U16215-1 FC-BS09Z (Li...nk to Original site) - - FC-BS09Z 626 - - - - Show FC-BS09 Library FC (Link to library) Clone ID FC-BS09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS09Q.Seq.d/ Representative seq. ID FC-BS...09Z (Link to Original site) Representative DNA sequence >FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS09Q.Seq....ignments: (bits) Value SSF360 (SSF360Q) /CSM/SS/SSF3-C/SSF360Q.Seq.d/ 854 0.0 FC-BS09 (FC-BS09Q) /CSM/FC/FC-BS/FC-BS

Dicty_cDB: FC-AI13 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

46 CFR 190.05-1 - Application.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 190.05-1 Section 190.05-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS CONSTRUCTION AND ARRANGEMENT General Fire Protection § 190.05-1 Application. (a) The provisions of this subpart shall apply to...

Dicty_cDB: FC-BR23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2

Dicty_cDB: FC-BS14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS14 (Link to dictyBase) - - - Contig-U16399-1 FC-BS14E (Li...nk to Original site) - - - - - - FC-BS14E 534 Show FC-BS14 Library FC (Link to library) Clone ID FC-BS14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS14Q.Seq.d/ Representative seq. ID FC-BS...14E (Link to Original site) Representative DNA sequence >FC-BS14 (FC-BS14Q) /CSM/FC/FC-BS/FC-BS14Q.Seq.... vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BS14 (FC-BS

Dicty_cDB: FC-AI17 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

Dicty_cDB: FC-AI18 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

Dicty_cDB: FC-AI04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

Dicty_cDB: FC-AI10 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Dicty_cDB: FC-AI21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

Gasoline Biodesulfurization DE-FC07-97ID13570 FINAL REPORT

Energy Technology Data Exchange (ETDEWEB)

Pienkos, Philip T.

2002-01-15

Nine strains were identified to grow with gasoline as sole sulfur source. Two different genes were cloned from Gordonia terrae KGB1 and tested for the ability to support gasoline BDS. The first of these, fmoA, was cloned by screening a KGB1 gene library for the ability to convert indole to indigo (a sulfur-regulated capability in KGB1). The fmoA gene was overexpressed in a gasoline tolerant strain of Pseudomonas putida PpG1 and the recombinant strain was shown to convert thiophene to a dimer of thiophene sulfoxide at rates nearly two orders of magnitude higher than KGB1 could catalyze the reaction. Despite this high activity the recombinant PpG1 was unable to demonstrate any activity against gasoline either in shake flask or in bench-scale gasoline BDS bioreactor. A second gene (toeA) was cloned from KGB1 and shown to support growth of Rhodococcus erythropolis JB55 on gasoline. The toeA gene was also identified in another gasoline strain T. wratislaviensis EMT4, and was identified as a homolog of dszA from R. erythropolis IGTS8. Expression of this gene in JB55 supported conversion of DBTO2 (the natural substrate for DszA) to HPBS, but activity against gasoline was low and BDS results were inconsistent. It appeared that activity was directed against C2- and C3-thiophenes. Efforts to increase gene expression by plasmid manipulation, by addition of flavin reductase genes, or by expression in PpG1 were unsuccessful. The DszC protein (DBT monooxygenase) from IGTS8 has very little activity against the sulfur compounds in gasoline, but a mutant enzyme with a substitution of phenylalanine for valine at position 261 was shown to have an altered substrate range. This alteration resulted in increased activity against gasoline, with activity towards mainly C3- and C4-thiophenes and benzothiophene. A mutant library of dszB was constructed by RACHITT (W. C. Coco et al., DNA shuffling method for generating highly recombined genes and evolved enzymes. 2001. Nature Biotech. 19

Revisiting Field Capacity (FC: variation of definition of FC and its estimation from pedotransfer functions

Directory of Open Access Journals (Sweden)

Theophilo Benedicto Ottoni Filho

2014-12-01

Full Text Available Taking into account the nature of the hydrological processes involved in in situ measurement of Field Capacity (FC, this study proposes a variation of the definition of FC aiming not only at minimizing the inadequacies of its determination, but also at maintaining its original, practical meaning. Analysis of FC data for 22 Brazilian soils and additional FC data from the literature, all measured according to the proposed definition, which is based on a 48-h drainage time after infiltration by shallow ponding, indicates a weak dependency on the amount of infiltrated water, antecedent moisture level, soil morphology, and the level of the groundwater table, but a strong dependency on basic soil properties. The dependence on basic soil properties allowed determination of FC of the 22 soil profiles by pedotransfer functions (PTFs using the input variables usually adopted in prediction of soil water retention. Among the input variables, soil moisture content θ (6 kPa had the greatest impact. Indeed, a linear PTF based only on it resulted in an FC with a root mean squared residue less than 0.04 m³ m-3 for most soils individually. Such a PTF proved to be a better FC predictor than the traditional method of using moisture content at an arbitrary suction. Our FC data were compatible with an equivalent and broader USA database found in the literature, mainly for medium-texture soil samples. One reason for differences between FCs of the two data sets of fine-textured soils is due to their different drainage times. Thus, a standardized procedure for in situ determination of FC is recommended.

Dicty_cDB: FC-AI03 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

The effect of FcγRIIA and FcγRIIB on coronary artery lesion formation and intravenous immunoglobulin treatment responses in children with Kawasaki disease

Science.gov (United States)

Chang, Ling-Sai; Lo, Mao-Hung; Li, Sung-Chou; Yang, Ming-Yu; Hsieh, Kai-Sheng; Kuo, Ho-Chang

2017-01-01

Previous research has found patients with the FcγRIIIB NA1 variant having increased risk of intravenous immunoglobulin (IVIG) resistance in Kawasaki disease (KD). Our previous studies revealed that elevated FcγRIIA expression correlated with the susceptibility of KD patients. We conducted this research to determine whether and how Fcγ receptors affect the susceptibility, IVIG treatment response, and coronary artery lesions (CAL) of KD patients. The activating FcγRIIA and inhibitory FcγRIIB methylation levels of seven patients with KD and four control subjects were examined using HumanMethylation27 BeadChip. We enrolled a total of 44 KD patients and 10 control subjects with fevers. We performed real-time RT-PCR to determine the FcγRIIA and FcγRIIB expression levels, as well as a luciferase assay of FcγRIIA. We found a considerable increase in methylation of both FcγRIIA and FcγRIIB in KD patients undergoing IVIG treatment. Promoter methylation of FcγRIIA inhibited reporter activity in K562 cells using luciferase assay. The FcγRIIB mRNA expression levels were not found to increase susceptibility, CAL formation, or IVIG resistance. FcγRIIA mRNA expression levels were significantly higher in IVIG-resistant patients than in those that responded to IVIG during the pre-treatment period. Furthermore, the FcγRIIA/IIB mRNA expression ratio was considerably higher in KD patients with CAL than in those without CAL. FcγRIIA and FcγRIIB both demonstrated increased methylation levels in KD patients that underwent IVIG treatment. FcγRIIA expression influenced the IVIG treatment response of KD patients. The FcγRIIA/IIB mRNA expression ratio was greater in KD patients with CAL formation. PMID:27893416

Dicty_cDB: FC-AI12 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

Dicty_cDB: FC-AI19 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

Dicty_cDB: FC-AI14 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

Dicty_cDB: FC-AI06 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

Dicty_cDB: FC-AI09 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

Una aplicación de opciones reales a la valoración de contratos de leasing An application of real options to the assessment of leasing contracts

Directory of Open Access Journals (Sweden)

Mónica Andrea Arango Arango

2009-07-01

Full Text Available Este artículo es el resultado de una investigación que desarrolla un modelo para la determinación del canon de arrendamiento en un contrato de leasing sobre vehículos, incluyendo la valoración de la opción de compra implícita en éste. Para realizar esta valoración se utilizaron como base los modelos propuestos por Giaccotto et al. [1] y Gamba y Rigon [2] (en tres marcas de vehículos en Colombia para el período comprendido entre Enero de 2004 y Diciembre de 2007. Se identificó el proceso ARMA de las series de los retornos de los precios de los vehículos. Se realizaron pruebas para identificar posibles efectos ARCH en las series de los retornos de los precios de los vehículos analizados. La estimación del valor de la opción de compra del vehículo al finalizar el contrato de leasing se realiza mediante la implementación del modelo de black-scholes y de simulación Monte Carlo.This article is the result of a research that develops a model related to the determination of the rent on a leasing vehicle contract and the valuation of the call option that gives the lessee the right but not the obligation to buy the used car at the end of the contract at a specified price. We used models proposed by [1] and by [2] in three brands of vehicles in Colombia for the period between January of 2004 and December of 2007. The analysis of the time series of returns of the prices vehicles displayed an ARMA process. We also developed further tests to identify possible ARCH effects in the series of returns of prices of the vehicles analyzed. The estimation of the value of the option to purchase the vehicle at the end of the leasing contract is done by the implementation of the model of Black Scholes and Montecarlo Simulation.

Substratos renováveis na produção de mudas de Ficus enormis proveniente de jardim clonal

Directory of Open Access Journals (Sweden)

Rosimeri de Oliveira Fragoso

2017-01-01

Full Text Available Objetivou-se avaliar substratos renováveis à base de casca de arroz carbonizada (CAC e fibra de coco (FC sobre o enraizamento e qualidade final de mudas de Ficus enormis Mart. ex Miq. via estaquia caulinar de plantas provenientes de jardim clonal. Foram avaliados seis substratos: comercial (controle, composto por casca de arroz carbonizada (CAC, fibra de coco (FC e vermiculita (S1; 100% FC (S2; 100% CAC (S3; 50% FC e 50% CAC (S4; 30% (FC e 70% CAC (S5; 70% FC e 30% CAC (S6. O substrato comercial (S1 e as composições com maior proporção de FC apresentam qualificação superior para a produção de mudas de F. enormis.

Dicty_cDB: FC-AI15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

Dicty_cDB: FC-AI24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

Influencia de la relación velocidad de corte-avance en la calidad superficial de muestras taladradas de fibra de carbono

Directory of Open Access Journals (Sweden)

Álvarez, M.

2005-12-01

Full Text Available The industrial applications of Carbon Fiber (CF have increased in the last years. Particularly, in the aerospace industry, these materials are usually drilled because of the assembly requirements of the structural elements of airships. However, drilling of CF can be accompanied of troubles such as delaminations, lost of surface quality and quick wear of cutting tool. In this work, a study on the surface quality of CF drilled samples as a function of the cutting parameters has been achieved.

En los últimos años, la fibra de carbono (FC encuentra, cada vez, más aplicaciones en los distintos sectores industriales. En el caso particular de la industria aeronáutica, este tipo de materiales se somete frecuentemente a operaciones de taladrado formando parte de estructuras híbridas PC/substrato metálico, debido a las necesidades de montaje en los elementos estructurales de una aeronave. Sin embargo, en el taladrado de FC se puede presentar una serie de problemas como las delaminaciones, la pérdida de calidad en el acabado superficial o el desgaste rápido y excesivo de la herramienta de corte. En este trabajo se lleva a cabo un primer estudio de la calidad de acabado superficial obtenida en muestras de FC taladradas en función de las condiciones de corte impuestas.

Live visualization of genomic loci with BiFC-TALE.

Science.gov (United States)

Hu, Huan; Zhang, Hongmin; Wang, Sheng; Ding, Miao; An, Hui; Hou, Yingping; Yang, Xiaojing; Wei, Wensheng; Sun, Yujie; Tang, Chao

2017-01-11

Tracking the dynamics of genomic loci is important for understanding the mechanisms of fundamental intracellular processes. However, fluorescent labeling and imaging of such loci in live cells have been challenging. One of the major reasons is the low signal-to-background ratio (SBR) of images mainly caused by the background fluorescence from diffuse full-length fluorescent proteins (FPs) in the living nucleus, hampering the application of live cell genomic labeling methods. Here, combining bimolecular fluorescence complementation (BiFC) and transcription activator-like effector (TALE) technologies, we developed a novel method for labeling genomic loci (BiFC-TALE), which largely reduces the background fluorescence level. Using BiFC-TALE, we demonstrated a significantly improved SBR by imaging telomeres and centromeres in living cells in comparison with the methods using full-length FP.

Role of activatory Fc gamma RI and Fc gamma RIII and inhibitory Fc gamma RII in inflammation and cartilage destruction during experimental antigen-induced arthritis.

NARCIS (Netherlands)

Lent, P.L.E.M. van; Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Sloetjes, A.W.; Putte, L.B.A. van de; Verbeek, S.; Berg, W.B. van den

2001-01-01

IgG-containing immune complexes, which are found in most RA joints, communicate with hematopoietic cells using three classes of Fc receptors(Fc gamma RI, -II, -III). In a previous study we found that if a chronic T-cell-mediated antigen-induced arthritis (AIA) was elicited in knee joints of FcR

Dicty_cDB: FC-AI08 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

Dicty_cDB: FC-BR21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BR21 (Link to dictyBase) - - - Contig-U15384-1 | Contig-U16443-1 FC-BR2...1P (Link to Original site) FC-BR21F 551 FC-BR21Z 122 FC-BR21P 673 - - Show FC-BR21 Library FC (L...ink to library) Clone ID FC-BR21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Cont...ig-U15384-1 | Contig-U16443-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR2...1Q.Seq.d/ Representative seq. ID FC-BR21P (Link to Original site) Representative DNA sequence >FC-BR21 (FC-BR2

Dicty_cDB: FC-AI07 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

Dicty_cDB: FC-AI22 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

Copyright or Contract?

Science.gov (United States)

Okerson, Ann

1997-01-01

Most authors and publishers of electronic information believe that current copyright law does not address technical capabilities or reader uses and have turned to contracts or licenses to define the rights of owners and users. Discusses copyrights, fair use, and licenses and highlights licensing's unresolved issues: use and users; archiving;…

Temporary labour contracts

CERN Document Server

1999-01-01

The five contracts for Temporary Labour assignments on the CERN site (L020/PE, L021/PE, L022/PE, L023/PE and L024/PE) approved by the Finance Committee in March 1996 (CERN/FC/3857) will reach the end of their initial three-year contractual period at the end of December 1999. Following the satisfactory execution of these contracts during this period, CERN requests approval to extend them from January 2000 for the first of the two years foreseen in the original adjudication. The Finance Committee is invited: - to take note that the three-year expenditure for Temporary Labour contracts from 1997 to 1999 will not exceed 19 100 000 Swiss francs, compared to the 18 900 000 Swiss francs estimated at the time of the adjudication in March 1996; - to approve an extension of the present Temporary Labour contracts for the year 2000 for a total amount not exceeding 6 000 000 Swiss francs.

Cross-Linking GPVI-Fc by Anti-Fc Antibodies Potentiates Its Inhibition of Atherosclerotic Plaque- and Collagen-Induced Platelet Activation

Directory of Open Access Journals (Sweden)

Janina Jamasbi, RPh

2016-04-01

Full Text Available To enhance the antithrombotic properties of recombinant glycoprotein VI fragment crystallizable (GPVI-Fc, the authors incubated GPVI-Fc with anti-human Fc antibodies to cross-link the Fc tails of GPVI-Fc. Cross-linking potentiated the inhibition of human plaque- and collagen-induced platelet aggregation by GPVI-Fc under static and flow conditions without increasing bleeding time in vitro. Cross-linking with anti-human-Fc Fab2 was even superior to anti-human-Fc immunoglobulin G (IgG. Advanced optical imaging revealed a continuous sheath-like coverage of collagen fibers by cross-linked GPVI-Fc complexes. Cross-linking of GPVI into oligomeric complexes provides a new, highly effective, and probably safe antithrombotic treatment as it suppresses platelet GPVI-plaque interaction selectively at the site of acute atherothrombosis.

The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.

Science.gov (United States)

Abdiche, Yasmina Noubia; Yeung, Yik Andy; Chaparro-Riggers, Javier; Barman, Ishita; Strop, Pavel; Chin, Sherman Michael; Pham, Amber; Bolton, Gary; McDonough, Dan; Lindquist, Kevin; Pons, Jaume; Rajpal, Arvind

2015-01-01

The neonatal Fc receptor (FcRn) is expressed by cells of epithelial, endothelial and myeloid lineages and performs multiple roles in adaptive immunity. Characterizing the FcRn/IgG interaction is fundamental to designing therapeutic antibodies because IgGs with moderately increased binding affinities for FcRn exhibit superior serum half-lives and efficacy. It has been hypothesized that 2 FcRn molecules bind an IgG homodimer with disparate affinities, yet their affinity constants are inconsistent across the literature. Using surface plasmon resonance biosensor assays that eliminated confounding experimental artifacts, we present data supporting an alternate hypothesis: 2 FcRn molecules saturate an IgG homodimer with identical affinities at independent sites, consistent with the symmetrical arrangement of the FcRn/Fc complex observed in the crystal structure published by Burmeister et al. in 1994. We find that human FcRn binds human IgG1 with an equilibrium dissociation constant (KD) of 760 ± 60 nM (N = 14) at 25°C and pH 5.8, and shows less than 25% variation across the other human subtypes. Human IgG1 binds cynomolgus monkey FcRn with a 2-fold higher affinity than human FcRn, and binds both mouse and rat FcRn with a 10-fold higher affinity than human FcRn. FcRn/IgG interactions from multiple species show less than a 2-fold weaker affinity at 37°C than at 25°C and appear independent of an IgG's variable region. Our in vivo data in mouse and rat models demonstrate that both affinity and avidity influence an IgG's serum half-life, which should be considered when choosing animals, especially transgenic systems, as surrogates.

Valor nutritivo de silagens de capim-elefante emurchecido ou com adição de farelo de cacau Nutritive value of elephantgrass silage wilted or with addition of cocoa meal

Directory of Open Access Journals (Sweden)

Gleidson Giordano Pinto de Carvalho

2007-10-01

Full Text Available O experimento foi conduzido para avaliar o valor nutritivo da silagem de capim-elefante produzida com o capim emurchecido ou adicionada de diferentes níveis de farelo de cacau. O capim-elefante foi colhido aos 50 dias de rebrota após o corte de uniformização e submetido aos seguintes tratamentos na ensilagem: capim-elefante emurchecido ao sol por 8 horas, e capim-elefante sem emurchecimento com 0, 7, 14, 21 e 28% de farelo de cacau (FC (% da matéria natural. Foram utilizadas quatro repetições por tratamento; o material foi acondicionado em silos de PVC com 0,15 m de diâmetro e 0,3 m de altura, adotando-se compactação de 500 kg/m³. A inclusão do farelo de cacau na ensilagem do capim-elefante mostrou-se eficiente em aumentar o teor de MS da silagem. A inclusão de FC no nível de 7% permitiu produção de silagem com teor de MS semelhante ao da silagem de capim emurchecido. As silagens com FC apresentaram maiores teores de NT, EE, lignina, NIDN e NIDA, no entanto, os teores de FDN, FDA CEL, HEM, cinzas e NDT e a DIVMS diminuíram com a adição de farelo de cacau. O NDT estimado para a silagem de capim emurchecido foi superior ao obtido nas demais silagens, com e sem farelo de cacau. Embora o FC tenha promovido redução da DIVMS, sua inclusão nos níveis de 7 e 14% proporcionou boa digestibilidade das silagens (acima de 60%. O emurchecimento do capim-elefante e a adição de FC podem ser alternativas para aumentar o teor de MS da silagem e garantir a produção de silagens de bom valor nutritivo.The experiment was carried out to evaluate the nutritive value of elephant grass silage wilted under the sun light for eight hours. Other treatments involved the same elephant grass without exposing to sun light but with addition of 0, 7, 14, 21, and 28% of cocoa meal (CM at the ensilage process. The PVC silos used in the experiment measured 0.15 m of diameter and 0.30 m of height. During the ensiling process the forage was compressed until

48 CFR 52.222-52 - Exemption from Application of the Service Contract Act to Contracts for Certain Services...

Science.gov (United States)

2010-10-01

... of the Service Contract Act to Contracts for Certain Services-Certification. 52.222-52 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Certification. As... Contract Act to Contracts for Certain Services—Certification (NOV 2007) (a) The offeror shall check the...

48 CFR 52.222-53 - Exemption from Application of the Service Contract Act to Contracts for Certain Services...

Science.gov (United States)

2010-10-01

... of the Service Contract Act to Contracts for Certain Services-Requirements. 52.222-53 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Requirements. As... Act to Contracts for Certain Services—Requirements (FEB 2009) (a) The services under this contract are...

Immunoglobulin Fc receptors in clinical strains of Staphylococcus aureus do not confer resistance to Phagocytosis in an in vitro assay Los receptores Fc para inmunoglobulinas en cepas clínicas de Staphylococcus aureus no confieren resistencia a la fagocitosis in vitro

Directory of Open Access Journals (Sweden)

Benito VEGA

1999-05-01

Full Text Available Staphylococcus aureus binds Immunoglobulin G (IgG on its external surface due to the presence of specific receptors for the Fc domain of this immunoglobulin. This mechanism represents a kind of camouflage against phagocytic cells. In order to confirm that possibility an in vitro evaluation of the phagocytic activity of leukocytes polymorpho-nuclear (PMN against strains of Staphylococcus aureus was done, comparing 18 strains isolated from clinical samples and 16 from healthy individuals. The presence of Fc receptors was evaluated by haemagglutination (HA with erythrocytes group A after incubation of the strains with IgG anti blood group A. Phagocytosis of S. aureus was carried out by mixing live bacteria with a suspension of human PMN and incubating at 37 °C for 1 h; survivors were counted as colony forming units by plating. The strains from clinical specimens showed higher HA than those from healthy individuals (p = 0.01; but the former were killed more efficiently than the latter (80-90% and 40%, respectively. It is may be possible that S. aureus showed different behavior in vivo, where could express other virulence factors to prevent the action of phagocytes.Staphylococcus aureus liga inmunoglobulinas G (IgG a su superficie externa debido a la presencia de receptores para el dominio Fc de esas inmunoglobulinas. Este mecanismo representa una clase de camuflage contra células fagocíticas. Para confirmar tal posibilidad se realizó una evaluación in vitro de la actividad fagocítica de leucocitos polimorfonucleares (PMN contra cepas de Staphylococcus aureus, comparando 18 cepas aisladas de casos clínicos y 16 de individuos sanos. La presencia de receptores fue evaluada por hemaglutinación (HA con eritrocitos grupo A luego que las cepas fueron incubadas con IgG anti grupo sanguíneo A. La fagocitosis de S. aureus fue realizada mezclando células vivas con una suspensión de PMN e incubada a 37 °C por una hora; las bacterias sobrevivientes

Condutividade e teste quantitativo coulométrico na triagem neonatal para fibrose cística

Directory of Open Access Journals (Sweden)

Mouseline Torquato Domingos

2015-12-01

Full Text Available Resumo Objetivo Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém0nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos O teste do suor foi feito simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60 mmol/L. Resultados Fizeram o teste do suor por condutividade e dosagem coulométrica simultaneamente 444 RN sem FC (185 do sexo masculino, 234 do feminino e 24 não informado e obtiveram resultado mediano de 32 mmol/L e 12 mmol/L respectivamente. Para os noventa RN com FC os valores medianos de condutividade e dosagem coulométrica foram 108 mmol/L e 97 mmol/L respectivamente. O índice de falso positivo para condutividade foi de 16,7% e em todos os pacientes FC foi superior a 50 mmol/L, o que confere ao método 100% de sensibilidade (IC 95% = 93,8 a 97,8, especificidade de 96,2% (IC 95% = 93,8 a 97,8, valor preditivo positivo 83,3 (IC 95% = 74,4 a 91,1, valor preditivo negativo 100% (IC 95% = 90,5 a 109,4 e acurácia 9,8%. A correlação entre os métodos foi de r = 0,97 (p > 0,001.O melhor valor de corte sugerido foi de 69,0 mmol/L, coeficiente de kappa = 0,89. Conclusão O teste da condutividade apresentou excelente correlação com o quantitativo coulométrico, alta sensibilidade e especificidade e pode ser usado no diagnóstico da FC em crianças detectadas pela triagem neonatal.

O efeito do destreinamento de força muscular em meninos pré-púberes El efecto del desentrenamiento muscular en niños pre-puberes Effect of the muscular strength detraining in prepubertal boys

Directory of Open Access Journals (Sweden)

Andrea Silveira da Fontoura

2004-08-01

Full Text Available A treinabilidade da força em crianças tem sido bem explorada, mas ainda existe um questionamento a respeito de como a força diminui quando elas param de treinar. O objetivo deste estudo foi avaliar o efeito de 12 semanas de destreino na força muscular de meninos treinados por 12 semanas. Sete meninos pré-púberes (EX, 9,4 ± 1,6 anos treinaram três séries de 15 repetições, três vezes por semana, por 12 semanas. O treinamento foi supervisionado e desenvolvido em equipamentos; consistiu de oito exercícios, incluindo extensão de joelhos (EJ e flexão de cotovelos (FC. O teste de 1-RM de EJ e FC foi feito antes e após o treinamento e após 12 semanas de destreinamento. Um grupo similar de meninos (n = 7, 9,7 ± 1,7 anos, que não treinou, serviu como grupo controle (CO. Após o treinamento o grupo EX aumentou (p 0,05. Quando corrigida pelo peso corporal e pela massa corporal magra (MCM, 1-RM de EJ diminuiu significativamente (p El entrenamiento de la fuerza en niños ha sido bien explorada, mas existe en la actualidad un cuestionamiento al respecto de como la fuerza disminuye cuando los mismos paran de entrenar. El objetivo de este estudio fue evaluar el efecto del desentrenamiento de 12 semanas sobre la fuerza muscular en niños entrenados por 12 semanas. Siete niños pre-púberes (EX, 9,4 ± 1,6 años entrenaron tres series de 15 repeticiones, tres veces por semana, por 12 semanas. El entrenamiento fué supervisado y desarrollado en equipamientos, consistió de ocho ejercicios, incluyendo extensión de los codos (EJ y la flexión de las rodillas (FC. El test de 1-RM de EJ y FC fué hecho antes y después del entrenamiento y después de 12 semanas de desentrenamiento. Un grupo similar de niños (n = 7, 9,7 ± 1,7 años, que no entrenó sirvió como grupo control (CO. Después del entrenamiento el grupo EX aumentó (p 0,05. Cuando fue corregido por el peso corporal y por la masa corporal magra (MCM, 1-RM de EJ disminuy

FC-TLBO: fully constrained meta-heuristic algorithm for abundance ...

Indian Academy of Sciences (India)

Omprakash Tembhurne

hyperspectral unmixing; meta-heuristic approach; teaching-learning-based optimisation (TLBO). 1. ... area of research due to its real-time applications. Satellite .... describes the detailed methodology of proposed FC-TLBO. Section 4 contains ...

26 CFR 1.471-10 - Applicability of long-term contract methods.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 6 2010-04-01 2010-04-01 false Applicability of long-term contract methods. 1... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Inventories § 1.471-10 Applicability of long-term contract methods. See § 1.460-2 for rules providing for the application of the long-term contract methods to...

Optimization on Fc for Improvement of Stability and Aggregation Resistance.

Science.gov (United States)

Chen, Xiaobo; Zeng, Fang; Huang, Tao; Cheng, Liang; Liu, Huan; Gong, Rui

2016-01-01

Fc-based therapeutics including therapeutic full-size monoclonal antibodies (mAbs) and Fcfusion proteins represent fastest-growing market in biopharmaceutical industrial. However, one major challenge during development of Fc-based therapeutics is how to maintain their efficacy in clinic use. Many factors may lead to failure in final marketing. For example, the stability and aggregation resistance might not be high enough for bearing the disadvantages during fermentation, purification, formulation, storage, shipment and other steps in manufacture and sale. Low stability and high aggregation tendency lead to decreased bioactivity and increased risk of immunogenicity resulting in serious side effect. Because Fc is one of the major parts in monoclonal antibodies and Fc-fusion proteins, engineering of Fc to increase its stability and reduce or eliminate aggregation due to incorrect association are of great importance and could further extend the potential of Fc-based therapeutics. Lots of studies focus on Fc optimization for better physical and chemical characteristics and function by structured-based computer-aid rational design, high-throughput screening expression system selection and other methods. The identification of optimized Fc mutants increases the clinic potential of currently existed therapeutics mAbs and Fc-fusion proteins, and accelerates the development of new Fc-based therapeutics. Here we provide an overview of the related field, and discuss recent advances and future directions in optimization of Fc-based therapeutics with modified stability and aggregation resistance. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

Fc-Binding Ligands of Immunoglobulin G: An Overview of High Affinity Proteins and Peptides

Directory of Open Access Journals (Sweden)

Weonu Choe

2016-12-01

Full Text Available The rapidly increasing application of antibodies has inspired the development of several novel methods to isolate and target antibodies using smart biomaterials that mimic the binding of Fc-receptors to antibodies. The Fc-binding domain of antibodies is the primary binding site for e.g., effector proteins and secondary antibodies, whereas antigens bind to the Fab region. Protein A, G, and L, surface proteins expressed by pathogenic bacteria, are well known to bind immunoglobulin and have been widely exploited in antibody purification strategies. Several difficulties are encountered when bacterial proteins are used in antibody research and application. One of the major obstacles hampering the use of bacterial proteins is sample contamination with trace amounts of these proteins, which can invoke an immune response in the host. Many research groups actively develop synthetic ligands that are able to selectively and strongly bind to antibodies. Among the reported ligands, peptides that bind to the Fc-domain of antibodies are attractive tools in antibody research. Besides their use as high affinity ligands in antibody purification chromatography, Fc-binding peptides are applied e.g., to localize antibodies on nanomaterials and to increase the half-life of proteins in serum. In this review, recent developments of Fc-binding peptides are presented and their binding characteristics and diverse applications are discussed.

Desempenho de perus de corte alimentados com níveis crescentes de aflatoxinas, com ou sem adição de adsorvente Turkey performance fed with increasing aflatoxins levels, with or without adsorvent inclusion

Directory of Open Access Journals (Sweden)

Janio Morais Santurio

1998-03-01

Full Text Available Este trabalho foi realizado durante o verão de 1995/96 com o objetivo de determinar o nível de aflatoxinas (AFL capaz de causar prejuízos no desempenho de perus de corte criados sob condições ambientais de baixo desafio, bem como avaliar a eficácia da adição de bentonita sódica natural (BSN como um adsorvente. Foram utilizados 1008 perus de corte, alojados em 84 boxes seguindo um delineamento experimental de blocos casualizados com 14 tratamentos distribuídos em um arranjo fatorial 7x2, sendo 7 níveis de adição de AFL, (0, 10, 50, 100, 500, 1000 e 2000ppb e 2 níveis de adição de BSN (0 e 0,5%. Aos 21 dias de idade, as aves alimentadas com as dietas sem adição de BSN mostraram uma redução significativa (PThis experiment was carried out in the 1995/96 summer to determine the aflatoxin (AFL levels ability to decrease turkey performance raised under excellent environmental conditions and also to avaluate a natural sodium bentonite (NSB efficiency as an adsorbent. One thousand and eight poults were housed in 84 floor pens following a randomized complete block design with 14 treatments arranged in a 7x2 factorial, with 7 AFL levels (0, 10, 50, 100, 500, 1000 and 2000ppb and 2 NSB levels (0 and 0.5%. At 21 days of age the birds fed without NSB showed body weight gain (BWG and feed intake (FI reduction (P<0.05 from 500ppb or more of AFL, whereas the birds fed with NSB showed BWG and FI reduction (P<0.05 only from 1000ppb or more of AFL. These same results were observed at 40 days of age, but at 70 days, the BWG and FI reduction was statistically significant (P<0.05 from 500ppb or more of AFL, with or without NSB inclusion. In general, birds fed with NSB had about 15 to 20% less BWG and FI reduction than birds fed without NSB. The feed conversion (FC was less affected by AFL levels, although it worsened with increasing AFL levels. AFL have greatly affected the mortality rate. At 21 days of age the birds fed with 1000 and 2000pbb of

Quantitative application study on the control system of contract progress

International Nuclear Information System (INIS)

Hu Xiaocong; Kang Rujie; Zhan Li

2012-01-01

Quantitative application study on the control system of contract progress, which is based on project management theory and PDCA cycle methods, provides a new way for the contract business management of enterprise, in line with the current situation and the nuclear power enterprise performance management needs. The concept of the system, system development, program design and development of ERP (VBA design) which come from the work experience summary of business managers are convenient and feasible in practical applications. By way of the applications in 2009, 2010, 2011 three-year overhaul contract management and continuous adjustment it has become an important business management tool, which not only effectively guaranteed the contract time and efficiency, but also combines the performance management and contract progress management. This study has provided useful reference for the enterprise management. (authors)

Cholecystokinin (CCK) functional cholescintigraphy (FC) in patients suspected of acalculous biliary disease (ABD)

International Nuclear Information System (INIS)

Fink-Bennett, D.; De Ridder, P.; Kolozsi, W.; Gordon, R.; Rapp, J.

1984-01-01

To determine if CCK FC can aid in the diagnosis (Dx.) of ABD, the authors retrospectively analyzed the max. gallbladder (GB) ejection fraction response (EFR) to CCK in 240 patients (pts.) with persistent symptoms of biliary colic, a normal GB Ultrasound exam and/or OCG. Each pt. (NPO after 12 A.M.) received 5 mCi of technetium (Tc)-99 Hepatolite. After max GB filling, .02 μg/kg CCK was administered (1-3 minutes) I.V. Background corrected GB EFs were determined q.5 min x4 by ratioing the pre-CCK GB cts. minus post-CCK GB cts. to pre-CCK GB cts. In 131/240 pts. the max. GBEFR was 35%. Eleven underwent surgery, 98 medical Rx. 4/11 Cx. apts had CAC, 7 were normal. Of the 98 medical Rx. pts. 21 lack followup, 71 are clinically felt not to have ABD; 6 are felt to have ABD. CCK FC appears to be a useful test for the detection of ABD. Its predictive value (GBEF <35%) in Cx. pts. is 97%; in all pts. (assuming medical Rx. correct), 94% (sensitivity - 91%, specificity - 93%)

Generation and Characterization of an IgG4 Monomeric Fc Platform.

Directory of Open Access Journals (Sweden)

Lu Shan

Full Text Available The immunoglobulin Fc region is a homodimer consisted of two sets of CH2 and CH3 domains and has been exploited to generate two-arm protein fusions with high expression yields, simplified purification processes and extended serum half-life. However, attempts to generate one-arm fusion proteins with monomeric Fc, with one set of CH2 and CH3 domains, are often plagued with challenges such as weakened binding to FcRn or partial monomer formation. Here, we demonstrate the generation of a stable IgG4 Fc monomer with a unique combination of mutations at the CH3-CH3 interface using rational design combined with in vitro evolution methodologies. In addition to size-exclusion chromatography and analytical ultracentrifugation, we used multi-angle light scattering (MALS to show that the engineered Fc monomer exhibits excellent monodispersity. Furthermore, crystal structure analysis (PDB ID: 5HVW reveals monomeric properties supported by disrupted interactions at the CH3-CH3 interface. Monomeric Fc fusions with Fab or scFv achieved FcRn binding and serum half-life comparable to wildtype IgG. These results demonstrate that this monomeric IgG4 Fc is a promising therapeutic platform to extend the serum half-life of proteins in a monovalent format.

Qualidade da carne de marreco pequim branco (Anas Platyrhynchos platyrhynchos L. 1758 comparado a frango de corte Meat quality in white peking mallard (Anas Platyrhynchos platyrhynchos L. 1758 compared to broiler chicken

Directory of Open Access Journals (Sweden)

Peter Bitencourt Faria

2008-02-01

Full Text Available O total de 20 carcaças resfriadas (10 Marrecos Pequim Branco e 10 de frangos de corte foi submetido às análises de composição centesimal, colesterol, cor (sistema CIE L*a*b*, perda de peso por cozimento (PPC e força de cisalhamento (FC. A carne de marreco apresenta (PTwenty refrigerated carcasses (10 Peking mallard and 10 broiler chicken were submitted to analyses of chemical composition, cholesterol, colour (CIE L*a*b* system, weight loss by cooking (PPC and shear force (FC. Mallard meat had lower (P<0.05 humidity in both leg and breast (71.77 and 74.53%, respectively when compared with chicken meat (74.73 and 76.07%, respectively. When different cuts were compared, the breast had a higher (P<0.05 humidity and protein content than the leg in both species. Mallard leg and breast had lower (P<0.05 lightness (37.59 and 35.75, respectively and higher red content (18.48 and 20.67, respectively, than the lightness (40.98 and 45.18, respectively and red content (10.02 and 5.52, respectively observed in chicken. The FC was higher (P<0.05 in mallard breast (4.90 kgf than in chicken breast (2.63 kgf. Meat from White Peking mallard is darker and with a stronger red pigment than meat from broiler chicken. Even though it is less tender than meat from broiler chicken, mallard meat still has an acceptable tenderness.

High Efficiency Advanced Lightweight Fuel Cell (HEAL-FC), Phase I

Data.gov (United States)

National Aeronautics and Space Administration — Infinity's High Efficiency Advanced Lightweight Fuel Cell (HEAL FC) is an improved version of its current fuel cell technology developed for space applications. The...

Analytical FcRn affinity chromatography for functional characterization of monoclonal antibodies

Science.gov (United States)

Schlothauer, Tilman; Rueger, Petra; Stracke, Jan Olaf; Hertenberger, Hubert; Fingas, Felix; Kling, Lothar; Emrich, Thomas; Drabner, Georg; Seeber, Stefan; Auer, Johannes; Koch, Stefan; Papadimitriou, Apollon

2013-01-01

The neonatal Fc receptor (FcRn) is important for the metabolic fate of IgG antibodies in vivo. Analysis of the interaction between FcRn and IgG in vitro might provide insight into the structural and functional integrity of therapeutic IgG that may affect pharmacokinetics (PK) in vivo. We developed a standardized pH gradient FcRn affinity liquid chromatography method with conditions closely resembling the physiological mechanism of interaction between IgG and FcRn. This method allows the separation of molecular IgG isoforms, degradation products and engineered molecules based on their affinity to FcRn. Human FcRn was immobilized on the column and a linear pH gradient from pH 5.5 to 8.8 was applied. FcRn chromatography was used in comparison to surface plasmon resonance to characterize different monoclonal IgG preparations, e.g., oxidized or aggregated species. Wild-type and engineered IgGs were compared in vitro by FcRn chromatography and in vivo by PK studies in huFcRn transgenic mice. Analytical FcRn chromatography allows differentiation of IgG samples and variants by peak pattern and retention time profile. The method can distinguish: 1) IgGs with different Fabs, 2) oxidized from native IgG, 3) aggregates from monomer and 4) antibodies with mutations in the Fc part from wild-type IgGs. Changes in the FcRn chromatographic behavior of mutant IgGs relative to the wild-type IgG correlate to changes in the PK profile in the FcRn transgenic mice. These results demonstrate that FcRn affinity chromatography is a useful new method for the assessment of IgG integrity. PMID:23765230

Fc-specific biotinylation of antibody using an engineered photoactivatable Z–Biotin and its biosensing application

International Nuclear Information System (INIS)

Yang, Hong-Ming; Bao, Ru-Meng; Yu, Chang-Mei; Lv, Yan-Na; Zhang, Wei-Fen; Tang, Jin-Bao

2017-01-01

The development of a site-specific and covalent attachment methodology is crucial for antibody–biotin conjugates to preserve the antigen-binding ability of antibodies and yield homogeneous products. In this study, an engineered photoactivatable Z-domain variant [an UV-active amino acid benzoylphenylalanine (Bpa) was genetically incorporated into the Z-domain] carrying one biotin molecule (Z_B_p_a–Biotin) was prepared by employing aminoacyl-tRNA synthetase/suppressor tRNA and Avitag/BirA techniques. The site-specific and covalent attachment of IgG–biotin conjugates, viz. photo-biotinylated IgG, was successfully achieved after UV exposure by combining the inherent Fc-binding capability of the Z-domain with the formation of covalent bond by the photo-crosslinker. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis assay showed that more than 90% of IgGs conjugated with Z_B_p_a–Biotin molecules suffered 3 h UV irradiation. Further pepsin digestion analysis confirmed that the Z_B_p_a–Biotin was conjugated to the Fc fragment of IgG without interference. We took the tumor biomarker carcinoembryoic antigen (CEA) as model to evaluate the detection efficiency of the site-specific photo-biotinylated IgG in biosensing application using surface plasmon resonance (SPR) technology. The photo-biotinylated IgG coated surface gave a limit of detection (LOD) of 2 ng mL"-"1, is 5-fold lower than that of the randomly NHS-biotinylated IgG (10 ng mL"-"1). Given that the (strept)avidin–biotin complex is extensively used in immunoassays, the proposed method for biotinylated IgG provides a powerful approach to further expand related applications. - Highlights: • A photoactivable Z_B_p_a–Biotin was fabricated by aaRS/tRNA and Avitag/BirA techniques. • A approach for Fc-specific photo-biotinylated IgG via Z_B_p_a–Biotin was proposed. • The photo-biotinylated IgG was used to fabricate an immunosensor for detecting CEA. • It gave a LOD of 2 ng mL"-"1 CEA

Fc-specific biotinylation of antibody using an engineered photoactivatable Z–Biotin and its biosensing application

Energy Technology Data Exchange (ETDEWEB)

Yang, Hong-Ming; Bao, Ru-Meng; Yu, Chang-Mei; Lv, Yan-Na; Zhang, Wei-Fen; Tang, Jin-Bao, E-mail: tangjb@wfmc.edu.cn

2017-01-01

The development of a site-specific and covalent attachment methodology is crucial for antibody–biotin conjugates to preserve the antigen-binding ability of antibodies and yield homogeneous products. In this study, an engineered photoactivatable Z-domain variant [an UV-active amino acid benzoylphenylalanine (Bpa) was genetically incorporated into the Z-domain] carrying one biotin molecule (Z{sub Bpa}–Biotin) was prepared by employing aminoacyl-tRNA synthetase/suppressor tRNA and Avitag/BirA techniques. The site-specific and covalent attachment of IgG–biotin conjugates, viz. photo-biotinylated IgG, was successfully achieved after UV exposure by combining the inherent Fc-binding capability of the Z-domain with the formation of covalent bond by the photo-crosslinker. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis assay showed that more than 90% of IgGs conjugated with Z{sub Bpa}–Biotin molecules suffered 3 h UV irradiation. Further pepsin digestion analysis confirmed that the Z{sub Bpa}–Biotin was conjugated to the Fc fragment of IgG without interference. We took the tumor biomarker carcinoembryoic antigen (CEA) as model to evaluate the detection efficiency of the site-specific photo-biotinylated IgG in biosensing application using surface plasmon resonance (SPR) technology. The photo-biotinylated IgG coated surface gave a limit of detection (LOD) of 2 ng mL{sup -1}, is 5-fold lower than that of the randomly NHS-biotinylated IgG (10 ng mL{sup -1}). Given that the (strept)avidin–biotin complex is extensively used in immunoassays, the proposed method for biotinylated IgG provides a powerful approach to further expand related applications. - Highlights: • A photoactivable Z{sub Bpa}–Biotin was fabricated by aaRS/tRNA and Avitag/BirA techniques. • A approach for Fc-specific photo-biotinylated IgG via Z{sub Bpa}–Biotin was proposed. • The photo-biotinylated IgG was used to fabricate an immunosensor for detecting CEA. • It gave a LOD

Uso de óleo essencial de orégano, salinomicina e bacitracina de zinco na dieta de frangos de corte

Directory of Open Access Journals (Sweden)

Patricia Maria Meneghetti Pulici

2014-09-01

Full Text Available O presente trabalho teve como objetivo avaliar dietas com óleo essencial de orégano, associado ou não com salinomicina, como alternativa à bacitracina de zinco sobre o desempenho zootécnico de frangos de corte. Foram utilizados 600 pintos de um dia de idade, machos, da linhagem Cobb® 500, criados até 42 dias de idade em boxes com cama de casca de arroz providos de comedouros tubulares e bebedouros nipple. O delineamento foi inteiramente casualizado, com seis dietas e 10 repetições de 10 aves cada. As dietas experimentais à base de milho e farelo de soja foram: controle positivo – antibiótico (bacitracina de zinco + 0,05% de anticoccidiano (salinomicina, controle negativo – dieta basal (DB sem aditivos, DB + 0,05% de salinomicina e 0,03% de óleo essencial de orégano (Orego-Stim®, DB + 0,03% de óleo essencial de orégano, DB + 0,05% de salinomicina e 0,05% de óleo essencial de orégano, DB + 0,05% de óleo essencial de orégano. Não foi encontrado efeito da utilização do óleo de orégano até 21 dias no desempenho das aves. Nos demais períodos, aos 35 e 42 dias, o desempenho das aves tratadas com 0,03% de óleo essencial de orégano + salinomicina apresentou resultados semelhantes ao controle positivo, levando à conclusão de que a dose de 0,03% de óleo essencial de orégano + salinomicina pode substituir a bacitracina de zinco + salinomicina em dietas para frangos de corte.

Dicty_cDB: FC-AC21 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

Modulating Cytotoxic Effector Functions by Fc Engineering to Improve Cancer Therapy.

Science.gov (United States)

Kellner, Christian; Otte, Anna; Cappuzzello, Elisa; Klausz, Katja; Peipp, Matthias

2017-09-01

In the last two decades, monoclonal antibodies have revolutionized the therapy of cancer patients. Although antibody therapy has continuously been improved, still a significant number of patients do not benefit from antibody therapy. Therefore, rational optimization of the antibody molecule by Fc engineering represents a major area of translational research to further improve this potent therapeutic option. Monoclonal antibodies are able to trigger a variety of effector mechanisms. Especially Fc-mediated effector functions such as antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement- dependent cytotoxicity (CDC) are considered important in antibody therapy of cancer. Novel mechanistic insights into the action of monoclonal antibodies allowed the development of various Fc engineering approaches to modulate antibodies' effector functions. Strategies in modifying the Fc glycosylation profile (Fc glyco-engineering) or approaches in engineering the protein backbone (Fc protein engineering) have been intensively evaluated. In the current review, Fc engineering strategies resulting in improved ADCC, ADCP and CDC activity are summarized and discussed.

Comparative studies on Fc receptors for IgG on resting and activated T lymphocytes

International Nuclear Information System (INIS)

Hueckel, C.; Jensen, H.L.; Rychly, J.; Sandor, M.; Erdei, A.; Gergely, J.

1986-01-01

Fc-receptors for IgG (FcγR) on resting (i.e. freshly prepared) and mitogen (Con A) or alloantigen-activated mouse spleen T cells were compared using binding of different markers such as 125 I-labelled immune complexes, 125 I-labelled anti FcγR monoclonal antibody, FITC-labelled aggr. IgG and sheep erythrocytes covered with specific antibody (EA rosetting). C3b receptors were detected by rosetting with sheep erythrocytes covered with antibody and complement (EAC rosetting). The electrophoretic mobility of the cells without or after binding of aggr. IgG was also tested. Differences between resting and activated T cells were found: (1) After activation of T cells by mitogen or alloantigen, a proportion of FcγR-positive cells increased two to four times. (2) FcγR number per FcγR-positive cell seemed to be higher on activated then on resting cells. (3) FcγR-positive resting cells did not shed their FcγR upon incubation at 4 0 C followed by incubation at 37 0 C, but FcγR-positive activated cells shed a remarkable proportion of their FcγR on the same conditions. (4) Binding of aggr. IgG caused a decrease of electrophoretic mobility of activated but not resting cells. (5) FcγR-positive resting cells were also C3b receptor-positive, whereas FcγR-positive activated cells had no detectable C3b receptors. (author)

29 CFR 785.4 - Application to Walsh-Healey Public Contracts Act.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Application to Walsh-Healey Public Contracts Act. 785.4... Considerations § 785.4 Application to Walsh-Healey Public Contracts Act. The principles set forth in this part... employees performing work subject to the provisions of the Walsh-Healey Public Contracts Act. [35 FR 15289...

Dicty_cDB: FC-AY04 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AY04 (Link to dictyBase) - - - Contig-U16521-1 FC-AY04Z (Li...nk to Original site) - - FC-AY04Z 583 - - - - Show FC-AY04 Library FC (Link to library) Clone ID FC-AY04 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16521-1 Original site URL http://dict...10 4 CA753827 |AF402814_1 ( AF402814 ) 40S ribosomal protein S6 [Ictalurus puncta...0.00 m_ : 1.00 92.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-AY04 is cyt 5' e

Dicty_cDB: FC-AK01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AK01 (Link to dictyBase) - - - Contig-U15038-1 FC-AK01E (Li...nk to Original site) - - - - - - FC-AK01E 996 Show FC-AK01 Library FC (Link to library) Clone ID FC-AK01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15038-1 Original site URL http://dict...s clone omyk-evn... 172 6e-79 AF401557_1( AF401557 |pid:none) Ictalurus punctatus...reticulum 4.0 %: vacuolar >> prediction for FC-AK01 is mit 5' end seq. ID - 5' end seq. - Length of 5' end s

Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective

Directory of Open Access Journals (Sweden)

Younes Soualhi

2015-12-01

Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.

Gasoline Biodesulfurization DE-FC07-97ID13570 FINAL REPORT; FINAL

International Nuclear Information System (INIS)

Pienkos, Philip T.

2002-01-01

Nine strains were identified to grow with gasoline as sole sulfur source. Two different genes were cloned from Gordonia terrae KGB1 and tested for the ability to support gasoline BDS. The first of these, fmoA, was cloned by screening a KGB1 gene library for the ability to convert indole to indigo (a sulfur-regulated capability in KGB1). The fmoA gene was overexpressed in a gasoline tolerant strain of Pseudomonas putida PpG1 and the recombinant strain was shown to convert thiophene to a dimer of thiophene sulfoxide at rates nearly two orders of magnitude higher than KGB1 could catalyze the reaction. Despite this high activity the recombinant PpG1 was unable to demonstrate any activity against gasoline either in shake flask or in bench-scale gasoline BDS bioreactor. A second gene (toeA) was cloned from KGB1 and shown to support growth of Rhodococcus erythropolis JB55 on gasoline. The toeA gene was also identified in another gasoline strain T. wratislaviensis EMT4, and was identified as a homolog of dszA from R. erythropolis IGTS8. Expression of this gene in JB55 supported conversion of DBTO2 (the natural substrate for DszA) to HPBS, but activity against gasoline was low and BDS results were inconsistent. It appeared that activity was directed against C2- and C3-thiophenes. Efforts to increase gene expression by plasmid manipulation, by addition of flavin reductase genes, or by expression in PpG1 were unsuccessful. The DszC protein (DBT monooxygenase) from IGTS8 has very little activity against the sulfur compounds in gasoline, but a mutant enzyme with a substitution of phenylalanine for valine at position 261 was shown to have an altered substrate range. This alteration resulted in increased activity against gasoline, with activity towards mainly C3- and C4-thiophenes and benzothiophene. A mutant library of dszB was constructed by RACHITT (W. C. Coco et al., DNA shuffling method for generating highly recombined genes and evolved enzymes. 2001. Nature Biotech. 19

Screening of cardiomyocyte fluorescence during cell contraction by multi-dimensional TCSPC

Science.gov (United States)

Chorvat, D., Jr.; Abdulla, S.; Elzwiei, F.; Mateasik, A.; Chorvatova, A.

2008-02-01

Autofluorescence is one of the most versatile non-invasive tools for mapping the metabolic state of living tissues, such as the heart. We present a new approach to the investigation of changes in endogenous fluorescence during cardiomyocyte contraction - by spectrally-resolved, time correlated, single photon counting (TCSPC). Cell contraction is stimulated by external platinum electrodes, incorporated in a home-made bath and triggered by a pulse generator at a frequency of 0.5 Hz (to stabilize sarcoplasmic reticulum loading), or 5 Hz (the rat heart rate). Cell illumination by the laser is synchronized with cell contraction, using TTL logic pulses operated by a stimulator and delayed to study mitochondrial metabolism at maximum contraction (10-110 ms) and/or at steady state (1000-1100 ms at 0.5 Hz). To test the setup, we recorded calcium transients in cells loaded with the Fluo-3 fluorescent probe (excited by 475 nm pulsed picosecond diode laser). We then evaluated recordings of flavin AF (excited by 438 nm pulsed laser) at room and physiological temperatures. Application of the presented approach will shed new insight into metabolic changes in living, contracting myocytes and, therefore, regulation of excitation-contraction coupling and/or ionic homeostasis and, thus, heart excitability.

Dicty_cDB: FC-BF01 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BF01 (Link to dictyBase) - - - Contig-U15105-1 FC-BF01Z (Li...nk to Original site) - - FC-BF01Z 674 - - - - Show FC-BF01 Library FC (Link to library) Clone ID FC-BF01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 260 3e-68 AJ783868_1( AJ783868 |pid:none...lasmic 8.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-BF01 is cyt 5' end seq. ID - 5' end seq. - L

Dicty_cDB: FC-BC16 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BC16 (Link to dictyBase) - - - Contig-U15105-1 FC-BC16Z (Li...nk to Original site) - - FC-BC16Z 620 - - - - Show FC-BC16 Library FC (Link to library) Clone ID FC-BC16 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict...4 2e-66 AY961522_1( AY961522 |pid:none) Lysiphlebus testaceipes ribosomal ... 254 2e-66 AF402813_1( AF402813 |pid:none) Ict...hondrial 4.0 %: nuclear >> prediction for FC-BC16 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq

Supervisory control system based on PC applied to substations automatization of and to regional operation centers of distribution networks; Sistema de control supervisorio basado en PC aplicado en automatizacion de subestaciones y centros de operacion regional de redes de distribucion

Energy Technology Data Exchange (ETDEWEB)

Picasso B, Cuitlahuac [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Astorga Q, Clemente [Luz y Fuerza del Centro (Mexico)

2003-07-01

In order to increase the services quality in the electrical energy, to improve the process of identification of energy losses, to increase the equipment efficiency, to count on more complete statistics of profiles of load consumptions, among other applications, the Compania de Luz y Fuerza del Centro (LyFC) carries out the modernization in automatization of substations and regional operation centers of distribution networks. The technological base to make these programs requires automating the operative schemes of the substation and distribution centers that supervise the events of the electrical process. In this article the main results of the development and integration of master stations based on PC, that were made in the Instituto de Investigaciones Electricas (IIE) and that have been integrated in the electrical company LyFC are presented. [Spanish] Con el proposito de incrementar la calidad de los servicios en la energia electrica, mejorar el proceso de identificacion de perdidas de energia, aumentar la eficiencia de los equipos, contar con estadisticas mas completas de perfiles de consumos de carga, entre otras aplicaciones, la Compania de Luz y Fuerza del Centro (LyFC) lleva a cabo la modernizacion en automatizacion de subestaciones y centros de operacion regional de redes electricas de distribucion. La base tecnologica para realizar estos programas, requiere de automatizar los esquemas operativos de la subestacion y centros de distribucion que supervisan los eventos del proceso electrico. En este articulo se presentan los principales resultados del desarrollo e integracion de estaciones maestras basadas en PC, que se realizaron en el Instituto de Investigaciones Electricas (IIE) y que se han integrado en la compania electrica LyFC.

Fibrose Cística: Análise da Coorte de 10 Anos de um Programa para Adultos

Directory of Open Access Journals (Sweden)

Paulo de Tarso Roth Dalcin

2011-07-01

Full Text Available Introdução: A fibrose cística (FC que já foi considerada doença da criança é agora doença do adulto e requer programa para adultos. Objetivo: definir características clínicas de uma coorte de 10 anos de um programa para adultos com FC e determinar as características associadas com desfechos clínicos. Métodos: coorte retrospectiva de pacientes com FC (idade ≥ 10 anos atendida pelo Programa para Adultos do Hospital de Clínicas de Porto Alegre, de outubro de 1998 a outubro de 2008. Foram coletados dados demográficos, dados clínicos, status nutricional, função pulmonar, testes laboratoriais e microbiologia do escarro. Foram definidos como desfechos clínicos: sobrevivência, sobrevivência com transplante pulmonar e óbito. Resultados: foram atendidos 94 pacientes pelo programa para adultos. A média de idade foi 24,0±7,4 anos e a média do volume expiratório forçado no primeiro segundo (VEF1 foi 56,4±28,8%. Setenta e sete pacientes foram sobreviventes, 6 sobreviventes com transplante pulmonar e 11 morreram. Na análise univariada, etnia caucasiana (p=0,016, mutação F508del (p=0,04, escore clínico (p<0,001, índice de massa corporal (p<0,001,  oxigenoterapia (p<0,001, capacidade vital forçada (p=0,023 e VEF1 (p<0,001 se associaram com os desfechos clínicos. A análise de regressão logística identificou fatores associados com desfecho precário: VEF1 (RC=0,.72, ICI=0,54-0,94, p=0,017 e escore clínico  (RC = 0,70, IC=0,50-0,97, p = 0,034. Insuficiência respiratória crônica exacerbada por infecção respiratória aguda foi causa imediata de morte na maioria dos casos. Conclusão: Este estudo descreveu uma coorte de 94 pacientes com FC atendidos por um programa de adultos. VEF1 e escore clinico se associaram com os desfechos clínicos.

EFECTO DEL ESPESOR EN LAS PROPIEDADES SUPERCONDUCTORAS Y ESTRUCTURALES DE PELÍCULAS DELGADAS DE FeSe0,5Te0,5

Directory of Open Access Journals (Sweden)

Oscar Rodríguez

2012-07-01

Full Text Available En este trabajo se investiga la influencia del espesor de la capa de FeSe0,5Te0,5 en las propiedades cristalinas y superconductoras de las películas depositadas sobre una capa buffer de hierro (Fe en sustratos de MgAl2O4, por el método de deposición por láser pulsado (PLD. El espesor de las capas superconductoras producidas son ~55nm y ~134nm. La película con menor espesor presenta mejores propiedades de textura (crecimiento orientado y una menor rugosidad superficial (RMS; verificadas por difracción de rayos X y AFM respectivamente. Esta misma película presenta una transición marcada al estado superconductor y una mayor temperatura crítica a diferencia de la película de mayor espesor. Se discute el efecto del espesor en las tensiones de la red superconductora.

Contabilización de Contratos de Futuros, Opciones, Forwards y Swaps (Accounting treatment for future, options, forwards and swap contracts

Directory of Open Access Journals (Sweden)

Vernor Mesén Figueroa

2012-12-01

Full Text Available Un entorno cada vez más dinámico y evolutivo ha dado paso al surgimiento y, por ende, al uso cada vez más frecuente de instrumentos financieros cuya flexibilidad y capacidad de ajuste a las condiciones de mercado permitan a las personas y empresas lograr sus objetivos de operación, inversión y financiamiento. En el contexto antes descrito, los contratos de futuros, opciones, forwards y swaps representan mecanismos cuyas características operativas permiten a sus tenedores el logro de objetivos alternativos tales como la cobertura eficaz de diferentes tipos de riesgos o la obtención de ganancias o pérdidas derivadas de la especulación. El presente artículo pretende reseñar, en forma breve, los mecanismos de operación de los contratos de futuros, opciones, forwards y swaps, para luego enfatizar en los criterios de contabilización que toda entidad o intermediario financiero debe seguir para reconocer los efectos que dichos tipos de contratos tienen sobre su posición financiera, resultados de operación y flujos de efectivo.   ABSTRACT A rapidly changing and evolving environment has given rise and increased the use of financial tools whose flexibility and adjusting capabilities to variable market conditions allow individuals and companies to achieve their operating, investment and financial goals. Within this framework, contracts for futures, options, forwards and swaps provide mechanisms with operating characteristics that allow their tenants to achieve alternative objectives such as the effective coverage of different risks or the attaining of profits or losses as a result of speculation. This article attempts to resume the operating mechanisms of futures, options, forwards and swap contracts and then concentrates into the accounting criteria that must be followed by financial intermediaries or entities to recognize the effects such contracts have on their financial position, operational results and cash flow.

HAL/S-FC compiler system specifications

Science.gov (United States)

1976-01-01

This document specifies the informational interfaces within the HAL/S-FC compiler, and between the compiler and the external environment. This Compiler System Specification is for the HAL/S-FC compiler and its associated run time facilities which implement the full HAL/S language. The HAL/S-FC compiler is designed to operate stand-alone on any compatible IBM 360/370 computer and within the Software Development Laboratory (SDL) at NASA/JSC, Houston, Texas.

Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha Tomato seedlings production using substrates with coconut fiber and rock waste

Directory of Open Access Journals (Sweden)

Regynaldo A Sampaio

2008-12-01

Full Text Available Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC e pó de rocha de granito (RG como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC e pó de rocha de granito (RG: T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. O cultivo foi feito em bandeja de poliestireno expandido com células de 3,5 x 3,5 x 5,0 cm. Foram avaliados o diâmetro do coleto, a altura da planta, o índice de velocidade de emergência, a percentagem de emergência e a massa fresca e seca da parte aérea e da raiz. Em praticamente todas as características avaliadas o substrato comercial foi superior aos substratos contendo fibra de coco e pó de rocha. Considerando-se apenas os substratos contendo fibra de coco e pó de rocha, as mudas com melhores características foram obtidas com a mistura de aproximadamente 70% em volume de fibra de coco.A greenhouse experiment was carried out to evaluate the ratio of coconut fiber and rock waste, in the tomato seedling production (cultivar Kada Gigante, in Montes Claros, Brazil. The experimental design was of randomized complete blocks with four replicates. The treatments were composed of a control and six ratios of coconut fiber (FC and rock waste (RG: T1 - Commercial Substrate Hortimix®; T2 - 0% FC + 100% RG; T3 - 20% FC + 80% RG; T4 - 40% FC + 60% RG; T5 - 60% FC + 40% RG; T6 - 80% FC + 20% RG; T7 - 100% FC + 0% RG. The cultivation was done in polystyrene trays with cells of 3.5 x 3.5 x 5,0 cm. Stem diameter, seedling height, emergency speed index, emergency percentage, root and aerial part of fresh and dry matter were evaluated. In

75 FR 52528 - FC Landfill Energy, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

Science.gov (United States)

2010-08-26

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER10-2268-000] FC Landfill Energy, LLC; Supplemental Notice That Initial Market- Based Rate Filing Includes Request for Blanket... proceeding, of FC Landfill Energy, LLC's application for market-based rate authority, with an accompanying...

Dicty_cDB: FC-IC0102 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC-IC (Link to library) FC-IC0102 (Link to dictyBase) - - - Contig-U16527-1 FC-IC01...02F (Link to Original site) FC-IC0102F 434 - - - - - - Show FC-IC0102 Library FC-IC (Link to library) Clone ...ID FC-IC0102 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dict... (bits) Value N AB088483 |AB088483.1 Dictyostelium discoideum gene for gamete and mating-type specific prote...oducing significant alignments: (bits) Value AB088483_1( AB088483 |pid:none) Dictyostelium discoideum gmsA g

Assessing the Heterogeneity of the Fc-Glycan of a Therapeutic Antibody Using an engineered FcγReceptor IIIa-Immobilized Column.

Science.gov (United States)

Kiyoshi, Masato; Caaveiro, Jose M M; Tada, Minoru; Tamura, Hiroko; Tanaka, Toru; Terao, Yosuke; Morante, Koldo; Harazono, Akira; Hashii, Noritaka; Shibata, Hiroko; Kuroda, Daisuke; Nagatoishi, Satoru; Oe, Seigo; Ide, Teruhiko; Tsumoto, Kouhei; Ishii-Watabe, Akiko

2018-03-02

The N-glycan moiety of IgG-Fc has a significant impact on multifaceted properties of antibodies such as in their effector function, structure, and stability. Numerous studies have been devoted to understanding its biological effect since the exact composition of the Fc N-glycan modulates the magnitude of effector functions such as the antibody-dependent cell mediated cytotoxicity (ADCC), and the complement-dependent cytotoxicity (CDC). To date, systematic analyses of the properties and influence of glycan variants have been of great interest. Understanding the principles on how N-glycosylation modulates those properties is important for the molecular design, manufacturing, process optimization, and quality control of therapeutic antibodies. In this study, we have separated a model therapeutic antibody into three fractions according to the composition of the N-glycan by using a novel FcγRIIIa chromatography column. Notably, Fc galactosylation was a major factor influencing the affinity of IgG-Fc to the FcγRIIIa immobilized on the column. Each antibody fraction was employed for structural, biological, and physicochemical analysis, illustrating the mechanism by which galactose modulates the affinity to FcγRIIIa. In addition, we discuss the benefits of the FcγRIIIa chromatography column to assess the heterogeneity of the N-glycan.

Cultura Organizacional e Gestão de Equipes de Alto Rendimento: Os Casos FC Barcelona, Sporting Club de Portugal e AFC Ajax

Directory of Open Access Journals (Sweden)

Ary José Rocco Júnior

2015-01-01

Full Text Available 800x600 Em todo o mundo, a chamada Indústria do Esporte vêm experimentando vertiginoso crescimento financeiro. Com isso, o papel das agremiações esportivas adquiriu especial importância dentro da sociedade contemporânea global. A relevância do planejamento estratégico dessas organizações fez crescer a necessidade dos clubes esportivos investirem em estratégias que permitam o seu correto posicionamento no mercado e as suas conquistas no campo esportivo. A implantação e o desenvolvimento de uma cultura organizacional que permita o desenvolvimento de uma identidade do clube que agregue todos os seus stakeholders – atletas, torcedores, patrocinadores, marcas, investidores e outros -, é uma dessas estratégias. A criação estratégica e planejada de valores e princípios organizacionais que equilibrem resultados econômicos, mercadológicos e financeiros, com a performance esportiva, colabora para o desenvolvimento e implantação de uma cultura, que gera receita e traz conquistas no campo esportivo. O objetivo deste artigo é analisar três casos de sucesso – FC Barcelona, da Espanha; Sporting Club de Portugal; e, AFC Ajax, da Holanda -, de organizações esportivas que implantaram estratégias dessa natureza na Europa. Pretendemos, com isso, estimular agremiações esportivas do Brasil a adotarem estratégias semelhantes. Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4

Dicty_cDB: FC-BS24 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BS24 (Link to dictyBase) - - - Contig-U16209-1 FC-BS24Z (Li...nk to Original site) - - FC-BS24Z 721 - - - - Show FC-BS24 Library FC (Link to library) Clone ID FC-BS24 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...nce. 52 9e-12 4 BQ096846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ict...N SA ;, mRNA sequence. 44 1e-10 4 BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDN

Postneonatal Mortality and Liver Changes in Cloned Pigs Associated with Human Tumor Necrosis Factor Receptor I-Fc and Human Heme Oxygenase-1 Overexpression

Directory of Open Access Journals (Sweden)

Geon A. Kim

2017-01-01

Full Text Available Soluble human tumor necrosis factor (shTNFRI-Fc and human heme oxygenase 1 (hHO-1 are key regulators for protection against oxidative and inflammatory injury for xenotransplantation. Somatic cells with more than 10 copy numbers of shTNFRI-Fc and hHO-1 were employed in somatic cell nuclear transfer to generate cloned pigs, thereby resulting in seven cloned piglets. However, produced piglets were all dead within 24 hours after birth. Obviously, postnatal death with liver apoptosis was reported in the higher copy number of shTNFRI-Fc and hHO-1 piglets. In liver, the transcript levels of ferritin heavy chain, light chain, transferrin, and inducible nitric oxide synthase were significantly highly expressed compared to those of lower copy number of shTNFRI-Fc and hHO-1 piglets (P<0.05. Also, H2O2 contents were increased, and superoxide dismutase was significantly lower in the higher copy number of shTNFRI-Fc and hHO-1 piglets (P<0.05. These results indicate that TNFRI-Fc and hHO-1 overexpression may apparently induce free iron in the liver and exert oxidative stress by enhancing reactive oxygen species production and block normal postneonatal liver metabolism.

Fc-specific biotinylation of antibody using an engineered photoactivatable Z-Biotin and its biosensing application.

Science.gov (United States)

Yang, Hong-Ming; Bao, Ru-Meng; Yu, Chang-Mei; Lv, Yan-Na; Zhang, Wei-Fen; Tang, Jin-Bao

2017-01-01

The development of a site-specific and covalent attachment methodology is crucial for antibody-biotin conjugates to preserve the antigen-binding ability of antibodies and yield homogeneous products. In this study, an engineered photoactivatable Z-domain variant [an UV-active amino acid benzoylphenylalanine (Bpa) was genetically incorporated into the Z-domain] carrying one biotin molecule (Z Bpa -Biotin) was prepared by employing aminoacyl-tRNA synthetase/suppressor tRNA and Avitag/BirA techniques. The site-specific and covalent attachment of IgG-biotin conjugates, viz. photo-biotinylated IgG, was successfully achieved after UV exposure by combining the inherent Fc-binding capability of the Z-domain with the formation of covalent bond by the photo-crosslinker. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis assay showed that more than 90% of IgGs conjugated with Z Bpa -Biotin molecules suffered 3 h UV irradiation. Further pepsin digestion analysis confirmed that the Z Bpa -Biotin was conjugated to the Fc fragment of IgG without interference. We took the tumor biomarker carcinoembryoic antigen (CEA) as model to evaluate the detection efficiency of the site-specific photo-biotinylated IgG in biosensing application using surface plasmon resonance (SPR) technology. The photo-biotinylated IgG coated surface gave a limit of detection (LOD) of 2 ng mL -1 , is 5-fold lower than that of the randomly NHS-biotinylated IgG (10 ng mL -1 ). Given that the (strept)avidin-biotin complex is extensively used in immunoassays, the proposed method for biotinylated IgG provides a powerful approach to further expand related applications. Copyright © 2016 Elsevier B.V. All rights reserved.

Produção de mudas de tomateiro em substratos contendo fibra de coco e pó de rocha

OpenAIRE

Sampaio,Regynaldo A; Ramos,Sílvio J; Guilherme,Denílson O; Costa,Cândido A da; Fernandes,Luiz Arnaldo

2008-01-01

Com o objetivo de avaliar proporções dos resíduos fibra de coco (FC) e pó de rocha de granito (RG) como substratos na produção de mudas de tomateiro, cultivar Kada Gigante, realizou-se um experimento em casa de vegetação na UFMG-ICA. Foi utilizado o delineamento experimental em blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos por uma testemunha e seis proporções de fibra de coco (FC) e pó de rocha de granito (RG): T1 - Substrato comercial Hortimix®; T2 - 0% FC + 100% ...

Grau de moagem dos alimentos em rações para a tilápia do Nilo (Oreochromis niloticus durante o período de reversão sexual - DOI: 10.4025/actascianimsci.v27i1.1245 Milling degree of feed in ration for Nile tilapia (Oreochromis niloticus larvae during sexual reversion phase - DOI: 10.4025/actascianimsci.v27i1.1245

Directory of Open Access Journals (Sweden)

Robie Allan Bombardelli

2005-03-01

Full Text Available O experimento avaliou o efeito de diferentes graus de moagem dos alimentos sobre o desempenho de larvas de tilápia do Nilo no período de reversão sexual. O delineamento experimental foi inteiramente casualizado com 4 tratamentos e 6 repetições. Os tratamentos foram os graus de moagem dos alimentos em peneira de malhas de 0,25; 0,50; 0,70 e 1,00 mm. Utilizou-se uma ração de modo a atender às necessidades nutricionais da espécie. Foram avaliados peso (PFM, comprimento (CFM, ganho de peso diário (GPD, fator de condição (FC e sobrevivência (S. Os dados foram submetidos à ANOVA e, à análise de regressão em caso de evidência de diferença significativa (P = 0,05. Apenas PFM, GPD e FC apresentaram efeito dos tratamentos, mostrando efeito quadrático (P This work evaluated the effect of different milling degree of feeds on Nile tilapia performance during sex reversal period. A completely randomized design with four treatments and six replicates was utilized. The treatments were the milling degree of feed by 0.25, 0.50, 0.70, and 1.00 mm screen. The diets used fulfilled larvae necessity. Data of weight (W, length (L, daily gain weight (DGW, factor condition (FC and survival (S were evaluated. Data were submitted to ANOVA and regression analysis in case of significant difference were detected (P = 0.05. Only W, DGW and FC presented significant difference between treatments, showing a quadratic effect (P < 0.05 and better results to 0.60, 0.60 and 0.63 mm of feed milling degree, respectively. Diet with milling degree of 0.60 mm screen was recommended to Nile tilapia reversion phase

Discussion on the tropospheric concentrations of FC21

Energy Technology Data Exchange (ETDEWEB)

Crescentini, G.; Mangani, F.; Mastrogiamcomo, A.R.; Cappiello, A.; Bruner, F.

1986-01-01

FC21 tropospheric mixing ratios measured in air samples collected at different locations in the world are presented. Results of a campaign carried out at two locations in the Sahara desert where FC21 and FC11 mixing ratios were simultaneously determined in 180 samples are also shown. Though scattered high values have been found, the average background concentration of FC21 ranged between 0 and 1 pptv. 9 references, 1 figure, 2 tables.

Advanced power conversion based on the Aerocapacitor{trademark}. Final report

Energy Technology Data Exchange (ETDEWEB)

Roark, D.

1997-03-05

This report summarizes work performed under contract No. DE-FC07-94ID13283, {open_quotes}Advanced Power Conversion Based on the Aerocapacitors{trademark}.{close_quotes} Under this contract high power density, high energy density, organic electrolyte Aerocapacitors{trademark} were developed and characterized for power conversion applications. Pilot facilities for manufacturing prototype AA-size Aerocapacitors{trademark} were put in place. The low ESR and good frequency response of these devices show that they are ideal components for high discharge rate and low to moderate frequency (< 10 kHz) applications such as power conversion.

Identification of antibody glycosylation structures that predict monoclonal antibody Fc-effector function.

Science.gov (United States)

Chung, Amy W; Crispin, Max; Pritchard, Laura; Robinson, Hannah; Gorny, Miroslaw K; Yu, Xiaojie; Bailey-Kellogg, Chris; Ackerman, Margaret E; Scanlan, Chris; Zolla-Pazner, Susan; Alter, Galit

2014-11-13

To determine monoclonal antibody (mAb) features that predict fragment crystalizable (Fc)-mediated effector functions against HIV. Monoclonal antibodies, derived from Chinese hamster ovary cells or Epstein-Barr virus-immortalized mouse heteromyelomas, with specificity to key regions of the HIV envelope including gp120-V2, gp120-V3 loop, gp120-CD4(+) binding site, and gp41-specific antibodies, were functionally profiled to determine the relative contribution of the variable and constant domain features of the antibodies in driving robust Fc-effector functions. Each mAb was assayed for antibody-binding affinity to gp140(SR162), antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP) and for the ability to bind to FcγRIIa, FcγRIIb and FcγRIIIa receptors. Antibody glycan profiles were determined by HPLC. Neither the specificity nor the affinity of the mAbs determined the potency of Fc-effector function. FcγRIIIa binding strongly predicted ADCC and decreased galactose content inversely correlated with ADCP, whereas N-glycolylneuraminic acid-containing structures exhibited enhanced ADCP. Additionally, the bi-antenary glycan arm onto which galactose was added predicted enhanced binding to FcγRIIIa and ADCC activity, independent of the specificity of the mAb. Our studies point to the specific Fc-glycan structures that can selectively promote Fc-effector functions independently of the antibody specificity. Furthermore, we demonstrated antibody glycan structures associated with enhanced ADCP activity, an emerging Fc-effector function that may aid in the control and clearance of HIV infection.

Debt renegotiation with incomplete contract

Directory of Open Access Journals (Sweden)

Paulo de Melo Jorge Neto

2005-09-01

Full Text Available A debt contract usually does not include a provision about renegotiation. The right to seize the borrower’s asset and the rules of this process are usually stipulated in the contract. Such a promise not to renegotiate is not credible since renegotiation can mitigate the dead-weight loss of liquidating insolvent borrowers. Once the initial contract may not consider the renegotiation procedure and renegotiation may occur, this paper investigates why a complete contract is not offered. It shows that the lender does not need to stipulate the renegotiation procedure on the initial contract because he is indifferent about committing or not to the terms of a contract. This indicates that a complete contract gives the lender the same expected return as an incomplete contract, in which the renegotiation process is determined after the occurrence of default.Um contrato de débito geralmente não inclui uma cláusula sobre renegociação. O direito de liquidar os ativos do tomador e as regras do processo são habitualmente estipuladas no contrato. Tal promessa de não renegociar não é crível, já que a renegociação pode mitigar a perda bruta de se liquidar tomadores insolventes. Uma vez que o contrato inicial pode não considerar os procedimentos de renegociação, e esta pode, de fato, vir a ocorrer, este artigo investiga a razão de um contrato completo não ser ofertado. Mostra-se que o emprestador não precisa estipular os procedimentos de renegociação no contrato inicial porque ele é indiferente entre se comprometer ou não aos termos do contrato. Isto indica que um contrato completo dá ao emprestador o mesmo retorno esperado de um contrato incompleto, no qual os procedimentos de renegociação são determinados após a declaração de default.

Traces of pFc' in IVIG interact with human IgG Fc domains and counteract aggregation

NARCIS (Netherlands)

Rispens, Theo; Himly, Martin; Ooievaar-de Heer, Pleuni; den Bleker, Tamara H.; Aalberse, Rob C.

2010-01-01

To prevent multimer formation, intravenous immunoglobulin (IVIG) is often treated with traces of pepsin. So far, the mechanism behind this treatment has been unclear. Recently, we reported that human IgG4 binds other IgG molecules via Fc-Fc interactions. Here we show that IVIG treated with traces of

Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge

Science.gov (United States)

Konduru, Krishnamurthy; Shurtleff, Amy C.; Bradfute, Steven B.; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo

2016-01-01

Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105−106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support

Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.

Science.gov (United States)

Konduru, Krishnamurthy; Shurtleff, Amy C; Bradfute, Steven B; Nakamura, Siham; Bavari, Sina; Kaplan, Gerardo

2016-01-01

Ebola virus (EBOV), a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP) are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV) GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc) protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC) adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV) pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data further support

Ebolavirus Glycoprotein Fc Fusion Protein Protects Guinea Pigs against Lethal Challenge.

Directory of Open Access Journals (Sweden)

Krishnamurthy Konduru

Full Text Available Ebola virus (EBOV, a member of the Filoviridae that can cause severe hemorrhagic fever in humans and nonhuman primates, poses a significant threat to the public health. Currently, there are no licensed vaccines or therapeutics to prevent and treat EBOV infection. Several vaccines based on the EBOV glycoprotein (GP are under development, including vectored, virus-like particles, and protein-based subunit vaccines. We previously demonstrated that a subunit vaccine containing the extracellular domain of the Ebola ebolavirus (EBOV GP fused to the Fc fragment of human IgG1 (EBOVgp-Fc protected mice against EBOV lethal challenge. Here, we show that the EBOVgp-Fc vaccine formulated with QS-21, alum, or polyinosinic-polycytidylic acid-poly-L-lysine carboxymethylcellulose (poly-ICLC adjuvants induced strong humoral immune responses in guinea pigs. The vaccinated animals developed anti-GP total antibody titers of approximately 105-106 and neutralizing antibody titers of approximately 103 as assessed by a BSL-2 neutralization assay based on vesicular stomatitis virus (VSV pseudotypes. The poly-ICLC formulated EBOVgp-Fc vaccine protected all the guinea pigs against EBOV lethal challenge performed under BSL-4 conditions whereas the same vaccine formulated with QS-21 or alum only induced partial protection. Vaccination with a mucin-deleted EBOVgp-Fc construct formulated with QS-21 adjuvant did not have a significant effect in anti-GP antibody levels and protection against EBOV lethal challenge compared to the full-length GP construct. The bulk of the humoral response induced by the EBOVgp-Fc vaccine was directed against epitopes outside the EBOV mucin region. Our findings indicate that different adjuvants can eliciting varying levels of protection against lethal EBOV challenge in guinea pigs vaccinated with EBOVgp-Fc, and suggest that levels of total anti-GP antibodies elicit by protein-based GP subunit vaccines do not correlate with protection. Our data

Contract Attorneys Course Deskbook. Volume 1

Science.gov (United States)

2007-06-21

included in a contract in violation of statutory or regulatory criteria will be read out of a contract. Empresa de Viacao Terceirense, ASBCA No. 49827...for upward and downward revision of the stated contract price upon the occurrence of specified contingencies. See Transportes Especiales de ...4th Infantry Division, Fort Hood Texas, 2002-2005; Assistant Operations Officer/Test Control Officer, Military Entrance Processing Station, Des

Chicken IgY Fc expressed by Eimeria mitis enhances the immunogenicity of E. mitis.

Science.gov (United States)

Qin, Mei; Tang, Xinming; Yin, Guangwen; Liu, Xianyong; Suo, Jingxia; Tao, Geru; Ei-Ashram, Saeed; Li, Yuan; Suo, Xun

2016-03-21

Eimeria species are obligate intracellular apicomplexan parasites, causing great economic losses in the poultry industry. Currently wild-and attenuated- type anticoccidial vaccines are used to control coccidiosis. However, their use in fast growing broilers is limited by vaccination side effects caused by medium and/or low immunogenic Eimeria spp. There is, therefore, a need for a vaccine with high immunogenicity for broilers. The avian yolk sac IgY Fc is the avian counterpart of the mammalian IgG Fc, which enhances immunogenicity of Fc-fusion proteins. Here, we developed a stable transgenic Eimeria mitis expressing IgY Fc (Emi.chFc) and investigated whether the avian IgY Fc fragment enhances the immunogenicity of E. mitis. Two-week-old broilers were immunized with either Emi.chFc or wild type Eimeria and challenged with wild type E. mitis to analyze the protective properties of transgenic Emi.chFc. Chickens immunized with Emi.chFc had significantly lower oocyst output, in comparison with PBS, mock control (transgenic E. mitis expressing HA1 from H9N2 avian influenza virus) and wildtype E. mitis immunized groups after challenge, indicating that IgY Fc enhanced the immunogenicity of E. mitis. Our findings suggest that IgY Fc-expressing Eimeria may be a better coccidiosis vaccine, and transgenic Eimeria expressing Fc-fused exogenous antigens may be used as a novel vaccine-delivery vehicle against a wide variety of pathogens.

Relevancia de los diferentes momentos del juego y de las acciones a balón parado (ABP en los rendimientos del FC Barcelona y Real Madrid durante la liga nacional de fútbol profesional 2011/12

Directory of Open Access Journals (Sweden)

Xavier Planes i Fontestad

2015-08-01

Full Text Available El estudio se centra en la relevancia de las fases dinámicas y estáticas en los rendimientos del FC Barcelona y Real Madrid. Utilizamos la metodología observacional con el fin de tratar de asociar los diferentes Momentos o Fases del juego (MJ y las Acciones a Balón Parado (ABP con la obtención de cada uno de los goles. Para conseguirlo, hemos creado un instrumento de observación ad hoc (IOX y hemos utilizado dos instrumentos de registro (LINCE y MOTS. Para el análisis de los datos del registro y la obtención de resultados, hemos utilizado las técnicas de comparación de proporciones con el software Statgraphics, habiendo encontrado, inicialmente, diferencias significativas entre los dos equipos únicamente en la fase defensiva.

On the application of copula in modeling maintenance contract

International Nuclear Information System (INIS)

Iskandar, B P; Husniah, H

2016-01-01

This paper deals with the application of copula in maintenance contracts for a nonrepayable item. Failures of the item are modeled using a two dimensional approach where age and usage of the item and this requires a bi-variate distribution to modelling failures. When the item fails then corrective maintenance (CM) is minimally repaired. CM can be outsourced to an external agent or done in house. The decision problem for the owner is to find the maximum total profit whilst for the agent is to determine the optimal price of the contract. We obtain the mathematical models of the decision problems for the owner as well as the agent using a Nash game theory formulation. (paper)

Rapid polyclonal desensitization with antibodies to IgE and FcεRIα.

Science.gov (United States)

Khodoun, Marat V; Kucuk, Zeynep Yesim; Strait, Richard T; Krishnamurthy, Durga; Janek, Kevin; Lewkowich, Ian; Morris, Suzanne C; Finkelman, Fred D

2013-06-01

Rapid desensitization, a procedure in which persons allergic to an antigen are treated at short intervals with increasing doses of that antigen until they tolerate a large dose, is an effective, but risky, way to induce temporary tolerance. We wanted to determine whether this approach can be adapted to suppress all IgE-mediated allergies in mice by injecting serially increasing doses of monoclonal antibodies (mAbs) to IgE or FcεRIα. Active and passive models of antigen- and anti-IgE mAb-induced IgE-mediated anaphylaxis were used. Mice were desensitized with serially increasing doses of anti-IgE mAb, anti-FcεRIα mAb, or antigen. Development of shock (hypothermia), histamine and mast cell protease release, cytokine secretion, calcium flux, and changes in cell number and FcεRI and IgE expression were evaluated. Rapid desensitization with anti-IgE mAb suppressed IgE-mediated immediate hypersensitivity; however, some mice developed mild anaphylaxis during desensitization. Rapid desensitization with anti-FcεRIα mAb that only binds FcεRI that is not occupied by IgE suppressed both active and passive IgE-mediated anaphylaxis without inducing disease. It quickly, but temporarily, suppressed IgE-mediated anaphylaxis by decreasing mast cell signaling through FcεRI, then slowly induced longer lasting mast cell unresponsiveness by removing membrane FcεRI. Rapid desensitization with anti-FcεRIα mAb was safer and longer lasting than rapid desensitization with antigen. A rapid desensitization approach with anti-FcεRIα mAb safely desensitizes mice to IgE-mediated anaphylaxis by inducing mast cell anergy and later removing all mast cell IgE. Rapid desensitization with an anti-human FcεRIα mAb may be able to prevent human IgE-mediated anaphylaxis. Copyright © 2013 American Academy of Allergy, Asthma & Immunology. Published by Mosby, Inc. All rights reserved.

48 CFR 52.233-4 - Applicable Law for Breach of Contract Claim.

Science.gov (United States)

2010-10-01

... Provisions and Clauses 52.233-4 Applicable Law for Breach of Contract Claim. As prescribed in 33.215(b), insert the following clause: Applicable Law for Breach of Contract Claim (OCT 2004) United States law... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Applicable Law for Breach...

CONSIDERATION ON THE LEGAL REGIME APPLICABLE TO INTERNATIONAL TOURISM CONTRACTS

Directory of Open Access Journals (Sweden)

Serban-Alexandru STANESCU

2017-07-01

Full Text Available Upon conclusion of an international tourism contract, the contracting parties - one of which (the beneficiary acts as the consumer – are facing legal difficulties, which are addressed by this study from the perspective of the interference between the national law and the European Union law. Thus, one of the primary issues considered herein is that concerning the determination of the applicable law based on which the rights and obligations of the contracting parties are to be established. Secondly, this study examines the applicable procedural rules in the case where a Romanian court is requested to settle a dispute arising from an international tourism contract. Finally, the study deals with the hypothesis where a dispute arising from such a contract is settled by a foreign court, and in particular with the effects of the judgment given by the foreign court on the territory of Romania. The above mentioned issues are the grounds behind this research on the legal status of international tourism contracts, in addition to the fact that, despite the rich contractual practice in the field under consideration, the amount of specialized literature on this subject is rather limited.

Firm Reorganization : Social Control or Social Contract?

NARCIS (Netherlands)

Aalbers, Hendrik Leendert; Dolfsma, Wilfred; Blinde-Leerentveld, Rowan

Firm reorganizations deeply affect employees. Management can reorganize in different ways, focusing on costs or acknowledging the involvement of employees. The latter implies following a social contract that complements incomplete (formal) labor contracts. Little is known about how the way in which

Smart contracts sobre Bitcoin

OpenAIRE

Andreu Alemany, Josep Miquel

2016-01-01

El present treball final de màster realitza una introducció als smart contracts. El treball introdueix el concepte de contracte intel·ligent, els seus usos i alguns exemples existents. Seguidament proporciona les nocions necessàries de les transaccions del protocol Bitcoin per poder implementar un contracte intel·ligent, usant la blockchain que ofereix el protocol. Per últim, s'explica la implementació d'un contracte intel·ligent usant bitcoin: un canal de micropagaments. El presente traba...

Immunization With Fc-Based Recombinant Epstein–Barr Virus gp350 Elicits Potent Neutralizing Humoral Immune Response in a BALB/c Mice Model

Directory of Open Access Journals (Sweden)

Bingchun Zhao

2018-05-01

Full Text Available Epstein–Barr virus (EBV was the first human virus proved to be closely associated with tumor development, such as lymphoma, nasopharyngeal carcinoma, and EBV-associated gastric carcinoma. Despite many efforts to develop prophylactic vaccines against EBV infection and diseases, no candidates have succeeded in effectively blocking EBV infection in clinical trials. Previous investigations showed that EBV gp350 plays a pivotal role in the infection of B-lymphocytes. Nevertheless, using monomeric gp350 proteins as antigens has not been effective in preventing infection. Multimeric forms of the antigen are more potently immunogenic than monomers; however, the multimerization elements used in previous constructs are not approved for human clinical trials. To prepare a much-needed EBV prophylactic vaccine that is potent, safe, and applicable, we constructed an Fc-based form of gp350 to serve as a dimeric antigen. Here, we show that the Fc-based gp350 antigen exhibits dramatically enhanced immunogenicity compared with wild-type gp350 protein. The complete or partial gp350 ectodomain was fused with the mouse IgG2a Fc domain. Fusion with the Fc domain did not impair gp350 folding, binding to a conformation-dependent neutralizing antibody (nAb and binding to its receptor by enzyme-linked immunosorbent assay and surface plasmon resonance. Specific antibody titers against gp350 were notably enhanced by immunization with gp350-Fc dimers compared with gp350 monomers. Furthermore, immunization with gp350-Fc fusion proteins elicited potent nAbs against EBV. Our data strongly suggest that an EBV gp350 vaccine based on Fc fusion proteins may be an efficient candidate to prevent EBV infection in clinical applications.

Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function.

Science.gov (United States)

Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F; Mo, Xiaokui; Byrd, John C; Carson, William E; Butchar, Jonathan P; Tridandapani, Susheela

2016-02-05

The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. © 2016 by The American Society for Biochemistry

Analysis of the Effects of the Bruton's tyrosine kinase (Btk) Inhibitor Ibrutinib on Monocyte Fcγ Receptor (FcγR) Function*

Science.gov (United States)

Ren, Li; Campbell, Amanda; Fang, Huiqing; Gautam, Shalini; Elavazhagan, Saranya; Fatehchand, Kavin; Mehta, Payal; Stiff, Andrew; Reader, Brenda F.; Mo, Xiaokui; Byrd, John C.; Carson, William E.; Butchar, Jonathan P.; Tridandapani, Susheela

2016-01-01

The irreversible Bruton's tyrosine kinase (Btk) inhibitor ibrutinib has shown efficacy against B-cell tumors such as chronic lymphocytic leukemia and B-cell non-Hodgkin lymphoma. Fcγ receptors (FcγR) on immune cells such as macrophages play an important role in tumor-specific antibody-mediated immune responses, but many such responses involve Btk. Here we tested the effects of ibrutinib on FcγR-mediated activities in monocytes. We found that ibrutinib did not affect monocyte FcγR-mediated phagocytosis, even at concentrations higher than those achieved physiologically, but suppressed FcγR-mediated cytokine production. We confirmed these findings in macrophages from Xid mice in which Btk signaling is defective. Because calcium flux is a major event downstream of Btk, we tested whether it was involved in phagocytosis. The results showed that blocking intracellular calcium flux decreased FcγR-mediated cytokine production but not phagocytosis. To verify this, we measured activation of the GTPase Rac, which is responsible for actin polymerization. Results showed that ibrutinib did not inhibit Rac activation, nor did the calcium chelator 1,2-bis(2-aminophenoxy)ethane-N,N,N′,N′-tetraacetic acid tetrakis(acetoxymethyl ester). We next asked whether the effect of ibrutinib on monocyte FcγR-mediated cytokine production could be rescued by IFNγ priming because NK cells produce IFNγ in response to antibody therapy. Pretreatment of monocytes with IFNγ abrogated the effects of ibrutinib on FcγR-mediated cytokine production, suggesting that IFNγ priming could overcome this Btk inhibition. Furthermore, in monocyte-natural killer cell co-cultures, ibrutinib did not inhibit FcγR-mediated cytokine production despite doing so in single cultures. These results suggest that combining ibrutinib with monoclonal antibody therapy could enhance chronic lymphocytic leukemia cell killing without affecting macrophage effector function. PMID:26627823

Dicty_cDB: FC-AJ15 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT

25 CFR 900.133 - Does the declination process or the Contract Dispute Act apply to construction contract...

Science.gov (United States)

2010-04-01

...-DETERMINATION AND EDUCATION ASSISTANCE ACT Construction § 900.133 Does the declination process or the Contract... 25 Indians 2 2010-04-01 2010-04-01 false Does the declination process or the Contract Dispute Act apply to construction contract amendments proposed either by an Indian tribe or tribal organization or...

24 CFR 891.595 - HAP contract extension or renewal.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false HAP contract extension or renewal... Handicapped-Section 8 Assistance § 891.595 HAP contract extension or renewal. Upon expiration of the term of the HAP contract, HUD and the Borrower may agree (subject to available funds) to extend the term of...

Application of Lectin Array Technology for Biobetter Characterization: Its Correlation with FcγRIII Binding and ADCC

Directory of Open Access Journals (Sweden)

Markus Roucka

2016-12-01

Full Text Available Lectin microarray technology was applied to compare the glycosylation pattern of the monoclonal antibody MB311 expressed in SP2.0 cells to an antibody-dependent cellular cytotoxic effector function (ADCC-optimized variant (MB314. MB314 was generated by a plant expression system that uses genetically modified moss protoplasts (Physcomitrella patens to generate a de-fucosylated version of MB311. In contrast to MB311, no or very low interactions of MB314 with lectins Aspergillus oryzae l-fucose (AOL, Pisum sativum agglutinin (PSA, Lens culinaris agglutinin (LCA, and Aleuria aurantia lectin (AAL were observed. These lectins are specific for mono-/biantennary N-glycans containing a core fucose residue. Importantly, this fucose indicative lectin-binding pattern correlated with increased MB314 binding to CD16 (FcγRIII; receptor for the constant region of an antibody—whose affinity is mediated through core fucosylation—and stronger ADCC. In summary, these results demonstrate that lectin microarrays are useful orthogonal methods during antibody development and for characterization.

Bacteria and viruses modulate FcεRI-dependent mast cell activity 

Directory of Open Access Journals (Sweden)

Aleksandra Słodka

2013-03-01

Full Text Available Undoubtedly, mast cells play a central role in allergic processes. Specific allergen cross-linking of IgE bound to the high affinity receptors (FcεRI on the mast cell surface leads to the release of preformed mediators and newly synthesized mediators, i.e. metabolites of arachidonic acid and cytokines. More and more data indicate that bacteria and viruses can influence FcεRI-dependent mast cell activation. Some bacterial and viral components can reduce the surface expression of FcεRI. There are also findings that ligation of Toll-like receptors (TLRs by bacterial or viral antigens can affect IgE-dependent mast cell degranulation and preformed mediator release as well as eicosanoid production. The synergistic interaction of TLR ligands and allergen can also modify cytokine synthesis by mast cells stimulated via FcεRI. Moreover, data suggest that specific IgE for bacterial or viral antigens can influence mast cell activity. What is more, some bacterial and viral components or some endogenous proteins produced during viral infection can act as superantigens by interacting with the VH3 domain of IgE. All these observations indicate that bacterial and viral infections modify the course of allergic diseases by affecting FcεRI-dependent mast cell activation. 

Bloqueio do plexo braquial pela via posterior com uso de neuroestimulador e ropivacaína a 0,5% Bloqueo del plexo braquial por la vía posterior con el uso de neuroestimulador y ropivacaína a 0,5% Posterior brachial plexus block with nerve stimulator and 0.5% ropivacaine

Directory of Open Access Journals (Sweden)

Lúcia Beato

2005-08-01

, scheduled for shoulder, clavicle and proximal humerus surgery, who were submitted to posterior brachial plexus block with the aid of a nerve stimulator starting at 1 mA. When adequate muscle contraction was obtained, the current was decreased to 0.5 mA. If the response persisted, 40 mL of 0.5% ropivacaine was injected. The following parameters were evaluated: block onset, analgesia and motor block duration, complications and side effects. RESULTS: Blockade was effective in 20 out of 22 patients, mean onset time was 15.52 min, mean surgical duration was 1.61 h. Mean analgesia duration was 15.85 h and mean motor block duration was 11.16 h. There were no clinical signs or symptoms of toxic effects of local anesthetics and no patient presented side effects. CONCLUSIONS: Posterior brachial plexus block with the aid of nerve stimulator provides effective anesthesia, is very comfortable for patients and easy to perform.

Development of a real-time fuel cell stack modelling solution with integrated test rig interface for the generic fuel cell modelling environment (GenFC) software

Energy Technology Data Exchange (ETDEWEB)

Fraser, S.D.; Monsberger, M.; Hacker, V. [Graz Univ. of Technology, Graz (Austria). Christian Doppler Laboratory for Fuel Cell Systems; Gubner, A.; Reimer, U. [Forschungszentrum Julich, Julich (Germany)

2007-07-01

Since the late 1980s, numerous FC models have been developed by scientists and engineers worldwide to design, control and optimize fuel cells (FCs) and fuel cell (FC) power systems. However, state-of-the-art FC models have only a small range of applications within the versatile field of FC modelling. As fuel cell technology approaches commercialization, the scientific community is faced with the challenge of providing robust fuel cell models that are compatible with established processes in industrial product development. One such process, known as Hardware in the Loop (HiL), requires real-time modelling capability. HiL is used for developing and testing hardware components by adding the complexity of the related dynamic systems with mathematical representations. Sensors and actuators are used to interface simulated and actual hardware components. As such, real-time fuel cell models are among the key elements in the development of the Generic Fuel Cell Modelling Environment (GenFC) software. Six European partners are developing GenFC under the support of the Sixth European Framework Programme for Research and Technological Development (FP6). GenFC is meant to increase the use of fuel cell modelling for systems design and to enable cost- and time-efficient virtual experiments for optimizing operating parameters. This paper presented an overview of the GenFC software and the GenFC HiL functionality. It was concluded that GenFC is going to be an extendable software tool providing FC modelling techniques and solutions to a wide range of different FC modelling applications. By combining the flexibility of the GenFC software with this HiL-specific functionality, GenFC is going to promote the use of FC model-based HiL technology in FC system development. 9 figs.

fcGENE: a versatile tool for processing and transforming SNP datasets.

Directory of Open Access Journals (Sweden)

Nab Raj Roshyara

Full Text Available Modern analysis of high-dimensional SNP data requires a number of biometrical and statistical methods such as pre-processing, analysis of population structure, association analysis and genotype imputation. Software used for these purposes often rely on specific and incompatible input and output data formats. Therefore extensive data management including multiple format conversions is necessary during analyses.In order to support fast and efficient management and bio-statistical quality control of high-dimensional SNP data, we developed the publically available software fcGENE using C++ object-oriented programming language. This software simplifies and automates the use of different existing analysis packages, especially during the workflow of genotype imputations and corresponding analyses.fcGENE transforms SNP data and imputation results into different formats required for a large variety of analysis packages such as PLINK, SNPTEST, HAPLOVIEW, EIGENSOFT, GenABEL and tools used for genotype imputation such as MaCH, IMPUTE, BEAGLE and others. Data Management tasks like merging, splitting, extracting SNP and pedigree information can be performed. fcGENE also supports a number of bio-statistical quality control processes and quality based filtering processes at SNP- and sample-wise level. The tool also generates templates of commands required to run specific software packages, especially those required for genotype imputation. We demonstrate the functionality of fcGENE by example workflows of SNP data analyses and provide a comprehensive manual of commands, options and applications.We have developed a user-friendly open-source software fcGENE, which comprehensively supports SNP data management, quality control and analysis workflows. Download statistics and corresponding feedbacks indicate that software is highly recognised and extensively applied by the scientific community.

The New Zealand Construction Contracts Amendment Act 2015 - For Better or Worse?

Directory of Open Access Journals (Sweden)

David Finnie

2015-11-01

Full Text Available Adjudication has been statutorily introduced as an alternative dispute resolution method in 14 jurisdictions including New Zealand. Whilst adjudication under the New Zealand Construction Contracts Act 2002 has been hailed a success, further refinements were proposed in the Construction Contracts Amendment Bill first published in 2013. As part of the legislative process, 48 submissions were made to the Commerce Committee. There was general support for most of the amendments, but some parties expressed concerns on some of the changes. A documentary analysis of the Amendment Bills and submissions to the Commerce Committee was made to critically evaluate the changes proposed and establish if they were improvements. The findings show the major changes proposed include (i removing most of the distinctions between the treatment of residential and commercial contracts under the Act, (ii extending the scope of the Act to apply to contracts for certain professional services, (iii removing the distinction between enforcement of payment determinations and of those relating to rights and obligations, and (iv making the enforcement process more efficient. The findings also show that during a period of over two years from when the Bill was first introduced in January 2013, one other significant improvement for retentions to be held in trust was made. A few proposals to further refine the Bill such as the suggestion to mandate retentions to be kepts in a separate trust account were however not accepted. The Construction Contract Amendment Bill (Bill 97-3 was uninanimously passed during the third and final reading in Parliament on 20 October 2015 with most of the amendments coming into force on 1 December 2015, those incorporating professional services on 1 September 2016, and the retention provisions on 31 March 2017. Royal assent was given on 11 October 2015 leading to the enactment of the Construction Contracts Amendment Act 2015.

The New Zealand Construction Contracts Amendment Act 2015 - For Better or Worse?

Directory of Open Access Journals (Sweden)

David Finnie

2015-11-01

Full Text Available Adjudication has been statutorily introduced as an alternative dispute resolution method in 14 jurisdictions including New Zealand. Whilst adjudication under the New Zealand Construction Contracts Act 2002 has been hailed a success, further refinements were proposed in the Construction Contracts Amendment Bill first published in 2013. As part of the legislative process, 48 submissions were made to the Commerce Committee. There was general support for most of the amendments, but some parties expressed concerns on some of the changes. A documentary analysis of the Amendment Bills and submissions to the Commerce Committee was made to critically evaluate the changes proposed and establish if they were improvements. The findings show the major changes proposed include (i removing most of the distinctions between the treatment of residential and commercial contracts under the Act, (ii extending the scope of the Act to apply to contracts for certain professional services, (iii removing the distinction between enforcement of payment determinations and of those relating to rights and obligations, and (iv making the enforcement process more efficient. The findings also show that during a period of over two years from when the Bill was first introduced in January 2013, one other significant improvement for retentions to be held in trust was made. A few proposals to further refine the Bill such as the suggestion to mandate retentions to be kept in a separate trust account were however not accepted. The Construction Contract Amendment Bill (Bill 97-3 was uninanimously passed during the third and final reading in Parliament on 20 October 2015 with most of the amendments coming into force on 1 December 2015, those incorporating professional services on 1 September 2016, and the retention provisions on 31 March 2017. Royal assent was given on 11 October 2015 leading to the enactment of the Construction Contracts Amendment Act 2015.

A 6-month study comparing efficacy, safety, and tolerability of the preservative-free fixed combination of tafluprost 0.0015% and timolol 0.5% versus each of its individual preservative-free components.

Science.gov (United States)

Pfeiffer, Norbert; Traverso, Carlo E; Lorenz, Katrin; Saarela, Ville; Liinamaa, Johanna; Uusitalo, Hannu; Astakhov, Yury; Boiko, Ernest; Ropo, Auli

2014-12-01

The efficacy, safety and tolerability of the preservative-free (PF) fixed combination (FC) of tafluprost 0.0015% and timolol 0.5% (once daily) were compared to those of the individual components (PF tafluprost 0.0015% once daily and PF timolol 0.5% twice daily) in patients with open-angle glaucoma or ocular hypertension inadequately controlled on prior timolol or prostaglandin monotherapy for 6 months. A stratified, double-masked, randomized, multicenter phase III study was conducted. A total of 189 prior timolol users were randomized within the timolol stratum (TS) to receive either FC (n = 95) or timolol 0.5% (TIM; n = 94). Furthermore, a total of 375 prior prostaglandin analog (PGA) users were randomized within the prostaglandin stratum (PS) to receive either FC (n = 188) or tafluprost 0.0015% (TAF; n = 187). To be eligible for participation in the study, the patients were required to have an intraocular pressure (IOP) of ≥22 mmHg when on timolol (TIM) or of ≥20 mmHg when on PGA in either treated eye at the screening and end-of-run-in visits. In addition to these, the study included visits at baseline, 2 and 6 weeks, 3 and 6 months and at a post-study visit. IOP was measured at 8 a.m., 10 a.m., 4 p.m., and 8 p.m. In the TS, a significant reduction from baseline IOP was seen with FC and TIM throughout the study. Average diurnal IOP change from baseline at month 3 was -8.55 mmHg (32%) for FC and -7.35 mmHg (28%) for TIM. The model-based treatment difference (FC-TIM) was -0.885 mmHg [95% confidence interval (CI) -1.745 to -0.024; p = 0.044] demonstrating the superiority of FC over TIM. In the PS, a significant reduction in IOP was seen with both FC and TAF throughout the study. The average diurnal IOP change from baseline at month 3 was -8.61 mmHg (33%) for FC and -7.23 mmHg (28%) for TAF. The model-based treatment difference (FC-TAF) was -1.516 mmHg (95% CI -2.044 to -0.988; p preservative-free fixed combination of tafluprost and

Estudo comparativo do efeito de solução de NaF a 0,5%, através de bochecho, escovação e ambos, na prevenção da cárie dental A comparative study of the effect of a 0.5% NaF solution, used in mouthwashing or toothbrushing or both, in the prevention of dental caries

Directory of Open Access Journals (Sweden)

Roberto Augusto Castellanos

1983-12-01

Full Text Available Foi realizado estudo a fim de comparar o efeito na redução do ataque de cárie de uma solução de fluoreto de sódio, na concentração de 0,5% aplicada sob a forma de bochecho, escovação, escovação e bochecho, uma vez por semana, sob supervisão, durante um período escolar de 10 meses em 424 escolares de 9 a 10 anos de idade matriculados em cinco escolas estaduais do Estado de São Paulo (Brasil. As crianças foram distribuídas igualmente em três grupos experimentais e um grupo controle, de acordo com a idade dental (nº de superfícies de dentes permanentes irrompidas e experiência anterior de cárie (CPO-S. Foram examinadas 307 crianças e os resultados mostraram que houve uma redução, estatisticamente significante ao nível de 0,05, de ataque de cárie entre os grupos experimentais e controle, da ordem de 35,19% para o grupo de bochecho (grupo I, de 37,91% para o grupo de escovação (grupo II, e de 49,77% para o grupo de escovação e bochecho (grupo IV. Quando comparados os grupos experimentais entre si não houve diferenças estatisticamente significantes ao nível de 0,05.A comparative study of the anticariogenic effect of sodium fluoride solution, with a concentration of 0.5%, applied weekly and under supervision, in mouthwashing and toothbrushing, used independently and in combination, was carried out on 424 children of 9 and 10 years of age from five public schools in S. Paulo, Brazil, over a period of 10 school months. The children were equally divided into three experimental groups and one control group according to the dental age (number of erupted permanent teeth surfaces and history of caries (DMF-S. Three hundred and seven children were examined at the end of the study and the results show a statistically significant decrease at the 0.05 level, between the experimental groups and control group, in the incidence of caries - 35.19% for the mouthwashing group (Group I; 37.91% for the toothbrushing group (Group II; and

Avaliação de desempenho da Agência Nacional de Vigilância Sanitária no modelo de contrato de gestão The Brazilian National Health Surveillance Agency performance evaluation at the management contract model

Directory of Open Access Journals (Sweden)

Elka Maltez de Miranda Moreira

2010-11-01

Full Text Available A Agência Nacional de Vigilância Sanitária (Anvisa é acompanhada pelo Ministério da Saúde mediante contrato de gestão, instrumento de avaliação de desempenho. Realizou-se estudo de caso mediante entrevistas semiestruturadas com atores selecionados e análise documental, objetivando descrever e analisar o modelo de avaliação de desempenho da Anvisa, com vistas à finalidade da instituição, de acordo com as seguintes categorias analíticas: formalização do contrato de gestão, instrumentos de avaliação, sujeito avaliador e desempenho institucional. As entrevistas semiestruturadas e a análise documental indicam que a Anvisa celebrou um contrato de gestão, em 1999, atualizado por quatro termos aditivos. O avaliador interno é representado pela Diretoria Colegiada e Núcleo de Assessoramento à Gestão Estratégica; o avaliador externo, por uma Comissão de Avaliação constituída pelo Ministério da Saúde. Identificaram-se três fases do modelo avaliativo: estruturação do novo modelo de gestão (1999-2000, legitimação ante o segmento produtivo (2001-2004 e ampliação da legitimação (2005. O melhor desempenho ocorreu em 2000 (86,05%, e o pior em 2004 (40,00%. Verificou-se que o modelo de avaliação pouco avançou em direção à finalidade institucional e aferição da efetividade das ações realizadas.The Brazilian National Health Surveillance Agency (Anvisa is supervised by the Ministry of Health by means of a management contract, a performance evaluation tool. This case study was aimed at describing and analyzing Anvisa's performance evaluation model based on the agency's institutional purpose, according to the following analytical categories: the management contract formalization, evaluation tools, evaluators and institutional performance. Semi-structured interviews and document analysis revealed that Anvisa signed only one management contract with the Ministry of Health in 1999, updated by four additive terms. The

POTÊNCIA E CAPACIDADE ANAERÓBIA EM ATLETAS DE KARATE

Directory of Open Access Journals (Sweden)

Keith Sato Urbinati

2011-01-01

Full Text Available O objetivo do presente estudo foi verificar o nível de potência muscular, bem como a intensidade de esforço durante prova de potência e capacidade anaeróbia em atletas de Karate. Participaram do estudo treze karatekas especialistas em prova de kumitê (luta,sexo masculino, idade média de 20,7±3,79 anos. Realizou-se a avaliação de potência e capacidade anaeróbia (Wingate test, com coleta das variáveis fisiológicas:frequência cardíaca (FC, pressão arterial (PA e lactato sanguíneo (LAC de repouso, imediatamente após e em 5 min de recuperação. Para verificar se ocorrem diferenças nas variáveis fisiológicas durante o teste, realizou-se análise de variância, post hoc de Bonferronie (p?0,05. Verificou-se potência de pico(PP de 8,77 ± 0,99 W/kg-1, potência média (PM de 5,13± 0,49 W.kg-1 e % de fadiga de 50,5 ± 6,45%. Para as variáveis fisiológicas,a FC (F=9,79; p=0,00 pós-teste de Wingate foi estatisticamente maior e diferenteda FC de repouso e recuperação. Não foram encontradas diferenças nos níveis pressatórios e nas concentrações de LAC. Em relação aos valores de FC e LAC tais variáveis pós-teste não se apresentaram elevados. Os valores de potência anaeróbia estão de acordo com a necessidade da modalidade esportiva. Assim, verificou-se menores intensidades de esforço em teste de Wingate quando comparados a de situação real de competição. O nível de potência muscular parece estar adequado ao kumitê.

EFAM ETM 97 - the ETM method for assessing the significance of crack-like defects in engineering structures, comprising the versions ETM 97/1 and ETM 97/2

International Nuclear Information System (INIS)

Schwalbe, K.H.; Zerbst, U.; Kim, Y.J.; Brocks, W.; Cornec, A.; Heerens, J.; Amstutz, H.

1998-01-01

EFAM ETM 97 is a document of the GKSS Procedure 'Engineering Flaw Assessment Method (EFAM)'. It describes methods for estimating the crack driving force for cracks in structural components in terms of the crack tip opening displacement, δ 5 , and the J-integral. It consists of several modules covering particular application problems. Appendices to this document provide solutions for the stress intensity factor and the yield load, as well as information on transferability of fracture parameters and on the treatment of bi-axial and mixed mode loadings. A second assessment route is also given in an appendix. (orig.) [de

The Fc-receptor III of cultured human monocytes. Structural similarity with FcRIII of natural killer cells and role in the extracellular lysis of sensitized erythrocytes

NARCIS (Netherlands)

Klaassen, R. J.; Ouwehand, W. H.; Huizinga, T. W.; Engelfriet, C. P.; von dem Borne, A. E.

1990-01-01

FcRIII is not present on peripheral blood monocytes, but becomes expressed upon culturing and can be demonstrated on tissue macrophages. We studied the expression of FcRIII of cultured monocytes in detail and compared its structure with FcRIII of neutrophils and NK cells. The cell density of FcRIII

Inhibition of Notch signaling by Dll4-Fc promotes reperfusion of acutely ischemic tissues

Energy Technology Data Exchange (ETDEWEB)

Liu, Ren [Department of Pathology, University of Southern California, Los Angeles (United States); Trindade, Alexandre [Centro Interdisciplinar de Investigacao em Sanidade Animal (CIISA), Lisbon Technical University, Lisbon (Portugal); Instituto Gulbenkian de Ciencia, Oeiras (Portugal); Sun, Zhanfeng [Department of Vascular Surgery, 2nd Affiliated Hospital of Harbin Medical University, Harbin, Heilongjiang (China); Kumar, Ram; Weaver, Fred A. [Department of Surgery, University of Southern California, Los Angeles (United States); Krasnoperov, Valery; Naga, Kranthi [Vasgene Therapeutics, Los Angeles, CA (United States); Duarte, Antonio [Centro Interdisciplinar de Investigacao em Sanidade Animal (CIISA), Lisbon Technical University, Lisbon (Portugal); Instituto Gulbenkian de Ciencia, Oeiras (Portugal); Gill, Parkash S., E-mail: parkashg@usc.edu [Department of Pathology, University of Southern California, Los Angeles (United States)

2012-02-03

Highlights: Black-Right-Pointing-Pointer Low dose Dll4-Fc increases vascular proliferation and overall perfusion. Black-Right-Pointing-Pointer Low dose Dll4-Fc helps vascular injury recovery in hindlimb ischemia model. Black-Right-Pointing-Pointer Low dose Dll4-Fc helps vascular injury recovery in skin flap model. Black-Right-Pointing-Pointer Dll4 heterozygous deletion promotes vascular injury recovery. Black-Right-Pointing-Pointer Dll4 overexpression delays vascular injury recovery. -- Abstract: Notch pathway regulates vessel development and maturation. Dll4, a high-affinity ligand for Notch, is expressed predominantly in the arterial endothelium and is induced by hypoxia among other factors. Inhibition of Dll4 has paradoxical effects of reducing the maturation and perfusion in newly forming vessels while increasing the density of vessels. We hypothesized that partial and/or intermittent inhibition of Dll4 may lead to increased vascular response and still allow vascular maturation to occur. Thus tissue perfusion can be restored rapidly, allowing quicker recovery from ischemia or tissue injury. Our studies in two different models (hindlimb ischemia and skin flap) show that inhibition of Dll4 at low dose allows faster recovery from vascular and tissue injury. This opens a new possibility for Dll4 blockade's therapeutic application in promoting recovery from vascular injury and restoring blood supply to ischemic tissues.

Single chain Fc-dimer-human growth hormone fusion protein for improved drug delivery.

Science.gov (United States)

Zhou, Li; Wang, Hsuan-Yao; Tong, Shanshan; Okamoto, Curtis T; Shen, Wei-Chiang; Zaro, Jennica L

2017-02-01

Fc fusion protein technology has been successfully used to generate long-acting forms of several protein therapeutics. In this study, a novel Fc-based drug carrier, single chain Fc-dimer (sc(Fc) 2 ), was designed to contain two Fc domains recombinantly linked via a flexible linker. Since the Fc dimeric structure is maintained through the flexible linker, the hinge region was omitted to further stabilize it against proteolysis and reduce FcγR-related effector functions. The resultant sc(Fc) 2 candidate preserved the neonatal Fc receptor (FcRn) binding. sc(Fc) 2 -mediated delivery was then evaluated using a therapeutic protein with a short plasma half-life, human growth hormone (hGH), as the protein drug cargo. This novel carrier protein showed a prolonged in vivo half-life and increased hGH-mediated bioactivity compared to the traditional Fc-based drug carrier. sc(Fc) 2 technology has the potential to greatly advance and expand the use of Fc-technology for improving the pharmacokinetics and bioactivity of protein therapeutics. Copyright © 2016 Elsevier Ltd. All rights reserved.

Increase in neutrophil Fc gamma receptor I expression following interferon gamma treatment in rheumatoid arthritis.

Science.gov (United States)

Goulding, N J; Knight, S M; Godolphin, J L; Guyre, P M

1992-04-01

The therapeutic potential of interferon gamma (IFN gamma) in a number of disease states is still being explored, but progress is hampered by the lack of a suitable measure of in vivo biological activity. To assess the in vivo biological effects of recombinant human IFN gamma (rhIFN gamma), 14 patients were studied in a randomised, prospective, double blind, placebo controlled trial of this cytokine for the treatment of rheumatoid arthritis. The levels of Fc gamma receptors on peripheral blood neutrophils were measured at baseline and after 21 days of once daily, subcutaneous injections of rhIFN gamma or placebo. An induction of neutrophil Fc gamma receptor type I (Fc gamma RI) was seen in the group of patients receiving recombinant human rhIFN gamma but not in those receiving placebo. No change in the expression of Fc gamma RII or Fc gamma RIII was detected. The amount of induction of Fc gamma RI detected on the neutrophils of patients receiving rhIFN gamma did not correlate with clinical measures of response at either 21 days or at the end of the study (24 weeks). No significant clinical responses were observed in the rhIFN gamma group at these times. These data confirm that the reported in vitro effect of IFN gamma on human neutrophil Fc receptor expression can be reproduced in vivo.

Optimal football strategies: AC Milan versus FC Barcelona

OpenAIRE

Papahristodoulou, Christos

2012-01-01

In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

Embryo-fetal transfer of bevacizumab (Avastin) in the rat over the course of gestation and the impact of neonatal Fc receptor (FcRn) binding.

Science.gov (United States)

Thorn, Mitchell; Piche-Nicholas, Nicole; Stedman, Donald; Davenport, Scott W; Zhang, Ning; Collinge, Mark; Bowman, Christopher J

2012-10-01

There is concern about embryo-fetal exposure to antibody-based biopharmaceuticals based on the increase of such therapies being prescribed to women of childbearing potential. Therefore, there is a desire to better characterize embryo-fetal exposure of these molecules. The pregnant rat is a standard model for evaluating the potential consequences of exposure but placental transfer of antibody-based biopharmaceuticals is not well understood in this model. The relative embryo-fetal distribution of an antibody-based biopharmaceutical was evaluated in the rat. Bevacizumab (Avastin) was chosen as a tool antibody since it does not have significant target binding in the rat that might influence embryo-fetal biodistribution. Avastin was labeled with a fluorescent dye, characterized, and injected into pregnant rats at different gestation ages. Labeled Avastin in fetal tissues was visualized ex vivo using an IVIS 200 (Caliper, A PerkinElmer Company, Alameda, CA). Avastin localized to the fetus as early as 24-hr post intravenous injection of the dam, and was taken up by the fetus in a dose-dependent manner. Avastin was detectable in the developing embryo as early as gestation day 13 and continued to be transferred until the end of gestation. Fetal transfer of Avastins mutated in the portion of the antibody that binds the neonatal Fc receptor (FcRn) was tested in late gestation and was found to correlate with affinities of the mutant Avastin antibody to FcRn. The novel application of this imaging technology was used to characterize the onset and duration of Avastin maternal-fetal transfer in rats and the importance of FcRn binding. © 2012 Wiley Periodicals, Inc.

Força muscular de atletas de voleibol de 9 a 18 anos através da dinamometria computadorizada Fuerza muscular de atletas de voleibol de 9 a 18 años a través de la dinamometria computarizada Muscular strength of 9-18-year old volleyball athletes through computational dynamometry

Directory of Open Access Journals (Sweden)

Patrícia Schneider

2004-04-01

Full Text Available O objetivo deste estudo foi descrever e comparar as forças musculares isométrica e isocinética em diferentes graus maturacionais de meninos e meninas atletas de voleibol. Participou do estudo um total de 66 crianças e adolescentes saudáveis, em treinamento esportivo competitivo. Dos 37 meninos, 10 eram pré-púberes (PP, 15 púberes (PU e 12 pós-púberes (PO. Das 29 meninas, 11 eram PP, 13 PU e 5 PO. Foi utilizado um dinamômetro computadorizado (Cybex Norm para medir a força isocinética de flexão do cotovelo (FC e de extensão de joelho (EJ nas velocidades de 60 e 90º.s-1. A força isométrica foi medida nos mesmos exercícios nos ângulos de 60 e 90º (FC, e 45 e 60º (EJ. Utilizou-se a ANOVA para comparações entre os gêneros e graus maturacionais, e o teste post hoc de Tuckey. O nível de significância considerado foi de p El objetivo de este estudio fué describir y comparar las fuerzas musculares isométrica e isocinética en diferentes grados maduracionales de niños y niñas atletas de voleibol. Participó del estudio un total de 66 niños y adolescentes, en tratamiento deportivo competitivo. De los 37 niños, 10 eran pre-púberes (PP, 15 púberes (PU y 12 post-púberes (PO. De las 29 niñas, 11 eran PP, 13 PU e 5 PO. Fué utilizado un dinamómetro computarizado (Cybex Norm para medir la fuerza isocinética de flexión de codo (FC y extensión de rodilla (EJ en las velocidades de 60 y 90º.s-1. La fuerza isométrica fue medida en los mismos ejercicios en los ángulos de 60 y 90º (FC, y 45 y 60º (EJ. Se utilizó la ANOVA para comparaciones entre los géneros y grados maduracionales y el test post hoc de Tuckey. El nivel de significancia considerado fue de p The objective of this work was to describe and to compare the isometric and isokinetic muscular strength at different maturational degree of boys and girls volleyball athletes. 66 healthy children and youth participated in the study in a competitive sportive training

Effects of altered FcγR binding on antibody pharmacokinetics in cynomolgus monkeys

Science.gov (United States)

Leabman, Maya K; Meng, Y Gloria; Kelley, Robert F; DeForge, Laura E; Cowan, Kyra J; Iyer, Suhasini

2013-01-01

Antibody interactions with Fcγ receptors (FcγRs), like FcγRIIIA, play a critical role in mediating antibody effector functions and thereby contribute significantly to the biologic and therapeutic activity of antibodies. Over the past decade, considerable work has been directed towards production of antibodies with altered binding affinity to FcγRs and evaluation of how the alterations modulate their therapeutic activity. This has been achieved by altering glycosylation status at N297 or by engineering modifications in the crystallizable fragment (Fc) region. While the effects of these modifications on biologic activity and efficacy have been examined, few studies have been conducted to understand their effect on antibody pharmacokinetics (PK). We present here a retrospective analysis in which we characterize the PK of three antibody variants with decreased FcγR binding affinity caused by amino acid substitutions in the Fc region (N297A, N297G, and L234A/L235A) and three antibody variants with increased FcγRIIIA binding affinity caused by afucosylation at N297, and compare their PK to corresponding wild type antibody PK in cynomolgus monkeys. For all antibodies, PK was examined at a dose that was known to be in the linear range. Since production of the N297A and N297G variants in Chinese hamster ovary cells results in aglycosylated antibodies that do not bind to FcγRs, we also examined the effect of expression of an aglycosylated antibody, without sequence change(s), in E. coli. All the variants demonstrated similar PK compared with that of the wild type antibodies, suggesting that, for the six antibodies presented here, altered FcγR binding affinity does not affect PK. PMID:24492343

Fc-receptors and surface immunoglobulins in cells of the hairy cell leukemia

International Nuclear Information System (INIS)

Rieber, E.P.; Linke, R.P.; Riethmueller, G.; Heyden, H.W. von; Waller, H.D.

1976-01-01

Using 125 I-labelled aggregated IgG in a quantitative assay a strong expression of Fc-receptors was found on the leukemic cells of a patient with hairy cell leukemia. The Fc-receptor activity on these cells was much higher than that on monocytes and B-lymphocytes from normal blood. Surface immunoglobulins were detected by radioautography using radioactively labelled (Fab') 2 -fragments of monospecific antibodies directed against immunoglobulin heavy chains. Prior to radioautography the cells were stained for the tartrate resistant acid phosphatase. It is found that all cells containing this enzyme bore delta-chains on their surface. On more than 90% of these cells a simultaneous expression of μ-chains was detected. γ-chains could only be demonstrated on cells which were negative for the tartrate resistant acid phosphatase; part of these cells, however, were hairy cells by morphological criteria. (orig.) [de

Effect of trastuzumab interchain disulfide bond cleavage on Fcγ receptor binding and antibody-dependent tumour cell phagocytosis.

Science.gov (United States)

Suzuki, Mami; Yamanoi, Ayaka; Machino, Yusuke; Ootsubo, Michiko; Izawa, Ken-ichi; Kohroki, Junya; Masuho, Yasuhiko

2016-01-01

The Fc domain of human IgG1 binds to Fcγ receptors (FcγRs) to induce effector functions such as phagocytosis. There are four interchain disulfide bonds between the H and L chains. In this study, the disulfide bonds within the IgG1 trastuzumab (TRA), which is specific for HER2, were cleaved by mild S-sulfonation or by mild reduction followed by S-alkylation with three different reagents. The cleavage did not change the binding activities of TRA to HER2-bearing SK-BR-3 cells. The binding activities of TRA to FcγRIIA and FcγRIIB were greatly enhanced by modification with mild reduction and S-alkylation with ICH2CONH2 or N-(4-aminophenyl) maleimide, while the binding activities of TRA to FcγRI and FcγRIIIA were decreased by any of the four modifications. However, the interchain disulfide bond cleavage by the different modifications did not change the antibody-dependent cell-mediated phagocytosis (ADCP) of SK-BR-3 cells by activated THP-1 cells. The order of FcγR expression levels on the THP-1 cells was FcγRII > FcγRI > FcγRIII and ADCP was inhibited by blocking antibodies against FcγRI and FcγRII. These results imply that the effect of the interchain disulfide bond cleavage on FcγRs binding and ADCP is dependent on modifications of the cysteine residues and the FcγR isotypes. © The Authors 2015. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.

Multiple Plasmodium falciparum erythrocyte membrane protein 1 variants per genome can bind IgM via its Fc fragment Fcμ

DEFF Research Database (Denmark)

Jeppesen, Anine; Ditlev, Sisse Bolm; Soroka, Vladyslav

2015-01-01

with severe clinical manifestations, such as cerebral malaria in children and placental malaria in pregnant women. PfEMP1 that can bind the Fc part of IgM (Fcμ) characterizes one such type, although the functional significance of this IgM binding to PfEMP1 remains unclear. In this study, we report...... resemble the rosette-mediating and IgM-binding PfEMP1 HB3VAR06, but none of them mediated formation of rosettes. We could map the capacity for Fc-specific IgM binding to DBLε domains near the C terminus for three of the four PfEMP1 proteins tested. Our study provides new evidence regarding Fc...

Desarrollo y optimización de una jalea de piroxicam 0,5 % Development and optimization related to a 0.5 % Piroxican jelly

Directory of Open Access Journals (Sweden)

Oscar García Pulpeiro

2009-12-01

Full Text Available Se desarrolló por primera vez en Cuba, una formulación de jalea de piroxicam al 0,5 %. Se tomó como referencia la composición de la formulación líder del mercado FELDENE GELâ, a la cual se le efectuaron algunas modificaciones. Se realizaron 4 experimentos en las evaluaciones preliminares que sirvieron de base para la etapa posterior de diseño y optimización de la formulación. Se aplicó un diseño de experimentos con mezcla, para lo cual se emplearon como variables independientes la concentración de Carbopol 940, trietanolamina y hidroxipropilmetilcelulosa. Se evaluó la influencia de estos componentes en el pH, el área de extensibilidad y en algunas propiedades organolépticas. A partir de estos resultados, se seleccionó una formulación óptima.For the first time in Cuba a 0.5 % Piroxican jelly formula was developed. The point of reference was the leader formula from FELEDENE GELâ; market which underwent some modifications. During first assessments four experiments were carried out as basis for the later stage of formula design and optimization. An experimental design with mixture was applied using as independent variables the concentration of Carbopol 940, Trietanolamine, and Hidroxypropyl methylcellulose. Influence of these components on pH, the extensibility area, and on some organoleptic properties. From these results, an optimal formula was selected.

Substituição parcial do milho e farelo de soja por sorgo e farelo de caroço de algodão extrusado em rações de frangos de corte = Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations

Directory of Open Access Journals (Sweden)

André Carlos Silva Pimentel

2007-04-01

Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramentecasualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre otratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. Anexperiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC andcharacteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up to 13.31%, to improve the feed conversion.

46 CFR 90.05-5 - Specific application noted in text.

Science.gov (United States)

2010-10-01

... to which the text pertains, and in many cases limits the application of the text to vessels... 46 Shipping 4 2010-10-01 2010-10-01 false Specific application noted in text. 90.05-5 Section 90... VESSELS GENERAL PROVISIONS Application § 90.05-5 Specific application noted in text. (a) At the beginning...

Avaliar clinicamente uma solução contendo 0,12% de clorexidina, 0,05% de cetilpiridínico, e 0,05% de fluoreto de sódio na formação da placa e manchamento dental

OpenAIRE

Silva, Wagner Chagas da

2008-01-01

Apesar de sua eficácia no combate de infecções orais, a pigmentação de dentes e língua associada ao uso de soluções de clorexedina é um dos efeitos adversos que mais desencoraja o uso deste antisséptico por tempo prolongado. O objetivo deste estudo foi analisar o efeito da solução para bochecho contendo 0,12% de clorexidina, 0,05% de cetilpiridínio e 0,05% de fluoreto de sódio, na atividade anti- placa e formação da pigmentação extrínseca dental e da língua. Participara...

Efectos del entrenamiento continuo e interválico de carga externa similar sobre la frecuencia cardiaca Effects of continuous and interval training similar external load on heart rate

Directory of Open Access Journals (Sweden)

J. L. Tuimil

2010-09-01

Full Text Available

Los objetivos de este estudio fueron comparar la frecuencia cardíaca (FC media entre dos tipos de entrenamiento de carga externa equiparada basados en la carrera, la relación de la velocidad aeróbica máxima (VAM con la F.C. de reserva (FCR y los efectos de estos dos tipos de entrenamiento sobre la F.C. basal (FCB. El estudio se llevó a cabo con ocho estudiantes de educación física (23,25 años; VAM: 17,93 Km.h-1 que realizaron dos tipos de entrenamiento: CC =8 km al 70%VAM y CI= 4x(1000m al 90%VAM+1000m al 50% VAM. Se registró la FC durante el entrenamiento y la FCB antes y después del mismo. La diferencia de la FC media entre ambos métodos no fue estadísticamente significativa, sin embargo las medias del CC (FCCC (Z=2,240; p<0,05 y CI (FCCI (Z=2,380; p<0,05 fueron significativamente más elevadas que la calculada al 70% de FCR. La FCB se elevó de forma significativa (Z=2,319; p=0.020 solamente después del entrenamiento CI. En conclusión, dos métodos de entrenamiento distintos, pero de intensidad media similar, pueden dar lugar a una FC media también similar. La intensidad de carrera programada en función de la VAM es significativamente superior a la programada en función de la FCR. El entrenamiento interválico puede tener un mayor efecto sobre el incremento de la FCB.
PALABRAS CLAVE: Frecuencia cardíaca media, frecuencia cardíaca de reserva, frecuencia cardíaca basal, VAM, carrera continua, carrera interválica.

The aims of this study were to compare the mean heart rate response in two training methods of equal average intensity based on running, the relationship of the maximal aerobic speed (VAM with the reserve heart rate (FCR and the effects of these modes of training on the basal heart rate (FCB. The study was carried out with eight physical activity students (23,25 years old; VAM: 17,93 Km.h^-1

Estudo do crescimento inicial de plântulas de Cereus jamacaru DC em diferentes substratos

Directory of Open Access Journals (Sweden)

Wanderlucia Silva Rodrigues

2014-12-01

Full Text Available O presente trabalho objetivou avaliar o desenvolvimento de mudas de Cereus jamacaru DC, em substratos a base de fibra de coco e casca de arroz carbonizada. Os tratamentos utilizados foram dispostos em um delineamento inteiramente casualizado constituídos por cinco substratos a base de fibra de coco (FC e casca de arroz carbonizado (CAC, misturados com diferentes proporções volumétricas. Os tratamentos constituíram-se dos substratos 100% FC (T1, 100% CAC (T2, 75%FC+25%CAC (T3, 50%FC+50%CAC (T4, e 25%FC+75%CAC (T5. Cada tratamento foi composto por 14 repetições com 2 plantas por tratamento. Caixas de plástico transparente foram utilizados como recipientes. Aos 125 dias após o transplantio, foram avaliadas as seguintes variáveis das plântulas: comprimento, número, massa fresco e massa seco de raiz; massa fresco e massa seco da parte aérea; comprimento da parte aérea. Nas condições do experimento, conclui-se que o substrato composto somente por fibra de coco apresentou melhores resultados em todas as variáveis analisadas.

Raquianestesia unilateral com baixa dose de bupivacaína a 0,5% hiperbárica Raquianestesia unilateral con baja dosis de bupivacaína a 0,5% hiperbárica Unilateral spinal anesthesia with low 0.5% hyperbaric bupivacaine dose

Directory of Open Access Journals (Sweden)

Luiz Eduardo Imbelloni

2004-10-01

punta cortante, lenta velocidad de inyección y la posición lateral han sido relatados como facilitadores de la producción de raquianestesia unilateral. El presente estudio longitudinal investiga el grado de raquianestesia unilateral utilizando 5 mg de bupivacaína a 0,5% hiperbárica inyectada a través de aguja 27G tipo Quincke en el paciente en decúbito lateral, con miembro a ser operado vuelto para abajo. MÉTODO: Raquianestesia con 0,5% de bupivacaína fue realizada a través de aguja 27G Quincke en 30 pacientes estado físico ASA I y II sometidos a cirugías ortopédicas. La punción subaracnóidea fue realizada con el paciente previamente colocado con el lado a ser operado vuelto para abajo y fueron inyectados 5 mg de bupivacaína a 0,5% hiperbárica en la velocidad de 1 ml.15s-1. Bloqueos sensitivo y motor (picada de aguja y escala de 0 a 3 fueron comparados entre los lados a ser operados y el contralateral. RESULTADOS: Los bloqueos motor y sensitivo entre el lado operado y el contralateral fueron significativamente diferentes en todos los momentos. Raquianestesia unilateral fue obtenida en 85,7% de los pacientes. Estabilidad hemodinámica fue observada en todos los pacientes. Ningún paciente desenvolvió cefalea pós-raquianestesia. CONCLUSIONES: En las condiciones de este estudio la bupivacaína hiperbárica a 0,5% (5 mg proporcionó un predominante bloqueo unilateral. Veinte minutos fueron suficientes para la instalación del bloqueo. Las principales ventajas de la raquianestesia unilateral son la estabilidad hemodinámica, la satisfacción del paciente y recuperación mas rápida de la anestesia.BACKGROUND AND OBJECTIVES: Unilateral spinal anesthesia may be advantageous, especially for outpatient procedures. Low anesthetic doses, pencil point or cutting point needles, slow injection rate and the lateral position have been reported as helping unilateral spinal anesthesia technique. This longitudinal study aimed at investigating the depth of unilateral

Inhibición dual de la neprilisina y del receptor de la angiotensina (ARNI: una alternativa en los pacientes con falla cardiaca

Directory of Open Access Journals (Sweden)

Beatriz Wills

2016-03-01

Full Text Available La falla cardiaca (FC es la causa más común de admisión hospitalaria en adultos en el mundo. Además, de su importante prevalencia la FC tiene un alta tasa de mortalidad, se estima que aproximadamente el 50% de los pacientes con FC mueren a los 5 años posterior al egreso hospitalario. Esto ha motivado el desarrollo de nuevas terapias seguras y efectivas para el manejo de esta entidad. El LCZ696 es un inhibidor dual de la neprilisina y del receptor de angiotensina II que demostró en estudios de fase III disminuir el desenlace primario de muerte cardiovascular y hospitalización por empeoramiento de la FC y muerte global. Probablemente el LCZ696 se convertirá en la piedra angular del manejo en pacientes con FC con fracción de eyección deprimida.

Anti-influenza Hyperimmune Immunoglobulin Enhances Fc-functional Antibody Immunity during Human Influenza Infection.

Science.gov (United States)

Vanderven, Hillary A; Wragg, Kathleen; Ana-Sosa-Batiz, Fernanda; Kristensen, Anne B; Jegaskanda, Sinthujan; Wheatley, Adam K; Wentworth, Deborah; Wines, Bruce D; Hogarth, P Mark; Rockman, Steve; Kent, Stephen J

2018-05-31

New treatments for severe influenza are needed. Passive transfer of influenza-specific hyperimmune pooled immunoglobulin (Flu-IVIG) boosts neutralising antibody responses to past strains in influenza-infected subjects. The effect of Flu-IVIG on antibodies with Fc-mediated functions, which may target diverse influenza strains, is unclear. We studied the capacity of Flu-IVIG, relative to standard IVIG, to bind to Fc receptors and mediate antibody-dependent cellular cytotoxicity in vitro. The effect of Flu-IVIG infusion, compared to placebo infusion, was examined in serial plasma samples from 24 subjects with confirmed influenza infection in the INSIGHT FLU005 pilot study. Flu-IVIG contains higher concentrations of Fc-functional antibodies than IVIG against a diverse range of influenza hemagglutinins. Following infusion of Flu-IVIG into influenza-infected subjects, a transient increase in Fc-functional antibodies was present for 1-3 days against infecting and non-infecting strains of influenza. Flu-IVIG contains antibodies with Fc-mediated functions against influenza virus and passive transfer of Flu-IVIG increases anti-influenza Fc-functional antibodies in the plasma of influenza-infected subjects. Enhancement of Fc-functional antibodies to a diverse range of influenza strains suggests that Flu-IVIG infusion could prove useful in the context of novel influenza virus infections, when there may be minimal or no neutralising antibodies in the Flu-IVIG preparation.

Complexes prepared from protein A and human serum, IgG, or Fc gamma fragments: characterization by immunochemical analysis of ultracentrifugation fractions and studies on their interconversion.

Science.gov (United States)

Langone, J J; Das, C; Mainwaring, R; Shearer, W T

1985-01-01

Protein A of Staphylococcus aureus is an Fc receptor for IgG that has been used as a therapeutic reagent to treat cancer in humans and experimental animals. We used ultracentrifugation combined with analysis of isolated fractions by radioimmunoprecipitation and competitive radioimmunoassay with chicken antibodies that bind free protein A or protein A in complexes but do bind free immunoglobulin reagents to localize and characterize the types of complexes formed with different molar ratios of 125I-protein A and human 131I-IgG alone or in serum, and 131I-Fc gamma fragments. This approach offers a distinct advantage over direct counting of radioactivity in the fractions because resolution of complexes and free reagents is much improved. With excess 131I-IgG or 131I-Fc, all the 125I-protein A is present only in complexes that contained 4 molecules of immunoglobulin reagent and 2 molecules of protein A (4:2 complexes), whereas with excess 125I-protein A the stoichiometry of the complexes was 1:1. We have also shown the preformed 4:2 and 1:1 complexes will interconvert in the presence of added excess protein A or IgG, respectively, and that fresh IgG will exchange with IgG or Fc gamma in preformed complexes. Because protein A has been found to elute from an immobilized reagent used in serotherapy of human cancer and is present in a large excess of IgG, the 4:2 complexes may play an active role in the tumoricidal or toxic reactions observed.

Human IgG4 binds to IgG4 and conformationally altered IgG1 via Fc-Fc interactions

NARCIS (Netherlands)

Rispens, Theo; Ooievaar-de Heer, Pleuni; Vermeulen, Ellen; Schuurman, Janine; van der Neut Kolfschoten, Marijn; Aalberse, Rob C.

2009-01-01

The Fc fragment of IgG4 can interact with the Fc fragment of another IgG molecule. This interaction is a confounding factor when measuring IgG4 rheumatoid factor levels. Recently, we demonstrated that half-molecules of IgG4 can exchange to form a bispecific Ab. We expected these two phenomena to be

QUALIDADE DA CARNE DE PEITO DE FRANGOS DE CORTE SUBMETIDA A DIFERENTES PROCESSAMENTOS / QUALITY OF BROILER BREAST MEAT SUBJECTED TO DIFFERENT PROCESSING

Directory of Open Access Journals (Sweden)

Rodrigo Garófallo GARCIA

2010-11-01

Full Text Available O objetivo do trabalho foi avaliar as características da carne de peito de frango de corte submetida a diferentes soluções de marinação e tempo de maturação. Os tratamentos foram distribuídos em um arranjo fatorial 3x3 sendo três formas diferentes de marinação (controle-água, cloreto de sódio e glutamato monossódico e três tempos diferentes de maturação da carne na geladeira (0, 24, e 48 horas e foram avaliados o pH, perda de peso por cozimento (PPC, força de cisalhamento (FC, capacidade de retenção de água (CRA, perda de exudato (PE, dimensionamento de peito (DP e características sensoriais. O pH não houve alteração significativa (p>0,05 apresentou-se no índice de acidificação ideal. A PPC foi afetada pela marinação e tempo de maturação (p<0,05 tendo a solução salina menores perdas e a solução com glutamato maiores perdas na medida que aumentou-se o tempo de maturação. A FC mostrou que os filés marinados com a solução salina nos três tempos de maturação foram mais macios (p<0,001 que os dos tratamentos controle e glutamato. A CRA não foi influenciada pelos precessos de marinação e maturação. Na análise sensorial a maturação não favoreceu os atributos estudados e, a marinação com sal ou glutamato pode ser empregada para melhorar a maciez, suculência e palatabilidade.   Palavras-chave: qualidade de carne, filés de peito de frango.

Atividade antimicrobiana, antioxidante e teor de compostos fenólicos em casca e amêndoa de frutos de manga

Directory of Open Access Journals (Sweden)

Kettelin Aparecida Arbos

2013-04-01

Full Text Available O processamento industrial de frutos de manga gera elevada quantidade de resíduos agroindustriais, representados pelas cascas e sementes (amêndoa, os quais, sem aplicação viável, acabam sendo descartados diretamente no meio ambiente. Esses resíduos são ricos em compostos bioativos, amplamente reconhecidos pelas suas propriedades promotoras da saúde e em aplicações tecnológicas. Os objetivos foram avaliar as atividades antimicrobiana e antioxidante e o teor de compostos fenólicos de dois extratos: um obtido da casca (FC e outro da amêndoa (FA de manga variedade 'Tommy Atkins'. O teor de compostos fenólicos totais variou de 3.123 a 6.644 mg de catequina/100 g. Os extratos FC e FA demonstraram relevante atividade antimicrobiana frente às cepas das bactérias Escherichia coli, Salmonella sp., Pseudomonas aeruginosa . Staphylococcus aureus, determinadas pelo método de difusão em disco. A ação antioxidante de FC e FA aumentou com o aumento das concentrações testadas, atingindo o valor máximo de 88% (FC. Em todas as concentrações testadas os extratos FC apresentaram ação antioxidante significativamente superior às respectivas concentrações dos extratos FA. Esses resultados sugerem potencial aplicação dos resíduos de manga como fonte de compostos fenólicos, substâncias antimicrobianas e antioxidantes, podendo ser explorados pelas indústrias de alimentos.

La comunicación digital del FC Barcelona y del Real Madrid CF y su percepción por los periodistas deportivos / Digital communication of FC Barcelona and Real Madrid CF and its perception by sports journalists

Directory of Open Access Journals (Sweden)

Fernando Olabe Sánchez

2012-12-01

Full Text Available ResumenEl FC Barcelona y el Real Madrid CF han cambiado su modelo de gestión comunicativa, especialmente en su relación con los medios de comunicación. Favorecidos por la implantación de las TIC, los departamentos de Comunicación de estas entidades se constituyen en gatekeeper al controlar y emitir, a través de sus propios medios de comunicación, como las televisiones y radios propias y los soportes online, las informaciones que ellos mismos generan. De este modo, controlan los mensajes y los emiten directamente a sus públicos objetivos sin la intermediación de los medios convencionales, condicionando las rutinas productivas de los periodistas deportivos.El objetivo de este trabajo es mostrar la percepción que estos profesionales tienen sobre las diferentes herramientas y soportes online que los departamentos de Comunicación de estos clubes emplean en su actividad diaria con los medios.AbstractThe FC Barcelona and Real Madrid CF have changed their communicative management model, especially in its relationship with the media. Favored by the introduction of ICT, Communication departments of these entities constitute gatekeeper to control and issue, through their own media, such as television and radio stations and media own online, the information that they generate. Thus, controlling broadcast messages and their target audiences directly without the intermediation of the mainstream media, conditioning routines productive sports journalists.The aim of this paper is to show the perception that these professionals have about the different tools and online media Communication departments to use these clubs in their daily activities with the media.

EFECTO DEL CONSUMO DE CREATINA SOBRE LA EJECUCIÓN DE DESTREZAS REALIZADAS EN FORMA INTERMITENTE Y DE DURACIÓN PROLONGADA

Directory of Open Access Journals (Sweden)

Óscar Pablo Gutiérrez Sancho

2002-06-01

Full Text Available Se estudió el efecto de la suplementación con creatina (Crsobre el rendimiento en natación, ciclismo y atletismo en 10 mujeres. Las participantes debían realizar 4intervalos en cada deporte a máxima intensidad, además de un segmento aeróbico de 7 min post intervaloentre el 65 - 85% de la FCmáx. En un diseño de medidas repetidas, las atletas completaron 3 condicionesexperimentales: control (CT, suplementación con creatina (CCr, y condición placebo (PL. Se registró eltiempo de cada intervalo en las diferentes condiciones y se aplicaron 3 ANOVAS de medidas repetidas paracada deporte. Se encontraron interacciones entre los tratamientos y las mediciones en ciclismo (p = .001 yatletismo (p = .002. El análisis de seguimiento para la interacción de ciclismo reveló que todas lascondiciones fueron diferentes entre sí (p < 0.05, y que éstas diferencias en los promedios se encontraban enlos intervalos 1, 2 y 4. El análisis post-hoc de Tukey mostró diferencias (p < 0.05 en el intervalo 1 entre CT(M = 78.3 ± 11.58 s y PL (M = 75.2 ± 7.62 s (p < 0.05. En el intervalo 2 las diferencias fueron entre CT(M = 77.3 ± 7.97 s y CCr (M = 75.3 ± 7.97 s (p < 0.05; y entre CT (M = 77.3 ± 7.97 s y PL (M = 74.8 ±7.28 s (p < 0.05. En el intervalo 4, CCr (M = 77.5 ± 8.29 s y PL (M = 76.4 ± 7.49 s. El análisis deseguimiento de la interacción de atletismo mostró diferencias en los intervalos 1, 3 y 4. El análisis post-hocde Tukey indicó diferencias en el intervalo 1 de atletismo entre CCr (M = 96.6 ± 13.63 s y PL (M = 90.4 ±14.08 s y entre CCr (M = 96.6 ± 13.63 s y CT (M = 91.8 ± 9.73 s (p < 0.05. En el intervalo 3 hubodiferencias entre CT (M = 94.8 ± 13.60 s y PL (M = 90.2 ± 8.97 s. Por último, en el intervalo 4 lasdiferencias fueron entre CT (M = 96.9 ± 15.18 s y CCr (M = 90.3 ± 11.84 s; y entre CT (M = 96.9 ± 15.18s y PL (M = 90.7 ± 11.35 s (p < 0.05. Se concluye que durante las etapas de atletismo hubo un efecto positivo de la

Quantitative glycan profiling of normal human plasma derived immunoglobulin and its fragments Fab and Fc.

Science.gov (United States)

Anumula, Kalyan Rao

2012-08-31

Typical clinical grade human IgG (intravenous immunoglobulin, IVIG), used for carbohydrate analysis, is derived from thousands of healthy donors. Quantitative high-resolution glycan profiles of IgG and its Fc-Fab fragments are presented here. Glycan profiles were established following digestions with Fc specific endoglycosidase S and generic PNGase F under denaturing and non-denaturing (native) conditions. The native PNGase F glycan profile of IgG was similar (but not identical) to that of Endo S. Endo S profiles did not contain the glycans with bisecting GlcNAc. PNGase F glycan profiles were the same for Fc fragments that were isolated from pepsin and Ide S protease digests. Both isolated Fab fragments and the previously deglycosylated IVIG (native conditions) yielded the same glycan profile. Glycan profiles were established using high resolution HPLC with 2-aminobenzoic acid (2AA) labeling. An accurate determination of sialylation levels can be made by this method. Carbohydrate content in Fc and Fab was determined using an internal standard and corrected for both protein and glycan recoveries. Fab portion contained about 14% of the total carbohydrate which translates to 2.3 sugar chains per mol in IVIG where 2 chains are located in the CH2 domain of the Fc. Fc glycans consisted of neutral (N) 84.5%; mono-sialylated (S1) 15% and di-sialylated (S2) 0.5%. In contrast, Fab contained N, 21%; S1, 43% and S2, 36%. The distribution of bisecting N-acetylglucosamine and fucose was found to be very different in various glycans (N, S1 and S2) found in Fab and Fc. Total IgG glycan profile (Fab plus Fc) contained N, 78.5%; S1, 17% and S2, 4.5%. Percent distribution of glycans G0, G1 and G2 (with 0, 1 and 2 two galactoses) was 26, 49 and 25 respectively within the 78% of the neutral glycans. Glycan profiles were nearly the same for various clinical grade IVIG preparations from various manufacturers. A fast HPLC profiling method was developed for the separation and quantitation

The concession contracts assignment: general issues and controversies; A cessao de direitos e obrigacoes no contrado de concessao: aspectos gerais e questoes controversas

Energy Technology Data Exchange (ETDEWEB)

Rosa, Renata Gualberto Cordeiro [PETROBRAS, Rio de Janeiro, RJ (Brazil)

2008-07-01

Considering the activities of exploration and production of oil and natural gas and the concession regimen applicable to them in Brazil, the assignment of rights and obligations of the concession contract is analyzed from the points of view of the Petroleum Law and the contract itself. This paper intend to address the legal aspects that support the general legal authorization and the rules of the concession contract, as well as the role of ANP in the approval of the transfer and in the development of technical rules, regarding its function as a regulatory agency. Two controversial issues, the transfer with retroactive effects and the transfer of part of the concession area, are analyzed in light of the general features of the transfer of rights and obligations. Finally, the 'cessao de fato' and its consequences will be considered for the study of assignment of rights with retroactive effects and the operations of sole risk.. (author)

Can De Sitter spacetime be a final state of the contracting universe

International Nuclear Information System (INIS)

Berezin, V.A.

1984-01-01

This chapter attempts to phenomenologically describe the final stage of the Universe contraction. A model equation of state is used to demonstrate that during a cosmological contraction a de Sitter spacetime may be produced. It is shown that a equilibrium thermodynamic description of the matter in cosmological models leads to the absence of particle creation. It is proposed that these nonequilibrium processes be taken into account by introducing a new additional thermodynamic variable showing the explicit time dependence of all thermodynamic potentials into the thermodynamic relations. The spacetime is assumed to be homogeneous and isotropic, and the energy momentum tensor includes not only the energy density and pressure for the matter and radiation, but it also includes contributions due to vacuum polarization by correspondent fields. It is demonstrated that it is possible to reach in principle the de Sitter spacetime as the limit of the contraction

Características de las personas afectadas de fibrilación auricular en una consulta de cardiología

Directory of Open Access Journals (Sweden)

Patricia López-Mases

Full Text Available La Fibrilación auricular (FA presenta una elevada prevalencia en los ancianos. Se plantea como objetivo describir las características de la población afectada y valorar las relaciones existentes entre los diferentes aspectos medibles. Metodología: Estudio descriptivo e inferencial con muestreo por conveniencia, seleccionando todos los pacientes con episodios de FA asociados a frecuencias cardíacas (FC superiores a 80 ppm o que hayan revertido a ritmo sinusal, con el que se obtiene una muestra de 65 personas. Se han recopilado datos sociodemográficos, tipo de FA, variaciones en FC, visitas a urgencias y complicaciones. Los datos han sido analizados mediante el programa SPSS v.17.0. Resultados: La media de edad fue de 65 años. La FA paroxística se encuentra asociada a FC iniciales superiores a las del grupo de FA persistente, el cual se relaciona con edades más avanzadas. El grupo que acude a urgencias presenta FC iniciales superiores. Existen diferencias significativas, asociando directamente las consultas al servicio de urgencias con episodios de FA con FC elevadas que obliga a la derivación. A edades avanzadas, mayor asociación en el individuo de los factores de riesgo con los que esta se relaciona. Conclusiones: La FA es una de las arritmias más prevalentes, con un alto coste sanitario y con un empeoramiento de la calidad de vida, por lo que las actividades encaminadas a la detección precoz y tratamiento adecuado son fundamentales para su mejora.

Generation of high-affinity, internalizing anti-FGFR2 single-chain variable antibody fragment fused with Fc for targeting gastrointestinal cancers.

Science.gov (United States)

Borek, Aleksandra; Sokolowska-Wedzina, Aleksandra; Chodaczek, Grzegorz; Otlewski, Jacek

2018-01-01

Fibroblast growth factor receptors (FGFRs) are promising targets for antibody-based cancer therapies, as their substantial overexpression has been found in various tumor cells. Aberrant activation of FGF receptor 2 (FGFR2) signaling through overexpression of FGFR2 and/or its ligands, mutations, or receptor amplification has been reported in multiple cancer types, including gastric, colorectal, endometrial, ovarian, breast and lung cancer. In this paper, we describe application of the phage display technology to produce a panel of high affinity single chain variable antibody fragments (scFvs) against the extracellular ligand-binding domain of FGFR2 (ECD_FGFR2). The binders were selected from the human single chain variable fragment scFv phage display libraries Tomlinson I + J and showed high specificity and binding affinity towards human FGFR2 with nanomolar KD values. To improve the affinity of the best binder selected, scFvF7, we reformatted it to a bivalent diabody format, or fused it with the Fc region (scFvF7-Fc). The scFvF7-Fc antibody construct presented the highest affinity for FGFR2, with a KD of 0.76 nM, and was selectively internalized into cancer cells overexpressing FGFR2, Snu-16 and NCI-H716. Finally, we prepared a conjugate of scFvF7-Fc with the cytotoxic drug monomethyl-auristatin E (MMAE) and evaluated its cytotoxicity. The conjugate delivered MMAE selectively to FGFR2-positive tumor cells. These results indicate that scFvF7-Fc-vcMMAE is a highly potent molecule for the treatment of cancers with FGFR2 overexpression.

30 CFR 285.436 - Can MMS require lease or grant contraction?

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Can MMS require lease or grant contraction? 285... Administration Lease Or Grant Contraction § 285.436 Can MMS require lease or grant contraction? At an interval no more frequent than every 5 years, the MMS may review your lease or grant area to determine whether the...

Reproduction of the FC/DFC units in nucleoli.

Science.gov (United States)

Smirnov, Evgeny; Hornáček, Matúš; Kováčik, Lubomír; Mazel, Tomáš; Schröfel, Adam; Svidenská, Silvie; Skalníková, Magdalena; Bartová, Eva; Cmarko, Dušan; Raška, Ivan

2016-04-25

The essential structural components of the nucleoli, Fibrillar Centers (FC) and Dense Fibrillar Components (DFC), together compose FC/DFC units, loci of rDNA transcription and early RNA processing. In the present study we followed cell cycle related changes of these units in 2 human sarcoma derived cell lines with stable expression of RFP-PCNA (the sliding clamp protein) and GFP-RPA43 (a subunit of RNA polymerase I, pol I) or GFP-fibrillarin. Correlative light and electron microscopy analysis showed that the pol I and fibrillarin positive nucleolar beads correspond to individual FC/DFC units. In vivo observations showed that at early S phase, when transcriptionally active ribosomal genes were replicated, the number of the units in each cell increased by 60-80%. During that period the units transiently lost pol I, but not fibrillarin. Then, until the end of interphase, number of the units did not change, and their duplication was completed only after the cell division, by mid G1 phase. This peculiar mode of reproduction suggests that a considerable subset of ribosomal genes remain transcriptionally silent from mid S phase to mitosis, but become again active in the postmitotic daughter cells.

Construction of a bimolecular fluorescence complementation (BiFC ...

African Journals Online (AJOL)

Protein–protein interactions are essential for signal transduction in cells. Bimolecular fluorescence complementation (BiFC) is a novel technology that utilises green fluorescent proteins to visualize protein–protein interactions and subcellular protein localisation. BiFC based on pSATN vectors are a good system for ...

The effect of texture in (Bi3.5Nd0.5)(Ti2.97Nb0.03)O12 ceramics

Science.gov (United States)

Cao, Ziping; Ding, Aili; Zheng, Xinsen; Qiu, Pingsun; Cheng, Wenxiu

2004-11-01

(Bi3.5Nd0.5) (Ti2.97Nb0.03)O12 ferroelectric ceramics was successfully prepared by a hot-pressing method. XRD diffraction confirms that the samples hold different texture in the sliced planes parallel and perpendicular to the hot-pressing axis, respectively. The anisotropy of ferroelectric, dielectric and piezoelectric properties were all observed in the textured ceramics. Due to the great improvement of ferroelectric and piezoelectric properties, the sample which was sliced along the direction parallel to the hot-pressing axis can be considered as a good candidate of high temperature piezoelectric materials.

Hubungan Polimorfisme Gen FcγRIIA dengan Densitas P. falciparum dan Efikasi Dihidroartemisinin-Piperakuin

Directory of Open Access Journals (Sweden)

Sylvia Sance Marantina

2016-06-01

Full Text Available Dimorfisme FcγRlla memiliki keterkaitan dengan kemampuan inang dalam mengeliminasi parasit malaria sehingga perlu dilakukan penelitian untuk mengetahui polimorfisme alel FcγRlla dari populasi di daerah endemis malaria di Indonesia agar dapat diketahui peran imunitas dalam mengeliminasi parasit malaria. Sebanyak 120 sampel dried blood spot (DBS malaria falsifarum yang diperoleh dari studi efikasi obat DHP di lima wilayah di Indonesia dianalisis dengan polymerase chain reaction (PCR dan sekuensing untuk melihat varian alel FcγRIIa-131 serta hubungannya dengan densitas parasit dan efikasi dihidroartemisinin-piperakuin. Analisis gen FcγRIIa menunjukkan bahwa genotip RH memiliki frekuensi paling tinggi (50,8% dibandingkan RR (17,5% dan HH (31,7%. Alel R131 gen FcγRIIa menunjukkan efek protektif terhadap high density parasitemia/HDP (>5000 parasit/μL; odds ratio [OR]= 0,133, 95% confidence interval [CI]= 0,053–0,334, p< 0,001 dan berhubungan dengan keberadaan gametosit yang lebih lama pada inang (>72 jam; relative risk [RR]= 1,571, 95% confidence interval [CI]= 1,005–2,456, p= 0,090. Kata Kunci: malaria falsiparum, dihidroartemisinin-piperakuin, K13, FcγRIIa, efikasi obat Polymorphism of Human FcγRIIa and Its Association with P. falciparum Density and Efficacy of Dihydroartemisinin- Piperaquine Abstract FcγRlla dimorphism has been related to the ability of the host to eliminate malaria parasite so it is necessary to investigate the allele polymorphism FcγRlla of population in malaria-endemic areas in Indonesia in order to know the role of immunity in eliminating malaria parasite. A total of 120 samples of Dried Blood Spot (DBS falciparum malaria acquired from DHP drug efficacy studies in 5 regions in Indonesia were analyzed by Polymerase Chain Reaction (PCR and sequencing, to look at variants of FcγRIIa-131 allele and its Association with Parasite DensityandEfficacy ofDihydroartemisinin- Piperaquine. The FcγRIIa gene analysis indicated

Yield and quality of tomato produced on substrates and with application of humic acids Produtividade e qualidade de tomate produzido em substratos e com aplicação de ácidos húmicos

Directory of Open Access Journals (Sweden)

Antonio A de Lima

2011-09-01

Full Text Available The aim of this work was to evaluate the yield and quality of tomato fruits, hybrid "Vênus", produced on substrates and with application of nutrient solution and humic acids (AH. Four doses of AH were evaluated (0, 20, 40 and 80 L ha-1 and 4 substrates: S1 (coconut fiber (CF, S2 (FC + carbonized coffee husk (CC in the ratio 1:3, S3 (CF + CC in the ratio 2:3 and S4 (CC, were evaluated following the randomized blocks design in factorial 4x4 scheme with four replications. The 35-day old seedlings were transplanted into plastic bags of 7 L. The humic acids were applied four times in eight-day intervals, and the first application was carried out eight days after transplanting. There was no significant effect of AH on the yield and quality of fruit, except in relation to soluble solids (SS/titratable acidity (AT. Doses of up to 36 L ha-1, increase the AT, above that amount favored increase of SS. The carbonized coffee husk in treatments S2, S3 and S4, did not alter the production of small fruits, medium, non-commercial, moisture, pH, SS, AT and SS/AT, however, significantly reduced the total production, commercial and large size fruit. The production of fruits in S1 was significantly higher compared to the other treatments, with an average of 142.6 t ha-1, showing average increase in yield of 24.4%, 29.3% and 36.1% compared to plant of treatments S2, S3 and S4, respectively.Este trabalho foi realizado com o objetivo de avaliar a produtividade e qualidade de frutos de tomateiro, híbrido Vênus, produzidos em substratos, com aplicação de solução nutritiva e de ácidos húmicos (AH. Foram avaliadas 4 doses de AH (0, 20, 40 e 80 L ha-1 e 4 substratos: S1 (fibra de coco (FC, S2 (FC + casca de café carbonizada (CC na proporção 1:3, S3 (FC + CC na proporção 2:3 e S4 (CC. O delineamento experimental foi em blocos casualizados distribuídos em esquema fatorial 4x4. As mudas foram transplantadas com 35 dias para sacolas plásticas com capacidade de 7

Aplicação de dessecantes na cultura de soja: antecipação da colheita e produção de sementes Application of desiccants on soybean crop glycine max: harvest anticipation and seed yield

Directory of Open Access Journals (Sweden)

A.L.S. Lacerda

2001-12-01

Full Text Available Este trabalho foi conduzido no município de Selvíria-MS, semeando soja do cultivar IAC-15. O delineamento experimental utilizado foi o de blocos casualizados, estando os tratamentos dispostos em um esquema fatorial 3x3 e 4x4, sendo os fatores os produtos (dessecantes e as épocas de aplicação, nos anos agrícolas 1996/97 e 1997/98, respectivamente. Os dessecantes utilizados foram: paraquat, diquat e mistura paraquat + diquat, nas dosagens de 0,4; 0,3 e 0,2+0,15 em 1996/97, respectivamente, e os mesmos tratamentos em 1997/98, além do glufosinato de amônio na dosagem de 0,4 kg i.a. ha-1 em 1997/98. Como épocas, foram realizadas três aplicações em 1996/97 e quatro em 1997/98, todas espaçadas de cinco dias a partir do estádio fenológico médio da cultura R6. Concluiu-se que os dessecantes utilizados mostraram-se eficientes na dessecação da soja; foi possível obter antecipação da colheita de sementes de soja, sem alterar a produção, por um período máximo de sete dias.This research was carried out in Selvíria-MS, Brazil, during the growing seasons of 1996/97 and 1997/98, using the soybean cultivar IAC-15. The experimental design was arranged in randomized complete blocks in a 3x3 and 4x4 factorial scheme during 1996/97 and 1997/98, respectively, with the factors being the products (desiccants and timing of application. The desiccants sprayed were: paraquat, diquat and a mixture of paraquat + diquat at rates of 0.4; 0.3 and 0.2+0.15 in 1996/97 and the same treatments in 1997/98 added to ammonium glufosinate at 0.4 kg a.i. ha-1 in 1997/98. The timing of application was spaced every five days, starting from the soybean vegetative stage R6. The tested desiccants were efficient on the soybean desiccation ; it was possible to obtain grain harvest anticipation, without yield reduction, in a maximum period of seven days.

46 CFR 50.05-5 - Existing boilers, pressure vessels or piping systems.

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Existing boilers, pressure vessels or piping systems. 50... ENGINEERING GENERAL PROVISIONS Application § 50.05-5 Existing boilers, pressure vessels or piping systems. (a) Whenever doubt exists as to the safety of an existing boiler, pressure vessel, or piping system, the marine...

Coordinate expression of activating Fc gamma receptors I and III and inhibiting Fc gamma receptor type II in the determination of joint inflammation and cartilage destruction during immune complex-mediated arthritis.

NARCIS (Netherlands)

Nabbe, K.C.A.M.; Blom, A.B.; Holthuysen, A.E.M.; Boross, P.; Roth, J.; Verbeek, S.; Lent, P.L.E.M. van; Berg, W.B. van den

2003-01-01

OBJECTIVE: To study the role of the activating Fc gamma receptor types I and III (Fc gamma RI and Fc gamma RIII, respectively) and the inhibiting Fc gamma receptor II (Fc gamma RII) in inflammation and in various aspects of cartilage destruction during arthritis that is solely induced by immune

Neutron Reflection Study of Surface Adsorption of Fc, Fab, and the Whole mAb.

Science.gov (United States)

Li, Zongyi; Li, Ruiheng; Smith, Charles; Pan, Fang; Campana, Mario; Webster, John R P; van der Walle, Christopher F; Uddin, Shahid; Bishop, Steve M; Narwal, Rojaramani; Warwicker, Jim; Lu, Jian Ren

2017-07-12

Characterizing the influence of fragment crystallization (Fc) and antigen-binding fragment (Fab) on monoclonal antibody (mAb) adsorption at the air/water interface is an important step to understanding liquid mAb drug product stability during manufacture, shipping, and storage. Here, neutron reflection is used to study the air/water adsorption of a mAb and its Fc and Fab fragments. By varying the isotopic contrast, the adsorbed amount, thickness, orientation, and immersion of the adsorbed layers could be determined unambiguously. While Fc adsorption reached saturation within the hour, its surface adsorbed amount showed little variation with bulk concentration. In contrast, Fab adsorption was slower and the adsorbed amount was concentration dependent. The much higher Fc adsorption, as compared to Fab, was linked to its lower surface charge. Time and concentration dependence of mAb adsorption was dominated by Fab behavior, although both Fab and Fc behaviors contributed to the amount of mAb adsorbed. Changing the pH from 5.5 to 8.8 did not much perturb the adsorbed amount of Fc, Fab, or mAb. However, a small decrease in adsorption was observed for the Fc over pH 8-8.8 and vice versa for the Fab and mAb, consistent with a dominant Fab behavior. As bulk concentration increased from 5 to 50 ppm, the thicknesses of the Fc layers were almost constant at 40 Å, while Fab and mAb layers increased from 45 to 50 Å. These results imply that the adsorbed mAb, Fc, and Fab all retained their globular structures and were oriented with their short axial lengths perpendicular to the interface.

Identification of Fc Gamma Receptor Glycoforms That Produce Differential Binding Kinetics for Rituximab.

Science.gov (United States)

Hayes, Jerrard M; Frostell, Asa; Karlsson, Robert; Müller, Steffen; Martín, Silvia Míllan; Pauers, Martin; Reuss, Franziska; Cosgrave, Eoin F; Anneren, Cecilia; Davey, Gavin P; Rudd, Pauline M

2017-10-01

Fc gamma receptors (FcγR) bind the Fc region of antibodies and therefore play a prominent role in antibody-dependent cell-based immune responses such as ADCC, CDC and ADCP. The immune effector cell activity is directly linked to a productive molecular engagement of FcγRs where both the protein and glycan moiety of antibody and receptor can affect the interaction and in the present study we focus on the role of the FcγR glycans in this interaction. We provide a complete description of the glycan composition of Chinese hamster ovary (CHO) expressed human Fcγ receptors RI (CD64), RIIa Arg131/His131 (CD32a), RIIb (CD32b) and RIIIa Phe158/Val158 (CD16a) and analyze the role of the glycans in the binding mechanism with IgG. The interactions of the monoclonal antibody rituximab with each FcγR were characterized and we discuss the CHO-FcγRIIIa Phe158/Val158 and CHO-FcγRI interactions and compare them to the equivalent interactions with human (HEK293) and murine (NS0) produced receptors. Our results reveal clear differences in the binding profiles of rituximab, which we attribute in each case to the differences in host cell-dependent FcγR glycosylation. The glycan profiles of CHO expressed FcγRI and FcγRIIIa Phe158/Val158 were compared with the glycan profiles of the receptors expressed in NS0 and HEK293 cells and we show that the glycan type and abundance differs significantly between the receptors and that these glycan differences lead to the observed differences in the respective FcγR binding patterns with rituximab. Oligomannose structures are prevalent on FcγRI from each source and likely contribute to the high affinity rituximab interaction through a stabilization effect. On FcγRI and FcγRIIIa large and sialylated glycans have a negative impact on rituximab binding, likely through destabilization of the interaction. In conclusion, the data show that the IgG1-FcγR binding kinetics differ depending on the glycosylation of the FcγR and further support a

Evaluación costo-efectividad de lidocaína al 5 % y bupivacaína al 0,5 % en anestesia espinal

Directory of Open Access Journals (Sweden)

Eréndira González Orozco

Full Text Available Se realizó un estudio económico prospectivo de costo-efectividad con datos primarios de efectividad obtenidos de un ensayo clínico aleatorizado, donde se comparan 2 anestésicos vía espinal: lidocaína al 5 % y bupivacaína al 0,5 %. La efectividad se evaluó como la probabilidad de aparición de síntomas neurológicos transitorios, reacción adversa propia de este grupo de medicamentos. Se formaron aleatoriamente 2 grupos de pacientes que requerían cirugías por debajo del ombligo con una duración no mayor de 120 min, con la aplicación de cada una de las opciones de anestesia estudiada a cada grupo, 109 pacientes en el grupo de lidocaína y 97 en el grupo de bupivacaína. Un especialista en Neurología evaluó a ciegas la condición neurológica posquirúrgica de cada paciente antes y 24 h después de la intervención. Se calcularon los costos de cada alternativa, que incluyeron los ocasionados por la toxicidad neurológica, y se determinaron las relaciones costo-efectividad y los costos incrementales. El grupo de bupivacaína resultó la alternativa con mejor relación costo-efectividad

48 CFR 12.505 - Applicability of certain laws to contracts for the acquisition of COTS items.

Science.gov (United States)

2010-10-01

... laws to contracts for the acquisition of COTS items. 12.505 Section 12.505 Federal Acquisition... Items 12.505 Applicability of certain laws to contracts for the acquisition of COTS items. COTS items.... In addition, the following laws are not applicable to contracts for the acquisition of COTS items: (a...

Desarrollo y optimización de una jalea de piroxicam 0,5 %

Directory of Open Access Journals (Sweden)

Oscar García Pulpeiro

Full Text Available Se desarrolló por primera vez en Cuba, una formulación de jalea de piroxicam al 0,5 %. Se tomó como referencia la composición de la formulación líder del mercado FELDENE GELâ, a la cual se le efectuaron algunas modificaciones. Se realizaron 4 experimentos en las evaluaciones preliminares que sirvieron de base para la etapa posterior de diseño y optimización de la formulación. Se aplicó un diseño de experimentos con mezcla, para lo cual se emplearon como variables independientes la concentración de Carbopol 940, trietanolamina y hidroxipropilmetilcelulosa. Se evaluó la influencia de estos componentes en el pH, el área de extensibilidad y en algunas propiedades organolépticas. A partir de estos resultados, se seleccionó una formulación óptima.

Sweat conductivity and coulometric quantitative test in neonatal cystic fibrosis screening

Directory of Open Access Journals (Sweden)

Mouseline Torquato Domingos

2015-11-01

Full Text Available Objective: To compare the results obtained with the sweat test using the conductivity method and coulometric measurement of sweat chloride in newborns (NBs with suspected cystic fibrosis (CF in the neonatal screening program. Methods: The sweat test was performed simultaneously by both methods in children with and without CF. The cutoff values to confirm CF were >50 mmol/L in the conductivity and >60 mmol/L in the coulometric test. Results: There were 444 infants without CF (185 males, 234 females, and 24 unreported submitted to the sweat test through conductivity and coulometric measurement simultaneously, obtaining median results of 32 mmol/L and 12 mmol/L, respectively. For 90 infants with CF, the median values of conductivity and coulometric measurement were 108 mmol/L and 97 mmol/L, respectively. The false positive rate for conductivity was 16.7%, and was higher than 50 mmol/L in all patients with CF, which gives this method a sensitivity of 100% (95% CI: 93.8–97.8, specificity of 96.2% (95% CI: 93.8–97.8, positive predictive value of 83.3% (95% CI: 74.4–91.1, negative predictive value of 100% (95% CI: 90.5–109.4, and 9.8% accuracy. The correlation between the methods was r = 0.97 (p > 0.001. The best suggested cutoff value was 69.0 mmol/L, with a kappa coefficient = 0.89. Conclusion: The conductivity test showed excellent correlation with the quantitative coulometric test, high sensitivity and specificity, and can be used in the diagnosis of CF in children detected through newborn screening. Resumo: Objetivo: Comparar os resultados obtidos no teste do suor pelo método da condutividade e a dosagem coulométrica de cloreto no suor em recém nascidos (RN suspeitos da triagem neonatal para fibrose cística (FC. Métodos: O teste do suor foi realizado simultaneamente pelos dois métodos em crianças com e sem FC. Os valores de corte para confirmar FC foram na condutividade > 50 mmol/L e no teste coulométrico > 60�

PRODUCCIÓN DE BIOMASA Y EXOPOLISACÁRIDOS DE Grifóla frondosa BAJO CULTIVO SUMERGIDO UTILIZANDO FUENTES DE CARBONO NO CONVENCIONALES

Directory of Open Access Journals (Sweden)

Paula Zapata

2007-06-01

Full Text Available Grifóla frondosa es un hongo Basidiomycete comestible y medicinal que produce polisacáridos tipo glucanos (β-1,6 y β-1,3 con actividad antitumoral e inmunomoduladora. Para el presente trabajo, el objetivo fue evaluar la incidencia de diferentes fuentes de carbono (FC en la producción de biomasa y exopolisacári-dos (EPS, bajo condiciones de cultivo sumergido, utilizando un diseño estadístico factorial con dos factores: fuente de carbono (FC(1-7 y medio (MB y MS. La máxima producción de biomasa micelial (21,10 ± 0,82 g/l y la máxima producción de EPS (6,53 ± 0,14 g/l se logró utilizando el medio MB suplementado con FC4. Además de lo anterior, se logró desarrollar un medio de cultivo que cumple con el objetivo de disminuir costos, de Col $18.455 a $656 por litro de medio, produciendo (14,14 ± 0,82 g/l de biomasa y (5,16 ± 0,14 g/l de EPS, utilizando el medio MS suplementando con FC4. Estos resultados abren nuevas alternativas y posibilidades en nuestro país para el desarrollo de productos a partir de esta especie con costos que estén al alcance de la población.Grifóla frondosa is a Basidiomycete fungus edible and medicinal, it produces polysaccharides such a glucans (β-1,6 and β-1,3 with anti-tumor and inmuno-stimulating activity. For this work, the aim was evaluate the incidence of different carbon sources (FC in biomass and exo-polymer (EPS production, under submerged culture conditions, by using a factorial statistical design with two factors: carbon source (FC(1-7 and medium (MB and MS. The maximal yield of mycelial biomass (21,10 ± 0,82 g/l and the maximal yield in EPS (6,53 ± 0,14 g/l was achieved by using the MB medium supplemented with FC4. Besides, it was possible to develop a medium that fulfills the objective of reducing costs from $18.455 to $656 Colombian pesos for each liter of medium used, which produces (14,14 ± 0,82 g/l of biomass and (5,16 ± 0,14 g/l of EPS, using the MS medium supplemented with FC4

27 CFR 19.97 - Taxpaid spirits or wines on bonded premises.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Taxpaid spirits or wines... Miscellaneous Provisions Conveyance of Spirits Or Wines on Plant Premises § 19.97 Taxpaid spirits or wines on bonded premises. Spirits or wines on which the tax has been paid or determined may be conveyed within a...

RESPUESTAS CARDIOVASCULARES AL ENTRENAMIENTO DE FUERZA BAJO OCLUSIÓN VASCULAR [Cardiovascular responses to strength training under occlusive training

Directory of Open Access Journals (Sweden)

Sergio Benito Hernández

2013-11-01

Full Text Available El entrenamiento de la fuerza bajo oclusión vascular se muestra como una alternativa al entrenamiento de alta intensidad. El presente estudio muestra las respuestas cardiovasculares a este tipo de entrenamiento. 10 sujetos fueron sometidos a dos protocolos de entrenamiento oclusivo diferenciados por el peso levantado, (30% del peso máximo, post30, y 70% del peso máximo, post70. Se registraron los valores de tensión arterial sistólica (TAS, diastólica (TAD y frecuencia cardiaca (FC. Los resultados evidencian disminución significativa en TAS y TAD en el grupo post30 en 7 y 13 mm Hg respectivamente en referencia a los valores basales (p<0.05, resultando un descenso muy significativo en el grupo post70, 14 y 20 mm Hg respectivamente (p<0.005. Los valores de la FC no se vieron alterados por ninguno de los protocolos experimentales (p>0.05. Los efectos de tamaño para todos los grupos resultaron triviales (d<0.25. En conclusión los resultados del presente estudios presentan una tendencia a la reducción de la tensión arterial significativa en TAS y TAD en los protocolos de entrenamiento oclusivo, resultando más notable cuando se aplica la mayor intensidad de entrenamiento. Resultan necesarios más estudios que examinen el comportamiento de los parámetros cardiovasculares tras el entrenamiento de fuerza bajo oclusión vascular.AbstractOcclusive strength training is shown like an alternative to intensive training. Present study shown cardiovascular responses to this training. 10 subjects were subjected to two occlusion training protocols, differentiated by the weight lifted (30 % of maximum weight lifted, post30, and 70 % of maximum weight lifted, post70. The values of arterial systolic tension (TAS, diastolic (TAD and heart rate (FC were recorded. The results showing a significant decline in TAS and TAD after post30 of 7 and 13 mm Hg respectively from basis values (p<0.05, resulting a very significant decline in post70 group, 14 and 20 mm Hg

29 CFR 97.22 - Allowable costs.

Science.gov (United States)

2010-07-01

... accounting standards that comply with cost principles acceptable to the Federal agency. [53 FR 8069, 8087... LOCAL GOVERNMENTS Post-Award Requirements Financial Administration § 97.22 Allowable costs. (a... increment above allowable costs) to the grantee or subgrantee. (b) Applicable cost principles. For each kind...

Automatic Conflict Detection on Contracts

Science.gov (United States)

Fenech, Stephen; Pace, Gordon J.; Schneider, Gerardo

Many software applications are based on collaborating, yet competing, agents or virtual organisations exchanging services. Contracts, expressing obligations, permissions and prohibitions of the different actors, can be used to protect the interests of the organisations engaged in such service exchange. However, the potentially dynamic composition of services with different contracts, and the combination of service contracts with local contracts can give rise to unexpected conflicts, exposing the need for automatic techniques for contract analysis. In this paper we look at automatic analysis techniques for contracts written in the contract language mathcal{CL}. We present a trace semantics of mathcal{CL} suitable for conflict analysis, and a decision procedure for detecting conflicts (together with its proof of soundness, completeness and termination). We also discuss its implementation and look into the applications of the contract analysis approach we present. These techniques are applied to a small case study of an airline check-in desk.

The effect of texture in (Bi3.5Nd0.5)(Ti2.97Nb0.03)O12 ceramics

International Nuclear Information System (INIS)

Cao, Ziping; Ding, Aili; Zheng, Xinsen; Qiu, Pingsun; Cheng, Wenxiu

2004-01-01

(Bi 3.5 Nd 0.5 ) (Ti 2.97 Nb 0.03 )O 12 ferroelectric ceramics was successfully prepared by a hot-pressing method. XRD diffraction confirms that the samples hold different texture in the sliced planes parallel and perpendicular to the hot-pressing axis, respectively. The anisotropy of ferroelectric, dielectric and piezoelectric properties were all observed in the textured ceramics. Due to the great improvement of ferroelectric and piezoelectric properties, the sample which was sliced along the direction parallel to the hot-pressing axis can be considered as a good candidate of high temperature piezoelectric materials. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Resposta cronotrópica ao teste anaeróbio máximo de corrida - MART

Directory of Open Access Journals (Sweden)

Flávio Areal Lemos

2013-06-01

Full Text Available INTRODUÇÃO: A frequência cardíaca (FC no teste anaeróbio máximo de corrida (MART expressa o comportamento autonômico cardíaco em exercício. Ainda não foi investigado se tais respostas cronotrópicas apresentam associação com o desempenho aeróbio e anaeróbio. OBJETIVOS: Descrever a resposta cronotrópica cardíaca durante o MART nos segundos iniciais de estímulo (FC ON e de recuperação (FC OFF e estabelecer a associação entre as variáveis cronotrópicas com o desempenho aeróbio e anaeróbio. MÉTODOS: Foram voluntários 13 homens assintomáticos e fisicamente ativos, com 25,1 ± 4,9 anos, 76,8 ± 12,5 kg, 178,4 ± 9,0 cm e 50,6 ± 4,1 mL×kg‑1×min‑1. Na primeira visita, após a anamnese e medidas antropométricas, foi realizado um teste cardiopulmonar de exercício (TCPE com monitoração direta dos gases expirados. Na segunda visita, foi feita uma familiarização ao MART e na terceira, o teste de MART conduzido até a exaustão. RESULTADOS: A FC de recuperação (58 ± 20 bpm comparada à FC de pico alcançada no primeiro e no último estágio de MART (39 ± 14 bpm apresentou maior inclinação, resultando em maior amplitude de variação ao longo do teste, caracterizando diferenças significativas (P = 0,0017. A FC ON apresentou entre o momento inicial, meio e final do MART diferenças significativas (inicial versus final, p = 0,007. Para FC OFF foram encontradas diferenças significativas do início com o meio (p = 0,035 e do início com o final (p = 0,005 do teste. As correlações entre as variáveis cronotrópicas e de desempenho não apresentaram significância estatística (P < 0,05, assim como com as variáveis de desempenho. CONCLUSÃO: O MART parece ser um modelo de sobrecargas fisiológicas adequado para investigação da modulação autonômica cardíaca. Observou-se atuação do sistema parassimpático mesmo em cargas supramáximas até o final do teste.

Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D.

Science.gov (United States)

Kapur, Rick; Della Valle, Luciana; Verhagen, Onno J H M; Hipgrave Ederveen, Agnes; Ligthart, Peter; de Haas, Masja; Kumpel, Belinda; Wuhrer, Manfred; van der Schoot, C Ellen; Vidarsson, Gestur

2015-03-01

RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions with FcγRIII, with less Fc-fucosylation strengthening the interaction. Anti-D IgG1 Fc-glycosylation patterns in 93 plasma samples from 28 male and 28 female Dutch HIDs and RhIG were analyzed with mass spectrometry. The Fc-glycosylation profiles of HIDs were evaluated with regard to their immunization history. HID sera demonstrated clearly lowered anti-D Fc-fucosylation compared to normal IgG fucosylation (93%); this was more pronounced for female than for male HIDs (47% vs. 65%, p = 0.001). RhIG preparations from seven manufacturers varied greatly in the level of Fc-fucosylation (56%-91%). The level of fucosylation slightly increased upon repeated immunization, although it remained fairly constant over time. The RhIG from the different manufacturers all demonstrated increased Fc-galactosylation (64%-82%) compared to total IgG (38%-51%). RhIG preparations vary in Fc-fucosylation and all demonstrate increased galactosylation. Despite not knowing the exact working mechanism, immunoprophylaxis could perhaps be optimized by selection of donors whose anti-D have low amounts of Fc-fucose, to increase the clearance activity of anti-D preparations, as well as high amounts of galactosylation, for anti-inflammatory effects. Implementing a biologic assay in the standardization of RhIG preparations might be considered. © 2014 AABB.

Advances in therapeutic Fc engineering - modulation of IgG associated effector functions and serum half-life

Directory of Open Access Journals (Sweden)

Abhishek Saxena

2016-12-01

Full Text Available Today monoclonal immunoglobulin gamma (IgG antibodies have become a major option in cancer therapy especially for the patients with advanced or metastatic cancers. Efficacy of monoclonal antibodies (mAbs are achieved through both its antigen binding fragment (Fab and crystallizable fragment (Fc. Fab can specifically recognize tumor associated antigen (TAA and thus modulate TAA-linked downstream signaling pathways that may lead to inhibition of tumor growth, induction of tumor apoptosis and differentiation. The Fc region can further improve mAbs’ efficacy by mediating effector functions such as antibody-dependent cellular cytotoxicity (ADCC, complement-dependent cytotoxicity (CDC and antibody dependent cell-mediated phagocytosis (ADCP. Moreover, Fc is the region interacting with the neonatal Fc receptor (FcRn in a pH-dependent manner that can slow down IgG’s degradation and extend its serum half-life. Loss of the antibody Fc region dramatically shortens its serum half-life and weakens its anti-cancer effects. Given the essential roles that the Fc region plays in the modulation of the efficacy of mAb in cancer treatment, Fc engineering has been extensively studied in the past years. This review focuses on the recent advances in therapeutic Fc engineering that modulates its related effector functions and serum half-life. We also discuss the progress made in aglycosylated mAb development that may substantially reduce cost of manufacture but maintain similar efficacies as conventional glycosylated mAb. Finally, we highlight several Fc engineering based mAbs under clinical trials.

Top-down and middle-down approach by fraction collection enrichment using off-line capillary electrophoresis - mass spectrometry coupling: Application to monoclonal antibody Fc/2 charge variants.

Science.gov (United States)

Biacchi, Michael; Said, Nassur; Beck, Alain; Leize-Wagner, Emmanuelle; François, Yannis-Nicolas

2017-05-19

The characterization of complex protein mixtures represents one of the biggest challenge in many research fields such as biological or biopharmaceutical sciences. Out of all categories, monoclonal antibodies (mAbs) and related products drawn the most interest due to their strong therapeutic potency and specificity. Because of their intrinsic complexity due to a large number of micro-heterogeneities, there is a crucial need for analytical methods to provide comprehensive in-depth characterization of these proteins. In this work, we developed a methodology using CE-UV/MALDI-MS to perform top-down or middle-down characterization after fraction collection enrichment applied to intact protein and mAbs samples. The performance of the method was evaluated with the rapid separation of three intact protein mixture. Good robustness of CZE separation and quality of MALDI-MS spectra and MALDI-ISD spectra of each protein confirms the usefulness of sample enrichment to obtain adequate quantity of deposed protein for top-down analysis and the proof of principle of the method. In a second step, the method was applied to the middle-down characterization of Fc/2 cetuximab variants. Identification of around 9% sequence coverage of Fc/2 cetuximab fragments allows to conclude on the feasibility of the strategy for middle-down characterization of Fc/2 cetuximab variants using CE-UV/MALDI-MS. Moreover, MALDI-ISD fragmentation of Fc/2 cetuximab variants confirm separation phenomenon based on the formation of Fc/2 dimers with and without C-terminal truncation. Copyright © 2017 Elsevier B.V. All rights reserved.

41 CFR 102-74.500 - Can Federal agencies disapprove permit applications or cancel issued permits?

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can Federal agencies disapprove permit applications or cancel issued permits? 102-74.500 Section 102-74.500 Public Contracts and... cancel issued permits? Yes, Federal agencies may disapprove any permit application or cancel an issued...

Chelate-size effects on the structures, chemical behavior, properties, and catalytic activity of the new palladium(II)-allyl complexes [Pd(eta(3)-1-R-1-C3H4){FcCH=N-CH2-(CH2)(n)-NMe2}][PF6] {Fc = (eta(5)-C5H5)Fe(eta(5)-C5H4), n=2 or 1, and R-1 = h or ph}

NARCIS (Netherlands)

Pérez, S.; López, C.; Bosque, R.; Solans, X.; Font-Bardía, M.; Roig, A.; Molins, E.; van Leeuwen, P.W.N.M.; van Strijdonck, G.P.F.; Freixa, Z.

2008-01-01

The synthesis, X-ray crystal structures, and the study of the solution behavior of the palladium(II) allyl complexes [Pd(eta(3)-1R(1)-C3H4){FcCH=N-CH2-(CH2)(n)-NMe2}][PF6] {with Fc = (eta(5)-C5H5)Fe(eta(5)-C5H4), R-1 = H, and n = 2 (4) or 1 (5) or R-1 = Ph and n = 2 (6) or 1 (7)} are described. The

Site-selective conjugation of an anticoagulant aptamer to recombinant albumins and maintenance of neonatal Fc receptor binding

DEFF Research Database (Denmark)

Schmøkel, Julie; Voldum, Anders; Tsakiridou, Georgia

2017-01-01

-linked aptamer to that of aptamer alone was found using an anticoagulant activity assay measuring temporal levels of activated partial thrombin. Covalent albumin-aptamer conjugation, however, substantially compromized binding to hFcRn, to 10% affinity of that of non-conjugated WT, determined by biolayer......-life, predominately facilitated by engagement with the cellular recycling neonatal Fc receptor (FcRn), and ligand transport properties of albumin promote it as an attractive candidate to improve the pharmacokinetic profile of aptamers. This study investigates the effect of Cys34 site-selective covalent attachment...... of a factor IXa anticoagulant aptamer on aptamer functionality and human FcRn (hFcRn) engagement using recombinant human albumin (rHA) of either a wild type (WT) or an engineered human FcRn high binding variant (HB). Albumin-aptamer conjugates, connected covalently through a heterobifunctional succinimidyl 4...

32 CFR 842.97 - Referring a claim to the US Attorney or the Department of Justice.

Science.gov (United States)

2010-07-01

... 32 National Defense 6 2010-07-01 2010-07-01 false Referring a claim to the US Attorney or the Department of Justice. 842.97 Section 842.97 National Defense Department of Defense (Continued) DEPARTMENT OF... United States (31 U.S.C. 3701, 3711-3719) § 842.97 Referring a claim to the US Attorney or the Department...

Effect of pH, temperature, and salt on the stability of Escherichia coli- and Chinese hamster ovary cell-derived IgG1 Fc.

Science.gov (United States)

Li, Cynthia H; Narhi, Linda O; Wen, Jie; Dimitrova, Mariana; Wen, Zai-qing; Li, Jenny; Pollastrini, Joseph; Nguyen, Xichdao; Tsuruda, Trace; Jiang, Yijia

2012-12-18

The circulation half-life of a potential therapeutic can be increased by fusing the molecule of interest (an active peptide, the extracellular domain of a receptor, an enzyme, etc.) to the Fc fragment of a monoclonal antibody. For the fusion protein to be a successful therapeutic, it must be stable to process and long-term storage conditions, as well as to physiological conditions. The stability of the Fc used is critical for obtaining a successful therapeutic protein. The effects of pH, temperature, and salt on the stabilities of Escherichia coli- and Chinese hamster ovary cell (CHO)-derived IgG1 Fc high-order structure were probed using a variety of biophysical techniques. Fc molecules derived from both E. coli and CHO were compared. The IgG1 Fc molecules from both sources (glycosylated and aglycosylated) are folded at neutral pH and behave similarly upon heat- and low pH-induced unfolding. The unfolding of both IgG1 Fc molecules occurs via a multistep unfolding process, with the tertiary structure and C(H)2 domain unfolding first, followed by changes in the secondary structure and C(H)3 domain. The acid-induced unfolding of IgG1 Fc molecules is only partially reversible, with the formation of high-molecular weight species. The CHO-derived Fc protein (glycosylated) is more compact (smaller hydrodynamic radius) than the E. coli-derived protein (aglycosylated) at neutral pH. Unfolding is dependent on pH and salt concentration. The glycosylated C(H)2 domain melts at a temperature 4-5 °C higher than that of the aglycosylated domain, and the low-pH-induced unfolding of the glycosylated Fc molecule occurs at a pH ~0.5 pH unit lower than that of the aglycosylated protein. The difference observed between E. coli- and CHO-derived Fc molecules primarily involves the C(H)2 domain, where the glycosylation of the Fc resides.

The application of the psychological contract to workplace safety.

Science.gov (United States)

Walker, Arlene; Hutton, Dorothy M

2006-01-01

Psychological contracts of safety are conceptualized as the beliefs of individuals about reciprocal safety obligations inferred from implicit or explicit promises. Although the literature on psychological contracts is growing, the existence of psychological contracts in relation to safety has not been established. The research sought to identify psychological contracts in the conversations of employees about safety, by demonstrating reciprocity in relation to employer and employee safety obligations. The identified safety obligations were used to develop a measure of psychological contracts of safety. The participants were 131 employees attending safety training sessions in retail and manufacturing organizations. Non-participant observation was used to collect the data during safety training sessions. Content analysis was used to analyze the data. Categories for coding were established through identification of language markers that demonstrated contingencies or other implied obligations. Direct evidence of reciprocity between employer safety obligations and employee safety obligations was found in statements from the participants demonstrating psychological contracts. A comprehensive list of perceived employer and employee safety obligations was compiled and developed into a measure of psychological contracts of safety. A small sample of 33 safety personnel was used to validate the safety obligations. CONCLUSIONS AND IMPACT ON INDUSTRY: Implications of these findings for safety and psychological contract research are discussed.

Increase of the contract amounts for LHC civil-engineering construction and civil-engineering consultancy contracts

CERN Document Server

2005-01-01

This document concerns the increase of the contract amounts for LHC civil-engineering construction and civil-engineering consultancy, Package 2. The Finance Committee is invited to take note of the increase of the contract amounts with: - the joint venture DRAGADOS (ES) and SELI (IT) for civil-engineering construction, LHC Package 2, for an amount of 28 087 000 Swiss francs, subject to revision, in the amount previously announced to Finance Committee (CERN/FC/4516) of 132 200 000 Swiss francs, subject to revision, bringing the total to a maximum amount of 160 287 000 Swiss francs, subject to revision. - the joint venture GIBB (GB), GEOCONSULT (AT) and SGI (CH) for the provision of civil-engineering consultancy services, LHC Package 2, for an amount of 900 000 Swiss francs, subject to revision, in the amount previously announced to Finance Committee of 13 800 000 Swiss francs, subject to revision, bringing the total to a maximum amount of 14 700 000 Swiss francs, subject to revision

Efecto del estiramiento estático de 15, 30 y 60 segundos sobre el rango de movimiento de la flexión de cadera con rodilla extendida

Directory of Open Access Journals (Sweden)

Claudia Lucía Ariza-García

2014-06-01

Full Text Available Objetivo: Evaluar el efecto de tres duraciones de estiramiento estático pasivo, 15, 30 y 60 segundos (s para aumentar el rango de movimiento de la flexión de cadera (ROM-FC. Metodología: Ensayo Clínico Controlado Aleatorizado. Nueve estudiantes mujeres (21,7 ± 4,3 años fueron asignadas aleatoriamente a tres grupos, 15 (G15, 30 (G30 y 60 (G60 s; n = 3 en cada grupo. El estiramiento de la musculatura isquitotibial se realizó en decúbito supino, máxima flexión de cadera, rodilla extendida y dorsiflexión de pie con ayuda de una banda elástica; dos veces consecutivas en ambos miembros inferiores, tres veces/semana, por tres semanas. El resultado principal fue el cambio del ROM-FC izquierda y derecha al finalizar la intervención. Se usó la prueba t de student y el análisis ANOVA. Resultados:  Las diferencias entre evaluaciones en G15 y G30 fueron estadísticamente significativas para el miembro inferior derecho. No se encontraron diferencias significativas en el grupo G60 del hemicuerpo derecho ni en grupo alguno del hemicuerpo izquierdo. Tampoco para el aumento de ROM-FC entre los tres grupos ni entre hemicuerpos. Conclusión: El estiramiento estático pasivo de 15 y 30 s de duración fue efectivo para aumentar el ROM-FC derecho. Se requieren futuros estudios con un tamaño de muestra adecuado para detectar diferencias en el aumento del ROM-FC según duración del estiramiento y hemicuerpos.

Efecto de sustratos orgánicos en plantas de fresa (Fragaria sp. cv ‘Albion’ bajo condiciones de campo

Directory of Open Access Journals (Sweden)

José Samuel Medina-Bolívar

2016-11-01

Full Text Available El cultivo de fresa es una de las opciones productivas para los agricultores, principalmente de los departamentos de Cundinamarca, Antioquia y Boyacá. La tendencia creciente hacia una agricultura cada vez más abierta al comercio mundial determina que las actividades agrícolas nacionales deben ser cada día más productivas y competitivas, esto soportado en nuevas y mejores tecnologías de producción. Dentro de estas, se cuenta el uso de diferentes sustratos con el fin de solucionar problemas como acidez, alta erosión o problemas de tipo fitosanitario que impiden la siembra de forma directa en el suelo. Teniendo en cuenta lo anterior el objetivo de la investigación fue la evaluación de diferentes sustratos orgánicos en el crecimiento y desarrollo de plantas de fresa cv ‘Albion’, bajo condiciones de campo abierto. Para la evaluación se utilizó un diseño completamente al azar con tres tratamientos siendo S1: suelo 50% + fibra de coco 50% (S:FC, S2: suelo 50% + fibra de coco 25% + cascarilla de arroz 25% (S:FC:CA y S3: suelo 50% + cascarilla de arroz 50% (S:CA, cada uno conto con tres replicaciones. Las variables evaluadas fueron masa fresca y seca de raíz y parte aérea, área foliar, clorofilas totales, numero de frutos/planta y producción g/planta. El tratamiento (S1, mostró diferencias significativas según la prueba de Tukey (P≤0.05 en la mayoría de parámetros evaluados, esto lo convierte en una alternativa para la producción de fresa cv ‘Albión’ bajo las condiciones de estudio.

Technical progress report, Contracts DE-AC02-81ER40014, 40015 and 40016

International Nuclear Information System (INIS)

1981-01-01

This Progress Report summarizes work carried out at the Nuclear Physics Laboratory of the University of Colorado from November 1, 1980 through July 31, 1981, under contracts between the University of Colorado and the United States Department of Energy. The shorter report period of nine months is due to a change to an earlier submission date this year for our proposal for support to begin February 1, 1982. Cyclotron operation, research, and development have been supported under contract DE-AC02-81ER40014. The AVF cyclotron has continued to provide reliable and versatile beams of protons, deuterons, 3 He and 4 He. A wide variety of research results in direct reactions, nuclear structure, and compound reaction mechanisms can be noted in this Progress Report, correlated in many cases to current problems in intermediate energy physics. Theoretical work on nuclear reactions, carried out under contract DE-AC02-81ER40015, has been well matched to our experimental programs in low and intermediate energy physics. One important result has been the recasting of the DWBA in an eikonal expansion suited to high energy reactions. Our efforts in intermediate energy physics, under contract DE-AC02-81ER40016, have emphasized pion scattering studies at LAMPF and TRIUMF and proton induced charge exchange reactions at IUCF. Data for an important test of hadronic charge symmetry have been completed at two energies, using elastic pion-deuteron scattering

Design of intelligent gateway control system based on AllJoyn and FC-3180

Directory of Open Access Journals (Sweden)

Chen Yanzhong

2017-02-01

Full Text Available To simplify interconnection of distributed household equipment,this design creates a spontaneous,movable,safe and configurable equipment management system and smart home layout with the open-source software framework AllJoyn,the embedded microprocessor FC-3180,the low power wireless transmission network ZigBee and mobile application platform Android.

Effect of a 0.5% chlorhexidine gel on dental plaque superinfecting microorganisms in mentally handicapped patients Efeito do gel de clorexidina a 0,5% em microrganismos superinfectantes da placa bacteriana de portadores de necessidades especiais

Directory of Open Access Journals (Sweden)

Cláudio Mendes Pannuti

2003-09-01

Full Text Available A randomized clinical trial was conducted to investigate the effect of a 0.5% chlorhexidine (CHX gel on dental plaque superinfecting microorganisms in mentally handicapped patients. Thirty inmates from the institution "Casas André Luiz" were assigned to either test group (CHX gel, n = 15 or control group (placebo gel, n = 15. The gel was administered over a period of 8 weeks. Supragingival plaque samples were collected at baseline, after gel use (8 weeks and 16 weeks after baseline. The presence of Gram-negative Enterobacteriaceae, Staphylococcus and yeasts was evaluated. No significant growth of any superinfecting microorganism was observed in the CHX group, when compared to the placebo group. The results indicated that the 0.5% chlorhexidine gel did not produce an undesirable shift in these bacterial populations.Foi conduzido um ensaio clínico aleatório com objetivo de investigar o efeito do gel de clorexidina (CHX a 0,5% sobre microorganismos superinfectantes da placa bacteriana de pacientes especiais. Trinta internos da instituição "Casas André Luiz" foram aleatoriamente divididos em grupo teste (gel de CHX, n = 15 e controle (gel placebo, n = 15. O gel foi utilizado por oito semanas. Amostras de placa supragengival foram coletadas no início do estudo, após o uso do gel (oito semanas e 16 semanas após o início do estudo. Foi avaliada a presença de bacilos entéricos Gram-negativos, Staphylococcus e leveduras. Não houve diferença entre os grupos quanto à presença desses microorganismos em qualquer momento do estudo. Os resultados indicam que o gel de CHX não provocou mudanças significativas na composição desses microorganismos.

Structural characterization of the Man5 glycoform of human IgG3 Fc

Energy Technology Data Exchange (ETDEWEB)

Shah, Ishan S.; Lovell, Scott; Mehzabeen, Nurjahan; Battaile, Kevin P.; Tolbert, Thomas J. (Kansas); (HWMRI)

2017-12-01

Immunoglobulin G (IgG) consists of four subclasses in humans: IgG1, IgG2, IgG3 and IgG4, which are highly conserved but have unique differences that result in subclass-specific effector functions. Though IgG1 is the most extensively studied IgG subclass, study of other subclasses is important to understand overall immune function and for development of new therapeutics. When compared to IgG1, IgG3 exhibits a similar binding profile to Fcγ receptors and stronger activation of complement. All IgG subclasses are glycosylated at N297, which is required for Fcγ receptor and C1q complement binding as well as maintaining optimal Fc conformation. We have determined the crystal structure of homogenously glycosylated human IgG3 Fc with a GlcNAc2Man5 (Man5) high mannose glycoform at 1.8 Å resolution and compared its structural features with published structures from the other IgG subclasses. Although the overall structure of IgG3 Fc is similar to that of other subclasses, some structural perturbations based on sequence differences were revealed. For instance, the presence of R435 in IgG3 (and H435 in the other IgG subclasses) has been implicated to result in IgG3-specific properties related to binding to protein A, protein G and the neonatal Fc receptor (FcRn). The IgG3 Fc structure helps to explain some of these differences. Additionally, protein-glycan contacts observed in the crystal structure appear to correlate with IgG3 affinity for Fcγ receptors as shown by binding studies with IgG3 Fc glycoforms. Finally, this IgG3 Fc structure provides a template for further studies aimed at engineering the Fc for specific gain of function.

48 CFR 2439.107 - Contract clauses.

Science.gov (United States)

2010-10-01

... Departmental automated information systems or applications as they are defined in the clause. (b) The contracting officer shall insert the clause at 48 CFR 2452.239-71, Information Technology Virus Security, in... SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY 2439.107 Contract clauses. (a) The...

Substituição Parcial do Farelo de Soja pela Farinha de Vísceras de Aves em Dietas Balanceadas com Base na Proteína e em Aminoácidos Totais ou Digestíveis para Frangos de Corte Partial Substitution of Soybean Meal by Poultry Offal Meal in Diets Balanced According to Protein and Total or Digestible Amino Acids for Broilers

Directory of Open Access Journals (Sweden)

C Bellaver

2001-12-01

Full Text Available A formulação com base no conceito de proteína ideal (PI é mais eficiente quando são usados ingredientes alternativos ao milho (M e ao farelo de soja (FS. Assim, o objetivo desse trabalho foi comparar formulações de dietas utilizando o conceito de PI, usando farinha de vísceras (FV em substituição ao FS, em dietas de frangos de corte. Os tratamentos foram os seguintes: T1 = dieta com 22 % e 20% de proteína bruta (PB nas fases inicial (FI e de crescimento (FC e 3200 kcal/kg de EM durante todo experimento; T2 = energia semelhante a dieta T1 e PI à base de M e FS (1,15% de lisina digestível na FI e 0,90% de lisina digestível na FC; T3=dieta semelhante a T2, com 20 % e 25 % de substituição do FS por FV nas FI e FC, respectivamente; T4=dieta semelhante a T3, com 40 e 50 % de substituição do FS por FV, nas FI e FC, respectivamente; T5=dieta semelhante a T4, porém com balanço por aminoácidos (AA totais (1,10 e 1,00 % de lisina total nas FI e FC, respectivamente. Os resultados permitiram concluir que a formulação com base na PI é melhor do que aquela que considera a PB ou AA totais. A inclusão de 20 % FV na FI e 25 % na FC de frangos de corte, em substituição ao FS, melhorou o desempenho até os 21 dias e não alterou o desempenho até os 42 dias em dietas formuladas dentro do conceito de proteína ideal.Ideal protein (IP concept in feed formulation is more suitable when alternative ingredients to corn (C and soybean meal (SBM are used. Thus, the objective of this paper was to compare diets using IP concept and poultry offal meal (POM in substitution to SBM in broiler diets. The treatments were: T1= diets with 22% and 20 % crude protein (CP in starting phase (SP and growing phase (GP, respectively and 3200 kcal ME/kg all over the experiment; T2= similar energy to T1 and IP diet based on C and SBM (1.15% digestible lysine in SP and 0.90 % in GP; T3= similar diet to T2, with 20% and 25% of substitution of SBM by POM in SP and GP

48 CFR 970.3102-05-4 - Bonding costs.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Bonding costs. 970.3102-05... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05-4 Bonding costs. (d) The allowability of bonding costs shall be determined pursuant to 970.5228...

Increased half-life and enhanced potency of Fc-modified human PCSK9 monoclonal antibodies in primates.

Directory of Open Access Journals (Sweden)

Yijun Shen

Full Text Available Blocking proprotein convertase subtilisin kexin type 9 (PCSK9 binding to low-density lipoprotein receptor (LDLR can profoundly lower plasma LDL levels. Two anti-PCKS9 monoclonal antibodies (mAbs, alirocumab and evolocumab, were approved by the FDA in 2015. The recommended dose is 75 mg to 150 mg every two weeks for alirocumab and 140mg every two weeks or 420 mg once a month for evolocumab. This study attempted to improve the pharmacokinetic properties of F0016A, an IgG1 anti-PCKS9 mAb, to generate biologically superior molecules. We engineered several variants with two or three amino acid substitutions in the Fc fragment based on prior knowledge. The Fc-modified mAbs exhibited increased binding to FcRn, resulting in prolonged serum half-life and enhanced efficacy in vivo. These results demonstrate that Fc-modified anti-PCKS9 antibodies may enable less frequent or lower dosing of antibodies by improved recycling into the blood.

Contracts Take or Pay, for supply and transport of gas

International Nuclear Information System (INIS)

Velasquez Bermudez, Jesus Maria

2000-01-01

The present article has as objective to study the effect that has the contract of supply and of transport of gas that subscribe generators agents of the electric sector with the agents of the market of the gas. The article concentrates on the study of the denominated contracts take or pay. Initially the modeling is analyzed to include the effect of the contracts of gas in the mathematical models that are used to support the works of planning. Later on is studied of optimal form to determining the prices in spot markets of the industries associated to the contracts. Finally is presented the methodology and controlled experiments that allow to identify and to quantify the macro economic effect of the contracts

High performance Bi0.5Na0.5TiO3-BiAlO3-K0.5Na0.5NbO3 lead-free pyroelectric ceramics for thermal detectors

Science.gov (United States)

Liu, Zhen; Ren, Weijun; Peng, Ping; Guo, Shaobo; Lu, Teng; Liu, Yun; Dong, Xianlin; Wang, Genshui

2018-04-01

Both high pyroelectric properties and good temperature stability of ferroelectric materials are desirable when used for applications in infrared thermal detectors. In this work, we report lead-free ternary 0.97(0.99Bi0.5Na0.5TiO3-0.01BiAlO3)-0.03K0.5Na0.5NbO3 (BNT-BA-KNN) ceramics, which not only exhibits a large pyroelectric coefficient (p ˜ 3.7 × 10-8 C cm-2 K-1) and figures of merit (Fi, Fv, and Fd) but also shows excellent thermal stable properties. At room temperature, Fi, Fv, and Fd are determined as high as 1.32 × 10-10 m/V, 2.89 × 10-2 m2/C, and 1.15 × 10-5 Pa-1/2 at 1 kHz and 1.32 × 10-10 m/V, 2.70 × 10-2 m2/C, and 1.09 × 10-5 Pa-1/2 at 20 Hz, respectively. During the temperature range of RT to 85 °C, the achieved p, Fi, Fv, and Fd do not vary too much. The high depolarization temperature and the undispersed ferroelectric-ergodic relaxor phase transition with a sharp pyroelectric coefficient peak value of ˜400 × 10-8 C cm-2 K-1 are suggested to be responsible for this thermal stability, which ensures reliable actual operation. The results reveal the BNT-BA-KNN ceramics as promising lead-free candidates for infrared thermal detector applications.

Hybrid IgG4/IgG4 Fc antibodies form upon 'Fab-arm' exchange as demonstrated by SDS-PAGE or size-exclusion chromatography

NARCIS (Netherlands)

Rispens, Theo; den Bleker, Tamara H.; Aalberse, Rob C.

2010-01-01

Human IgG4 antibodies are dynamic molecules that in vivo exchange half-molecules to become bispecific antibodies. Here we show that IgG4 antibodies and IgG4 Fc fragments similarly exchange resulting in hybrid antibodies (a single Fab + Fc) with a molecular weight of ca. 100 kDa. These antibodies can

Case studies on the success or failure of futures contracts.

Directory of Open Access Journals (Sweden)

Hilary Till

2015-06-01

Full Text Available Why do some futures contracts succeed and others fail? Although the U.S. futures markets have evolved in a trial-and-error fashion, research suggests key elements have determined whether particular futures contracts succeeded or failed. This knowledge could be useful for new financial centers as they build successful futures markets. This paper shows that there are three elements that determine whether a futures contract succeeds or not: 1. There must be a commercial need for hedging; 2. A pool of speculators must be attracted to a market; and 3. Public policy should not be too adverse to futures trading

Downmodulation of Vaccine-Induced Immunity and Protection against the Intracellular Bacterium Francisella tularensis by the Inhibitory Receptor FcγRIIB

Directory of Open Access Journals (Sweden)

Brian J. Franz

2015-01-01

Full Text Available Fc gamma receptor IIB (FcγRIIB is the only Fc gamma receptor (FcγR which negatively regulates the immune response, when engaged by antigen- (Ag- antibody (Ab complexes. Thus, the generation of Ag-specific IgG in response to infection or immunization has the potential to downmodulate immune protection against infection. Therefore, we sought to determine the impact of FcγRIIB on immune protection against Francisella tularensis (Ft, a Category A biothreat agent. We utilized inactivated Ft (iFt as an immunogen. Naïve and iFt-immunized FcγRIIB knockout (KO or wildtype (WT mice were challenged with Ft-live vaccine strain (LVS. While no significant difference in survival between naïve FcγRIIB KO versus WT mice was observed, iFt-immunized FcγRIIB KO mice were significantly better protected than iFt-immunized WT mice. Ft-specific IgA in serum and bronchial alveolar lavage, as well as IFN-γ, IL-10, and TNF-α production by splenocytes harvested from iFt-immunized FcγRIIB KO, were also significantly elevated. In addition, iFt-immunized FcγRIIB KO mice exhibited a reduction in proinflammatory cytokine levels in vivo at 5 days after challenge, which correlates with increased survival following Ft-LVS challenge in published studies. Thus, these studies demonstrate for the first time the ability of FcγRIIB to regulate vaccine-induced IgA production and downmodulate immunity and protection. The immune mechanisms behind the above observations and their potential impact on vaccine development are discussed.

Dual role of Fcγ receptors in host defense and disease in Borrelia burgdorferi-infected mice

Directory of Open Access Journals (Sweden)

Alexia Anne Belperron

2014-06-01

Full Text Available Arthritis in mice infected with the Lyme disease spirochete, Borrelia burgdorferi, results from the influx of innate immune cells responding to the pathogen in the joint and is influenced in part by mouse genetics. Production of inflammatory cytokines by innate immune cells in vitro is largely mediated by Toll-like receptor (TLR interaction with Borrelia lipoproteins, yet surprisingly mice deficient in TLR2 or the TLR signaling molecule MyD88 still develop arthritis comparable to that seen in wild type mice after B. burgdorferi infection. These findings suggest that other, MyD88-independent inflammatory pathways can contribute to arthritis expression. Clearance of B. burgdorferi is dependent on the production of specific antibody and phagocytosis of the organism. As Fc receptors (FcγR are important for IgG-mediated clearance of immune complexes and opsonized particles by phagocytes, we examined the role that FcγR play in host defense and disease in B. burgdorferi-infected mice. B. burgdorferi-infected mice deficient in the Fc receptor common gamma chain (FcεRγ-/- mice harbored ~10 fold more spirochetes than similarly infected wild type mice, and this was associated with a transient increase in arthritis severity. While the elevated pathogen burdens seen in B. burgdorferi-infected MyD88-/- mice were not affected by concomitant deficiency in FcγR, arthritis was reduced in FcεRγ-/-MyD88-/- mice in comparison to wild type or single knockout mice. Gene expression analysis from infected joints demonstrated that absence of both MyD88 and FcγR lowers mRNA levels of proteins involved in inflammation, including Cxcl1 (KC, Xcr1 (Gpr5, IL-1beta, and C reactive protein. Taken together, our results demonstrate a role for FcγR-mediated immunity in limiting pathogen burden and arthritis in mice during the acute phase of B. burgdorferi infection, and further suggest that this pathway contributes to the arthritis that develops in B. burgdorferi

21 CFR 866.5530 - Immunoglobulin G (Fc fragment specific) immunological test system.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Immunoglobulin G (Fc fragment specific... Test Systems § 866.5530 Immunoglobulin G (Fc fragment specific) immunological test system. (a) Identification. An immunoglobulin G (Fc fragment specific) immunological test system is a device that consists of...

Antibody-mediated immunity to the obligate intracellular bacterial pathogen Coxiella burnetii is Fc receptor- and complement-independent

Directory of Open Access Journals (Sweden)

Heinzen Robert A

2009-05-01

Full Text Available Abstract Background The obligate intracellular bacterial pathogen Coxiella burnetii causes the zoonosis Q fever. The intracellular niche of C. burnetii has led to the assumption that cell-mediated immunity is the most important immune component for protection against this pathogen. However, passive immunization with immune serum can protect naïve animals from challenge with virulent C. burnetii, indicating a role for antibody (Ab in protection. The mechanism of this Ab-mediated protection is unknown. Therefore, we conducted a study to determine whether Fc receptors (FcR or complement contribute to Ab-mediated immunity (AMI to C. burnetii. Results Virulent C. burnetii infects and replicates within human dendritic cells (DC without inducing their maturation or activation. We investigated the effects of Ab opsonized C. burnetii on human monocyte-derived and murine bone marrow-derived DC. Infection of DC with Ab-opsonized C. burnetii resulted in increased expression of maturation markers and inflammatory cytokine production. Bacteria that had been incubated with naïve serum had minimal effect on DC, similar to virulent C. burnetii alone. The effect of Ab opsonized C. burnetii on DC was FcR dependent as evidenced by a reduced response of DC from FcR knockout (FcR k/o compared to C57Bl/6 (B6 mice. To address the potential role of FcR in Ab-mediated protection in vivo, we compared the response of passively immunized FcR k/o mice to the B6 controls. Interestingly, we found that FcR are not essential for AMI to C. burnetii in vivo. We subsequently examined the role of complement in AMI by passively immunizing and challenging several different strains of complement-deficient mice and found that AMI to C. burnetii is also complement-independent. Conclusion Despite our data showing FcR-dependent stimulation of DC in vitro, Ab-mediated immunity to C. burnetii in vivo is FcR-independent. We also found that passive immunity to this pathogen is independent of

Measuring and manipulating brain connectivity with resting state functional connectivity magnetic resonance imaging (fcMRI) and transcranial magnetic stimulation (TMS).

Science.gov (United States)

Fox, Michael D; Halko, Mark A; Eldaief, Mark C; Pascual-Leone, Alvaro

2012-10-01

Both resting state functional magnetic resonance imaging (fcMRI) and transcranial magnetic stimulation (TMS) are increasingly popular techniques that can be used to non-invasively measure brain connectivity in human subjects. TMS shows additional promise as a method to manipulate brain connectivity. In this review we discuss how these two complimentary tools can be combined to optimally study brain connectivity and manipulate distributed brain networks. Important clinical applications include using resting state fcMRI to guide target selection for TMS and using TMS to modulate pathological network interactions identified with resting state fcMRI. The combination of TMS and resting state fcMRI has the potential to accelerate the translation of both techniques into the clinical realm and promises a new approach to the diagnosis and treatment of neurological and psychiatric diseases that demonstrate network pathology. Copyright © 2012 Elsevier Inc. All rights reserved.

The production of KIR-Fc fusion proteins and their use in a multiplex HLA class I binding assay.

Science.gov (United States)

Hilton, Hugo G; Moesta, Achim K; Guethlein, Lisbeth A; Blokhuis, Jeroen; Parham, Peter; Norman, Paul J

2015-10-01

Soluble recombinant proteins that comprise the extracellular part of a surface expressed receptor attached to the Fc region of an IgG antibody have facilitated the determination of ligand specificity for an array of immune system receptors. Among such receptors is the family of killer cell immunoglobulin-like receptors (KIR) that recognize HLA class I ligands. These receptors, expressed on natural killer (NK) cells and T cells, play important roles in both immune defense and placental development in early pregnancy. Here we describe a method for the production of two domain KIR-Fc fusion proteins using baculovirus infected insect cells. This method is more scalable than traditional mammalian cell expression systems and produces efficiently folded proteins that carry posttranslational modifications found in native KIR. We also describe a multiplex binding assay using the Luminex platform that determines the avidity and specificity of two domain KIR-Fc for a panel of microbeads, each coated with one of 97 HLA class I allotypes. This assay is simple to perform, and represents a major improvement over the assays used previously, which were limited in the number of KIR and HLA class I combinations that could be assayed at any one time. The results obtained from this assay can be used to predict the response of NK cell and T cells when their KIR recognize HLA class I. Copyright © 2015 Elsevier B.V. All rights reserved.

Parallel combination of FC and UC for vehicular power systems using a multi-input converter-based power interface

Energy Technology Data Exchange (ETDEWEB)

Vural, B.; Erdinc, O.; Uzunoglu, M. [Department of Electrical Engineering, Yildiz Technical University, Istanbul 34349 (Turkey)

2010-12-15

Fuel cells (FC) are widely recognized as one of the most promising technologies to meet future power requirements of vehicular applications. However, a FC system combined with an energy storage system (ESS) can perform better for vehicle propulsion as considering several points. As the additional ESS can fulfill the transient power demand fluctuations, the FC system can be downsized to fit the base power demand without facing peak loads. Besides, braking energy can be recovered by the ESS. Interfacing of traction drive requirements with characteristics and modes of operation of on-board generation units and ESSs calls for suitable power electronic converter configuration. In this paper, a FC/UC hybrid vehicular power system using a multi-input converter-based power interface is proposed. The applied power interface topology ensures the active power sharing and DC link voltage stabilization for the hybrid vehicular system. The mathematical and electrical models of the hybrid vehicular system are developed in detail and simulated using MATLAB registered, Simulink registered and SimPowerSystems registered environments. (author)

Parallel combination of FC and UC for vehicular power systems using a multi-input converter-based power interface

International Nuclear Information System (INIS)

Vural, B.; Erdinc, O.; Uzunoglu, M.

2010-01-01

Fuel cells (FC) are widely recognized as one of the most promising technologies to meet future power requirements of vehicular applications. However, a FC system combined with an energy storage system (ESS) can perform better for vehicle propulsion as considering several points. As the additional ESS can fulfill the transient power demand fluctuations, the FC system can be downsized to fit the base power demand without facing peak loads. Besides, braking energy can be recovered by the ESS. Interfacing of traction drive requirements with characteristics and modes of operation of on-board generation units and ESSs calls for suitable power electronic converter configuration. In this paper, a FC/UC hybrid vehicular power system using a multi-input converter-based power interface is proposed. The applied power interface topology ensures the active power sharing and DC link voltage stabilization for the hybrid vehicular system. The mathematical and electrical models of the hybrid vehicular system are developed in detail and simulated using MATLAB (registered) , Simulink (registered) and SimPowerSystems (registered) environments.

Natural form of noncytolytic flexible human Fc as a long-acting carrier of agonistic ligand, erythropoietin.

Directory of Open Access Journals (Sweden)

Se Jin Im

Full Text Available Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc consisting of IgD and IgG4, and tested its function using erythropoietin (EPO conjugate, EPO-hyFc. Despite low amino acid homology (20.5% between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H, a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last. Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.

Natural form of noncytolytic flexible human Fc as a long-acting carrier of agonistic ligand, erythropoietin.

Science.gov (United States)

Im, Se Jin; Yang, Sang In; Yang, Se Hwan; Choi, Dong Hoon; Choi, So Young; Kim, Hea Sook; Jang, Do Soo; Jin, Kyeong Sik; Chung, Yo-Kyung; Kim, Seung-Hee; Paik, Sang Hoon; Park, Yoo Chang; Chung, Moon Koo; Kim, Yong Bum; Han, Kang-Hyun; Choi, Kwan Yong; Sung, Young Chul

2011-01-01

Human IgG1 Fc has been widely used as a bioconjugate, but exhibits shortcomings, such as antibody- and complement-mediated cytotoxicity as well as decreased bioactivity, when applied to agonistic proteins. Here, we constructed a nonimmunogenic, noncytolytic and flexible hybrid Fc (hyFc) consisting of IgD and IgG4, and tested its function using erythropoietin (EPO) conjugate, EPO-hyFc. Despite low amino acid homology (20.5%) between IgD Fc and IgG4 Fc, EPO-hyFc retained "Y-shaped" structure and repeated intravenous administrations of EPO-hyFc into monkeys did not generate EPO-hyFc-specific antibody responses. Furthermore, EPO-hyFc could not bind to FcγR I and C1q in contrast to EPO-IgG1 Fc. In addition, EPO-hyFc exhibited better in vitro bioactivity and in vivo bioactivity in rats than EPO-IgG1 Fc, presumably due to the high flexibility of IgD. Moreover, the mean serum half-life of EPO-hyFc(H), a high sialic acid content form of EPO-hyFc, was approximately 2-fold longer than that of the heavily glycosylated EPO, darbepoetin alfa, in rats. More importantly, subcutaneous injection of EPO-hyFc(H) not only induced a significantly greater elevation of serum hemoglobin levels than darbepoetin alfa in both normal rats and cisplatin-induced anemic rats, but also displayed a delayed time to maximal serum level and twice final area-under-the-curve (AUC(last)). Taken together, hyFc might be a more attractive Fc conjugate for agonistic proteins/peptides than IgG1 Fc due to its capability to elongate their half-lives without inducing host effector functions and hindering bioactivity of fused molecules. Additionally, a head-to-head comparison demonstrated that hyFc-fusion strategy more effectively improved the in vivo bioactivity of EPO than the hyperglycosylation approach.

NEW ROLES FOR FC RECEPTORS IN NEURODEGENERATION-THE IMPACT ON IMMUNOTHERAPY FOR ALZHEIMER’S DISEASE

Directory of Open Access Journals (Sweden)

James P. Fuller

2014-08-01

Full Text Available There are an estimated 18 million Alzheimer’s disease (AD sufferers worldwide and with no disease modifying treatment currently available, development of new therapies represents an enormous unmet clinical need. AD is characterised by episodic memory loss followed by severe cognitive decline and is associated with many neuropathological changes. AD is characterised by deposits of amyloid beta (Aβ, neurofibrillary tangles, and neuroinflammation. Active immunisation or passive immunisation against Aβ leads to the clearance of deposits in transgenic mice expressing human Aβ. This clearance is associated with reversal of associated cognitive deficits, but these results have failed to translate to humans, with both active and passive immunotherapy failing to improve memory loss. One explanation for these observations is that certain anti-Aβ antibodies mediate damage to the cerebral vasculature limiting the top dose and potentially reducing efficacy. Fc gamma receptors (Fcγ are a family of immunoglobulin like receptors which bind to the Fc portion of IgG, and mediate the response of effector cells to immune complexes. Data from both mouse and human studies suggest that cross-linking Fc receptors by therapeutic antibodies and the subsequent pro-inflammatory response mediates the vascular side effects seen following immunotherapy. Increasing evidence is emerging that Fc receptor expression on CNS resident cells, including microglia and neurons, is increased during aging and functionally involved in the pathogenesis of age-related neurodegenerative diseases. We propose that increased expression and ligation of Fc receptors in the CNS, either by endogenous IgG or therapeutic antibodies, has the potential to induce vascular damage and exacerbate neurodegeneration. To produce safe and effective immunotherapies for AD and other neurodegenerative diseases it will be vital to understand the role of Fc receptors in the healthy and diseased brain.

Desempenho e características de carcaça de frangos de corte alimentados com dietas contendo farinha de resíduos do processamento de camarões (Litopeneaus vannamei - DOI: 10.4025/actascianimsci.v28i3.40 Utilization and effect of shrimp waste meal in the performance and characteristics of broiler (Litopeneaus Vannamei - DOI: 10.4025/actascianimsci.v28i3.40

Directory of Open Access Journals (Sweden)

Riviana Roberta de Souza Loureiro

2006-01-01

Full Text Available O objetivo do presente trabalho foi avaliar o desempenho zootécnico e as características de carcaça de frangos de corte, alimentados com dietas contendo farinha de resíduo do processamento de camarões (FC. Foram utilizados 240 pintos de um dia de idade, distribuídos em um delineamento experimental inteiramente casualizado, sendo 5 tratamentos (níveis de inclusão de FC: 0, 3, 6, 9 e 12% em rações a base de milho e farelo de soja com 4 repetições e 12 aves por unidade experimental. Os níveis de inclusão da FC proporcionaram efeito quadrático apenas para o ganho de peso, demonstrando que os melhores níveis de inclusão na dieta foram de 5,46% e 5,87%, nos períodos de 1 a 21 e 22 a 42 dias de idade, respectivamente, melhorando, inclusive, a pigmentação na carcaça das avesThis experiment was to evaluate the performance of broiler chickens feed with different levels of shrimp meal (SM in their diet. In this experiment 240 broiler chickens were distributed at a complete randomized design in five treatments and four replications of 12 broiler chickens per experimental unit. The levels of SM were 0, 3, 6, 9 e 12% added to zea mays and soybean-meal ration based. These rations were fed to 1-day-old broiler chicks for 6 weeks (3 weeks of starter rations and 3 weeks of finished ration. Only the weight gain presented significant difference with effects on shrimp meal levels in the ration. The shrimp waste meal (Litopenaeus vannamei resulted in a quadratic effect (P<0.05, where the best level included was 5.46 and 5.87% for 1-21 and 22-42 day-old, respectively. The increasing levels of SM inclusion improved the pigmentation of the birds’ food-pad

APC targeting enhances immunogenicity of a novel multistage Fc-fusion tuberculosis vaccine in mice.

Science.gov (United States)

Soleimanpour, Saman; Farsiani, Hadi; Mosavat, Arman; Ghazvini, Kiarash; Eydgahi, Mohammad Reza Akbari; Sankian, Mojtaba; Sadeghian, Hamid; Meshkat, Zahra; Rezaee, Seyed Abdolrahim

2015-12-01

Numerous studies have demonstrated that targeting immunogens to FcγR on antigen-presenting cells (APCs) can selectively uptake and increase cellular immunity in vitro and in vivo. Therefore, the present study was conducted to evaluate immunogenicity of a novel multistage tuberculosis vaccine, a combination of an early and a dormant immunogenic protein, ESAT6 and HspX, fused to Fcγ2a fragment of mouse IgG2a to target all forms of tuberculosis. Codon-optimized genes consisting of ESAT6, a linker, and HspX fused either to mouse Fcγ2a (ESAT6:HspX:mFcγ2a) or 6× His-tag (ESAT6:HspX:His) were synthesized. The resulting proteins were then produced in Pichia pastoris. The fusion proteins were separately emulsified in dimethyldioctadecylammonium bromide(DDA)-trehalose-6,6-dibehenate(TDB) adjuvant, and their immunogenicity with and without bacille Calmette-Guérin (BCG) was assessed in C57BL/6 mice. Th1, Th2, Th17, and T-reg cytokine patterns were evaluated using the ELISA method. Both multistage vaccines induced very strong IL-12 and IFN-γ secretion from splenic cells; the Fc-tagged subunit vaccine induced a more effective Th1 immune response (IFN-γ, 910 pg/mL, and IL-12, 854 pg/mL) with a very low increase in IL-17 (∼0.1 pg/mL) and IL-4 (37 pg/mL) and a mild increase in TGF-β (543 pg/mL) compared to the BCG or ESAT6:HspX:His primed and boosted groups. The production of IFN-γ to ESAT6:HspX:Fcγ2a was very consistent and showed an increasing trend for IL-12 compared to the BCG or ESAT6:HspX:His primed and boosted groups. Fcγ2a used as a delivery vehicle supported the idea of selective uptake, inducing cross-presentation and forming a proper anti-tuberculosis response in context of Th1/Th2 and Th17/T-reg balances, which is important for protection and prevention of damage.

Multiplicidade de vínculos de médicos no Estado do Ceará Multiplicidad de vínculos de médicos en el Estado de Ceará, Noreste de Brasil Multiple job contracts of physicians in Ceará, Northeastern Brazil

Directory of Open Access Journals (Sweden)

Regina Heloisa Maciel

2010-10-01

con los cuales los profesionales mantenían vínculos, buscando estimar los trayectos realizados por los médicos para cumplir los contratos de trabajo y su carga horaria semanal. RESULTADOS: De los 7.008 médicos vinculados al Estado, 3,751 (53,5% poseían entre dos a cuatro vínculos, y 39 (0,6% de 11 a 20 vínculos. Un profesional poseía 20 vínculos. Más de la mitad (51,9% de los médicos poseían vínculos de trabajo que, al sumarse, totalizaban una jornada semanal por encima de 40 horas y 27,0% (1.894 mantenían vínculos en más de un municipio. CONCLUSIONES: Para aumentar las ganancias con su trabajo los médicos articulan varios empleos, ejerciendo la profesión en locales diferentes en un constante ir y venir, inclusive en variados municipios, contribuyendo a la precarización de la calidad de sus vidas y, consecuentemente, el sistema de salud.OBJECTIVE: To analyze the multiple job contracts of physicians in the Brazilian National Health System in the State of Ceará. METHODS: Documental research was performed about the work contracts of the physicians, based on data of health professional contracts in the municipalities of Ceará state, Northeastern Brazil, in 2008. Indices were created for the quantity of contracts of each physician, as well as the municipalities where each physician maintained work contracts. The distances between the municipalities where they worked was calculated in order to estimate the total weekly hours of work. RESULTS: Of the 7,008 physicians employed by the Ceará state, 3,751 (53.5% maintain between two and four job contracts and 39 (0.6% between 11 and 20 contracts. One professional maintained 20 contracts. More than half (51.9% of the physicians had work contracts that when summed totaled more than 40 weekly working hours and 27.0% (1,894 maintained job contracts with more than one municipality. CONCLUSIONS: In order to increase their work income, physicians undertake various jobs, practicing their profession in different

FcγRIIb on myeloid cells rather than on B cells protects from collagen-induced arthritis.

Science.gov (United States)

Yilmaz-Elis, A Seda; Ramirez, Javier Martin; Asmawidjaja, Patrick; van der Kaa, Jos; Mus, Anne-Marie; Brem, Maarten D; Claassens, Jill W C; Breukel, Cor; Brouwers, Conny; Mangsbo, Sara M; Boross, Peter; Lubberts, Erik; Verbeek, J Sjef

2014-06-15

Extensive analysis of a variety of arthritis models in germline KO mice has revealed that all four receptors for the Fc part of IgG (FcγR) play a role in the disease process. However, their precise cell type-specific contribution is still unclear. In this study, we analyzed the specific role of the inhibiting FcγRIIb on B lymphocytes (using CD19Cre mice) and in the myeloid cell compartment (using C/EBPαCre mice) in the development of arthritis induced by immunization with either bovine or chicken collagen type II. Despite their comparable anti-mouse collagen autoantibody titers, full FcγRIIb knockout (KO), but not B cell-specific FcγRIIb KO, mice showed a significantly increased incidence and severity of disease compared with wild-type control mice when immunized with bovine collagen. When immunized with chicken collagen, disease incidence was significantly increased in pan-myeloid and full FcγRIIb KO mice, but not in B cell-specific KO mice, whereas disease severity was only significantly increased in full FcγRIIb KO mice compared with incidence and severity in wild-type control mice. We conclude that, although anti-mouse collagen autoantibodies are a prerequisite for the development of collagen-induced arthritis, their presence is insufficient for disease development. FcγRIIb on myeloid effector cells, as a modulator of the threshold for downstream Ab effector pathways, plays a dominant role in the susceptibility to collagen-induced arthritis, whereas FcγRIIb on B cells, as a regulator of Ab production, has a minor effect on disease susceptibility. Copyright © 2014 by The American Association of Immunologists, Inc.

Fc receptor gamma subunit polymorphisms and systemic lupus erythematosus

International Nuclear Information System (INIS)

Al-Ansari, Aliya; Ollier, W.E.; Gonzalez-Gay, Miguel A.; Gul, Ahmet; Inanac, Murat; Ordi, Jose; Teh, Lee-Suan; Hajeer, Ali H.

2004-01-01

To investigate the possible association between Fc receptor gamma polymorphisms and systemic lupus erythematosus (SLE). We have investigated the full FcR gamma gene for polymorphisms using polymerase chain reaction (PCR)-single strand confirmational polymorphisms and DNA sequencing .The polymorphisms identified were genotype using PCR-restriction fragment length polymorphism. Systemic lupus erythematosus cases and controls were available from 3 ethnic groups: Turkish, Spanish and Caucasian. The study was conducted in the year 2001 at the Arthritis Research Campaign, Epidemiology Unit, Manchester University Medical School, Manchester, United Kingdom. Five single nucleotide polymorphisms were identified, 2 in the promoter, one in intron 4 and, 2 in the 3'UTR. Four of the 5 single nucleotide polymorphisms (SNPs) were relatively common and investigated in the 3 populations. Allele and genotype frequencies of all 4 investigated SNPs were not statistically different cases and controls. fc receptor gamma gene does not appear to contribute to SLE susceptibility. The identified polymorphisms may be useful in investigating other diseases where receptors containing the FcR gamma subunit contribute to the pathology. (author)

ACQUA97 - a Fortran subroutine to evaluate the IAPWS-IF97 equations of state for water and steam

International Nuclear Information System (INIS)

Veloso, Marcelo A.; Dias, Marcio S.; Fortini, Maria Auxiliadora

2007-01-01

Fundamental to subroutine ACQUA97 is the IAPWS-IF97 formulation for the thermodynamic properties of water and steam adopted by the International Association for the Properties of Water and Steam (IAPWS) in 1997. This new formulation is designed specifically for industrial applications, and replaces the previous industrial formulation, IFC-67, that has formed the basis of steam tables used in many areas of steam power industry throughout the world since the late 1960's. ACQUA97 has been programmed to compute the thermodynamic properties of water and steam (pressure, temperature, specific volume, specific entropy, specific enthalpy, and internal specific energy) and their main first partial derivatives for several combinations of two independent variables. One of the independent variable is either pressure or temperature. Vapor-liquid saturation properties are calculated at specified temperature or pressure. Transport properties (dynamic viscosity and thermal conductivity) and vapor-liquid surface tension are also calculated with formulations adopted by IAPWS. Any of the above mentioned thermophysical properties can be computed by this single subroutine from a simple main program supplied by the user. ACQUA97 might be very useful to those who deal with design and evaluation of thermal power plants. (author)

Analysis of the 314th Contracting Squadrons Contract Management Capability Using the Contract Management Maturity Model (CMMM)

National Research Council Canada - National Science Library

Jackson, Jr, Carl J

2007-01-01

.... The purpose of this research project is to analyze the 314th Contracting Squadron contracting processes and requirement target areas for improvement efforts by the application of the Contract Management Maturity Model (CMMM...

Mouse splenic and bone marrow cell populations that express high-affinity Fc epsilon receptors and produce interleukin 4 are highly enriched in basophils.

OpenAIRE

Seder, R A; Paul, W E; Dvorak, A M; Sharkis, S J; Kagey-Sobotka, A; Niv, Y; Finkelman, F D; Barbieri, S A; Galli, S J; Plaut, M

1991-01-01

Splenic and bone marrow cells from normal mice, and from mice that have been polyclonally activated by injection of anti-IgD antibody, contain cells that produce interleukin 4 (IL-4) in response to crosslinkage of Fc epsilon receptors (Fc epsilon R) or Fc gamma R or to ionomycin. Isolated Fc epsilon R+ cells have recently been shown to contain all of the IL-4-producing capacity of the nonlymphoid compartment of spleen and bone marrow. Here, purified Fc epsilon R+ cells are shown to be enriche...

Lutetium-177 - Broad Production Capabilities are Expected to Stimulate Clinical Applications of this Important Therapeutic Radioisotope

International Nuclear Information System (INIS)

Knapp, F.F. Jr.

2009-01-01

though the effort and expense increase exponentially as higher levels of nca Lu-177 are required, with more experience, these methods would be expected to be optimized and automated. Effective clinical results of targeted therapy exemplified with Lu-177-DOTAT-TOC and other peptides have been widely reported for neuroendocrine tumors. For this application, SA of probably > 10 Ci/mg is required. For arthritis therapy with Lu-177-EDTMP, much lower SA is sufficient (∼ 0.5 Ci Lu-177/mg). Although not yet realized, the unique opportunity to produce high activity levels/high SA Lu-177 essentially anywhere in the world would be expected to catalyze broader clinical use of Lu-177. In fact, this is a unique situation where production capabilities for both HSA and LSA Lu-177 far exceed current demand. The goals of this presentation are to discuss the issues associated with the routine production and processing of high activity levels of lutetium-177 and current and expected clinical applications. Research at the Oak Ridge National Laboratory (ORNL) is supported by the U.S. Department of Energy (DOE) under contract DE-AC05-00OR22725 with UT-Battelle, LLC. 'The submitted manuscript has been authored by a contractor of the U.S. Government under contract DE-AC05-00OR22725. Accordingly, the U.S. Government retains a nonexclusive, royalty-free license to publish or reproduce the published form of this contribution, or allow others to do so, for U.S. Government purposes.' (author)

Inhibition of B cell proliferation by antisense DNA to both alpha and beta forms of Fc epsilon R II.

Science.gov (United States)

Bhatti, L; Behle, K; Stevens, R H

1992-10-01

Epstein-Barr Virus (EBV) infection activates B lymphocyte proliferation through partially understood mechanisms, resulting in phenotypic changes, including the appearance of new antigens. One such antigen is Fc epsilon R II/CD-23 which may be relevant for B cell proliferation. We have used anti-sense oligonucleotides to study the importance of the two forms of this molecule for proliferation in the EBV-transformed, Fc epsilon R II +ve lymphoblastoid B cell line, RPMI 8866. Anti-sense oligodeoxynucleotides were generated to the two forms of Fc epsilon R II; Fc epsilon R IIa (alpha) and IIb (beta) which differ only in their intracytoplasmic domains. Addition of increasing concentrations of anti-sense oligonucleotides, ranging from 1 to 30 microM, significantly decreased cellular proliferation as measured by the incorporation of [3H]thymidine (inhibition range 8-88%). Optimum inhibition of cellular proliferation was apparent at 15 microM concentration of both anti-sense Fc epsilon R IIa and IIb (Fc epsilon R IIa, mean +/- SE = 75 +/- 7% inhibition, p less than 0.001; Fc epsilon R IIb, mean +/- SE = 71 +/- 7% inhibition, p less than 0.001). Anti-sense oligonucleotides complementary to the common part of Fc epsilon R II resulted in a similar inhibition of proliferation. Sense oligonucleotides did not induce significant inhibition. Preincubation of sense and anti-sense oligonucleotides resulted in an abrogation of proliferation inhibition. Moreover, none of these oligonucleotides had any effect on a Fc epsilon R II -ve cell line. Incubation with both anti-sense IIa and IIb resulted in additive, but not synergistic inhibition of proliferation. Addition of soluble Fc epsilon R II did not reverse inhibition of proliferation, suggesting that membrane-bound or intracellular rather than soluble Fc epsilon R II was important for the induced proliferation. Analysis of cell surface expression for Fc epsilon II indicated that while there was a pronounced effect on cell number

A study of phase transformations processes in 0,5 to 4% mo uranium-molybdenum alloys; Etude des processus des transformations dans les alliages uranium-molybdene de teneur 0,5 a 4% en poids de molybdene

Energy Technology Data Exchange (ETDEWEB)

Lehmann, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1959-06-15

Isothermal and continuous cooling transformations process have been established on uranium-molybdenum alloys containing 0,5 to 4 w% Mo. Transformations process of the {beta} and {gamma} solid solutions are described. These processes depend upon molybdenum concentration. Out of the {beta} solid solution phase appears an eutectoid decomposition of {beta} to ({alpha} + {gamma}) or the formation of a martensitic phase {alpha}''. The {gamma} solid solution shows a decomposition of {gamma} to ({alpha} + {gamma}) or ({alpha} + {gamma}'), or a formation of martensitic phases a' or a'{sub b}. The U-Mo equilibrium diagram is discussed, particularly in low concentrations zones. Limits between domains ({alpha} + {gamma}) and ({beta} + {gamma}), ({beta} + {gamma}) and {gamma}, ({beta} + {gamma}) and {beta}, have been determined. (author) [French] Les processus des transformations isothermes, et au cours de refroidissements continus ont ete etablis sur les alliages uranium-molybdene de 0,5 a 4 % en poids de Mo. Ceci a permis de mettre en evidence les processus des transformations de solutions solides {beta} et {gamma}, differents suivant la teneur en molybdene de l'alliage. Dans le premier cas il y a decomposition eutectoide de {beta} en ({alpha} + {gamma}) ou formations d'une phase martensitique {alpha}''. Dans le second cas il y a decomposition de {gamma} soit en ({alpha} + {gamma}) soit en ({alpha} + {gamma}') suivant la temperature, ou bien formation des phases martensitiques {alpha}' ou {alpha}'{sub b}. Le diagramme d'equilibre, uranium-molybdene est sujet a de nombreuses controverses, en particulier dans la zone des faibles concentrations. Les limites entre les domaines ({alpha} + {gamma}) et ({beta} + {gamma}), ({beta} + {gamma}) et {gamma}, ({beta} + {gamma}) et {beta}, ont ete determinees. (auteur)

25 CFR 900.127 - What can be included in the Indian tribe or tribal organization's contract budget?

Science.gov (United States)

2010-04-01

..., taking into consideration the terms of the contract and the requirements of the Act and any other applicable law; (2) The costs of preparing the contract proposal and supporting cost data; (3) The costs... construction contract to make a reasonable profit, taking into consideration the risks associated with carrying...

Endothelial Fcγ Receptor IIB Activation Blunts Insulin Delivery to Skeletal Muscle to Cause Insulin Resistance in Mice

Science.gov (United States)

Tanigaki, Keiji; Chambliss, Ken L.; Yuhanna, Ivan S.; Sacharidou, Anastasia; Ahmed, Mohamed; Atochin, Dmitriy N.; Huang, Paul L.

2016-01-01

Modest elevations in C-reactive protein (CRP) are associated with type 2 diabetes. We previously revealed in mice that increased CRP causes insulin resistance and mice globally deficient in the CRP receptor Fcγ receptor IIB (FcγRIIB) were protected from the disorder. FcγRIIB is expressed in numerous cell types including endothelium and B lymphocytes. Here we investigated how endothelial FcγRIIB influences glucose homeostasis, using mice with elevated CRP expressing or lacking endothelial FcγRIIB. Whereas increased CRP caused insulin resistance in mice expressing endothelial FcγRIIB, mice deficient in the endothelial receptor were protected. The insulin resistance with endothelial FcγRIIB activation was due to impaired skeletal muscle glucose uptake caused by attenuated insulin delivery, and it was associated with blunted endothelial nitric oxide synthase (eNOS) activation in skeletal muscle. In culture, CRP suppressed endothelial cell insulin transcytosis via FcγRIIB activation and eNOS antagonism. Furthermore, in knock-in mice harboring constitutively active eNOS, elevated CRP did not invoke insulin resistance. Collectively these findings reveal that by inhibiting eNOS, endothelial FcγRIIB activation by CRP blunts insulin delivery to skeletal muscle to cause insulin resistance. Thus, a series of mechanisms in endothelium that impairs insulin movement has been identified that may contribute to type 2 diabetes pathogenesis. PMID:27207525

Hematopoietic properties of granulocyte colony-stimulating factor/immunoglobulin (G-CSF/IgG-Fc fusion proteins in normal and neutropenic rodents.

Directory of Open Access Journals (Sweden)

George N Cox

Full Text Available Previously we showed that granulocyte colony-stimulating factor (G-CSF in vitro bioactivity is preserved when the protein is joined via a flexible 7 amino acid linker to an immunoglobulin-1 (IgG1-Fc domain and that the G-CSF/IgG1-Fc fusion protein possessed a longer circulating half-life and improved hematopoietic properties compared to G-CSF in normal rats. We have extended this analysis by comparing the relative hematopoietic potencies of G-CSF/IgG1-Fc to G-CSF in normal mice and to G-CSF and polyethylene glycol (PEG -modified G-CSF in neutropenic rats. Mice were treated for 5 days using different doses and dosing regimens of G-CSF/IgG1-Fc or G-CSF and circulating neutrophil levels in the animals measured on Day 6. G-CSF/IgG1-Fc stimulated greater increases in blood neutrophils than comparable doses of G-CSF when administered using daily, every other day or every third day dosing regimens. In rats made neutropenic with cyclophosphamide, G-CSF/IgG1-Fc accelerated recovery of blood neutrophils to normal levels (from Day 9 to Day 5 when administered as 5 daily injections or as a single injection on Day 1. By contrast, G-CSF accelerated neutrophil recovery when administered as 5 daily injections, but not when administered as a single injection. G-CSF/IgG1-Fc was as effective as PEG-G-CSF at accelerating neutrophil recovery following a single injection in neutropenic rats. G-CSF/IgG1-Fc and G-CSF/IgG4-Fc fusion proteins in which the 7 amino acid linker was deleted also were effective at accelerating neutrophil recovery following a single injection in neutropenic rats. These studies confirm the enhanced in vivo hematopoietic properties of G-CSF/IgG-Fc fusion proteins.

Processing and characterization of AlCoFeNiXTi0,5 (X = Mn, V) high entropy alloys

International Nuclear Information System (INIS)

Triveno Rios, C.; Kiminami, C.S.

2014-01-01

The microstructure of high entropy alloys consists of solid solution phases with FC and BCC simple structures, contrary to classical metallurgy where they form complex structures of intermetallic compounds. Because of this they have several attractive properties for engineering applications. In this work the AlCoFeNiMnTi 0,5 and AlCoFeNiVTi 0,5 alloys were processed by melting arc. Since the main objective was the microstructural and mechanical characterization of ingots as-cast. The alloys were characterized by scanning electron microscopy, X-ray diffraction, microhardness and cold compression test. The results showed that the microstructure consists mainly of dendrites and interdendritic regions consisting of metastable crystalline phases. It was also observed that the AlCoFeNiVTi 0,5 alloy showed better mechanical properties than the AlCoFeNiMnTi 0,5 alloy. This may be associated with differences in the parameters of formation of simple solid solution phases between the two alloys. (author)

Enhanced antibody-dependent cellular phagocytosis by chimeric monoclonal antibodies with tandemly repeated Fc domains.

Science.gov (United States)

Nagashima, Hiroaki; Ootsubo, Michiko; Fukazawa, Mizuki; Motoi, Sotaro; Konakahara, Shu; Masuho, Yasuhiko

2011-04-01

We previously reported that chimeric monoclonal antibodies (mAbs) with tandemly repeated Fc domains, which were developed by introducing tandem repeats of Fc domains downstream of 2 Fab domains, augmented binding avidities for all Fcγ receptors, resulting in enhanced antibody (Ab)-dependent cellular cytotoxicity. Here we investigated regarding Ab-dependent cellular phagocytosis (ADCP) mediated by these chimeric mAbs, which is considered one of the most important mechanisms that kills tumor cells, using two-color flow cytometric methods. ADCP mediated by T3-Ab, a chimeric mAb with 3 tandemly repeated Fc domains, was 5 times more potent than that by native anti-CD20 M-Ab (M-Ab hereafter). Furthermore, T3-Ab-mediated ADCP was resistant to competitive inhibition by intravenous Ig (IVIG), although M-Ab-mediated ADCP decreased in the presence of IVIG. An Fcγ receptor-blocking study demonstrated that T3-Ab mediated ADCP via both FcγRIA and FcγRIIA, whereas M-Ab mediated ADCP exclusively via FcγRIA. These results suggest that chimeric mAbs with tandemly repeated Fc domains enhance ADCP as well as ADCC, and that Fc multimerization may significantly enhance the efficacy of therapeutic Abs. Copyright © 2010 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

46 CFR 159.010-15 - Contracting inspections and tests or transferrals to another laboratory or person.

Science.gov (United States)

2010-10-01

...— (1) A request in writing regarding the contract or transfer is submitted to the Commandant before the contract is executed or the transfer is completed; and (2) The Commandant notifies the laboratory in... SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF...

Quality management and quality assurance contracts

International Nuclear Information System (INIS)

Teichler, M.

1991-01-01

Quality assurance contracts belong to the most important instruments of quality management systems. As a result of such contracts, quality control is to be done not only by the buyer, but is made a task to be fulfilled by the manufacturer. The author of the article shows that quality assurance contracts do change the contractual relationship between supplier and buyer, but have no effect on economic and practical conditions. This is so because quality assurance contracts apply only to warranty claims, which play a subordinate role in the legal relationship between producer and buyer, or producer and consumer, as compared to the claims for damages arising out of the contracts. (orig.) [de

17 CFR 8.05 - Enforcement staff.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Enforcement staff. 8.05... staff. (a) Each exchange shall establish an adequate enforcement staff which shall be authorized by the... staff shall consist of employees of the exchange and/or persons hired on a contract basis. It may not...

La transición de fase I4/mcm→Pm3m en Sr0.5Ba0.5HfO3-δ

Directory of Open Access Journals (Sweden)

Lamas, D.

2001-08-01

Full Text Available The effect of partial substitution of cations in AMO3 compounds have been studied because the physical properties and applications of these materials can be improved. In particular we are interested in the Sr1-xBaxHfO3 family. In SrHfO3 the phase transition to cubic structure has been observed to occur when the angle between two consecutive oxygen octahedra tends to zero. Instead in BaHfO3 no phase transition was observed. These facts were attributed to depend on the atomic radius of A cation. In this contribution the study of Sr0.5Ba0.5HfO3 oxide is shown. The compound was prepared by the high temperature solid state reaction method and analyzed by X-ray diffraction and Perturbed Angular Correlation (PAC Spectroscopy at different temperatures. Diffraction studies revealed that about 400-420º C a structural phase transition from I4/mcm to Pm3m occurred by tending to zero the rotation angle. By PAC this transition was also observed. In the cubic phase the electric field gradient EFG measured were produced by defects. The same model applied to interpreted the results of BaTi1-xHfxO3 and the atomic positions determined by X-ray diffraction were used. This calculation reproduces reasonably the temperature dependence of the EFG measured by PAC.Los AMO3, llamados perovskitas, forman una gran familia de compuestos que presentan a su vez diversas propiedades físicas así como enormes aplicaciones tecnológicas. Es posible expandir esta familia y sus propiedades y aplicaciones, sustituyendo los cationes Ay M originales por diferentes A’ y M’. En este trabajo presentamos el estudio del compuesto Sr1-xBaxHfO3 con x=0.5. El óxido fue preparado por el método de reacción en fase sólida. La muestra fue analizada por difracción de Rayos X y por espectroscopía de Correlaciones Angulares Perturbadas (PAC a diferentes temperaturas. El estudio cristalográfico del material reveló que entre 400 y 420ºC se produce la transición de fase de estructura I4

Evaluación económica de rituximab en combinación con fludarabina y ciclofosfamida en comparación con fludarabina y ciclofosfamida en el tratamiento de la leucemia linfática crónica Economic evaluation of rituximab added to fludarabine plus cyclophosphamide versus fludarabine plus cyclophosphamide for the treatment of chronic lymphocytic leukemia

Directory of Open Access Journals (Sweden)

Luis Felipe Casado

2011-08-01

Full Text Available Objetivos: Evaluar el coste-efectividad del esquema de rituximab, fludarabina y ciclofosfamida (R-FC en comparación con el de fludarabina y ciclofosfamida (FC en dos tipos de pacientes con leucemia linfática crónica (LLC: no tratados previamente o bien en recidiva/resistentes al tratamiento previo. Métodos: Dos modelos de Markov, utilizando los resultados publicados de superviviencia libre de progresión (SLP de pacientes con LLC tratados con R-FC o FC en primera o segunda línea, las tasas de progresión de la enfermedad y las tasas de mortalidad en España. A los estados de SLP y progresión se les asignaron utilidades obtenidas en un estudio sobre LLC. Los costes de los medicamentos y de los tratamientos de soporte, así como los años de vida ajustados por calidad (AVAC, se estimaron para un periodo de 10 años. Se efectuaron análisis de sensibilidad univariados y probabilísticos (Monte Carlo. Resultados: La adición de rituximab a la quimioterapia con FC aumentó los años de vida ganados (AVG y los AVAC tanto en primera como en segunda línea de tratamiento. La razón de coste-eficacia incremental fue de 20.703 € por AVG y de 19.343 € por AVAC con la primera línea de tratamiento, y de 23.183 € por AVG y 24.781 € por AVAC con la segunda línea de tratamiento. Conclusiones: En los pacientes con LLC no tratados previamente y en aquellos en recaída o resistentes al tratamiento previo, la adición de rituximab al esquema FC aumentó la esperanza de vida y los AVAC, y en ambos casos resultó ser un tratamiento coste-efectivo.Objectives: We evaluated the cost-effectiveness of rituximab added to the chemotherapy regimen of fludarabine plus cyclophosphamide (R-FC versus fludarabine plus cyclophosphamide (FC for the treatment of patients with previously untreated or relapsed/refractory chronic lymphocytic leukemia (CLL. Methods: Two Markov models were built, using published results on progression-free survival (PFS in patients

Elementos de flexibilidade em contratos de terceirização logística: o caso de uma empresa de telecomunicações Flexibility elements in contracts of logistic outsourcing: the case of a telecommunications company

Directory of Open Access Journals (Sweden)

Renata Albergaria de Mello Bandeira

2012-04-01

Full Text Available O artigo analisa, através da técnica de estudo de caso, a terceirização logística em uma empresa de telecomunicações. Inicialmente, são discutidos os cuidados e a importância do contrato de terceirização, segundo abordagem da economia dos custos de transação. Analisam-se as possíveis causas das falhas na contratação, e sugerem-se providências para evitar repetições em implementações semelhantes. A experiência adquirida indica que um erro primordial, na opinião dos autores, refere-se à falta de definição da estratégia a ser seguida pela organização em relação ao modelo de contratação. Essa definição é uma etapa fundamental, já que o contrato deve estar alinhado à estratégia.This article examines, through the technique of case study, the process of logistics outsourcing in a Brazilian telecommunications company. Initially, the importance of contracts for outsourcing is analyzed according to the perspective of the transaction costs economics theory. The possible causes of imperfections in the contracting process are analyzed, and the steps to avoid the repetition of these mistakes in similar implementations are suggested. According to the authors' point of view, the acquired experience indicates that a primary error in outsourcing contracts refers to the lack of a strategy to be followed by the organization in relation to a contracting model. This definition is a fundamental step, since the contract must be aligned to the strategy.

de Barranquilla (Colombia

Directory of Open Access Journals (Sweden)

Edgar Navarro Lechuga

2005-01-01

Full Text Available Objetivo: Determinar los factores asociados a consumo de cigarrillo en adultos del suroccidente de Barranquilla. Métodos: Estudio analítico (145 casos y 290 controles. Personas identificadas de la base de datos del estudio de «Enfermedades crónicas no transmisibles del suroccidente de Barranquilla». La tabulación se realizó en epiinfo 6.04, con salidas a Microsoft Word y Microsoft Excel. Resultados: 44.1% de los fumadores comenzaron a hacerlo por curiosidad. El promedio de edad de inicio fue de 17.1 años. El promedio de cigarrillos fumados por día fue de 6. Se encontró asociación entre fumar y ser hombre (OR 2.39; IC95%: 1.56 – 3.69, bajo nivel de escolaridad (OR 1.93; IC95%: 1.26 – 2.97, estar laborando (OR 2.17; IC95%: 1.41 – 3.35, tener miembros en la familia fumadores (OR: 2.7, IC95%: 1.4 – 5.3, influencia de los medios de comunicación (OR: 0.91; IC95%: 2.97 – 12.48, no pertenecer a una religión (OR: 1.62, IC95%: 1.06 – 2.49, consumir café con frecuencia (OR: 2.05, IC95%: 1.28 – 3.29, consumir alcohol (OR: 2.7, IC95%: 1.22 – 6.19 y tener disfuncionalidad familiar (OR: 2.3, IC95%: 1.17 – 4.5. Conclusiones: Los fumadores están expuestos a variables sociodemográficas, inherentes a su ser, y del medio ambiente. Es necesario intervenir sobre los factores de riesgo modificables para disminuir el consumo de cigarrillo.

48 CFR 970.3102-05 - Selected costs.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Selected costs. 970.3102... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Contract Cost Principles and Procedures 970.3102-05 Selected costs. ...

ESTUDIO COMPARATIVO DE LA REMOCIÓN DE MATERIA ORGÁNICA EN HUMEDALES CONSTRUIDOS DE FLUJO HORIZONTAL SUBSUPERFICIAL USANDO TRES ESPECIES DE MACRÓFITAS ESTUDO COMPARATIVO DA REMOÇÃO DE MATÉRIA ORGÂNICA EM BANHADOS CONSTRUÍDOS DE FLUXO HORIZONTAL SUBSUPERFICIAL USANDO TRES ESPÉCIES DE MACRÓFITAS COMPARATIVE STUDY OF THE ORGANIC MATTER REMOVAL IN HORIZONTAL SUBSURFACE FLOW CONSTRUCTED WETLANDS USING THREE SPECIES OF MACROPHYTES

Directory of Open Access Journals (Sweden)

JORGE IGNACIO MONTOYA

2010-12-01

Full Text Available Los humedales construidos se presentan actualmente como una tecnología prometedora en reducir la contaminación por aguas residuales; este estudio investigó la remoción de materia orgánica con agua residual sintética, en términos de demanda química de oxígeno (DQO, demanda biológica de oxígeno (DBO5 y mediciones in situ de pH, oxígeno y temperatura cada 15 días, durante 3 meses, en seis sistemas de humedales construidos de flujo subsuperficial horizontal, a escala piloto, sembrados con tres diferentes macrófitas: Canna limbata, Heliconia psittacorum y Phragmites sp; las remociones medias de DQO fueron de 97,31 % y 95,94 % para Canna limbata; 94,49 % y 93,50 % para Heliconia psittacorum; 97,39 % y 97,13 % para Phragmites sp. En DBO5 fueron de 100 % y 99,36 % para Canna limbata; 99,09 % y 97,49 % para Heliconia psittacorum; 100 % y 99,45 % para Phragmites sp. Se concluye que existen diferencias significativas para la remoción de DQO entre las diferentes plantas (P Os banhados construídos são agora uma tecnologia promissora para reduzir a poluição por esgotos; este estudo investigou a remoção de matéria orgânica com esgoto sintético, em termos de demanda química de oxigênio (DQO, demanda biológica de oxigênio (DBO5 e medições in situ de pH, oxigênio e temperatura a cada 15 dias durante 3 meses, em seis sistemas de banhados construídos de fluxo sub-superficial horizontal, em escala piloto plantados com três diferentes macrófitas: Canna limbata, Heliconia psittacorum e Phragmites sp; as remoçães médias de DQO média foram 97,31 % e 95,94 % para Canna limbata, 94,49 % e 93,50 % para Heliconia psittacorum; 97,39 % e 97,13 % para Phragmites sp. Em DBO5 foram de 100 % e 99,36 % para Canna limbata, 99,09 % e 97,49 % para Heliconia psittacorum; 100 % e 99,45 % para Phragmites sp. Conclui-se que existem diferenças significativas para a remoção de DQO entre plantas diferentes (P Constructed wetlands appear at the

A intersubjetividade no contexto da família de pessoas com fibrose cística

Directory of Open Access Journals (Sweden)

Geisa Santos Luz

2012-04-01

Full Text Available Trata-se de uma investigação qualitativa, com aproximação fenomenológica, que objetivou desvelar os processos intersubjetivos no contexto da família de pessoas com Fibrose Cística (FC. Desenvolveu-se entrevista com 14 famílias com portadores de FC, cadastrados na Associação Paranaense de Assistência à Mucoviscidose (AAMPR, residentes nas regiões Norte e Noroeste do estado do Paraná (PR, Brasil. Das suas falas foram apreendidas unidades de significado, agrupadas em três categorias: Família, portador de FC e o outro; Aspectos religiosos na vivência da FC na família; Portador de FC na vida escolar, afetiva e profissional. Os resultados evidenciaram que a experiência das famílias compartilhada com o outro foi crucial para o enfrentamento da doença. Conhecer os processos intersubjetivos que perpassam o âmago da família de pessoas acometidas pela FC possibilita um novo modo de atuar em Enfermagem.

Avaliação da remoção de cromo (III por materiais compósitos porosos adsorventes de PE-g-MA, fibra de coco e quitosana, usando planejamento experimental

Directory of Open Access Journals (Sweden)

Dilma Alves Costa

2017-04-01

Full Text Available RESUMO Os processos de adsorção podem ser empregados no tratamento de efluentes líquidos contendo metais pesados visando a reduzir os danos ambientais. Porém, o alto custo dos materiais adsorventes justifica a aplicação de adsorventes alternativos, como a fibra de coco (FC e a quitosana (Q. Assim, este trabalho teve como objetivo desenvolver compósitos porosos adsorventes a partir da mistura de polietileno graftizado com anidrido maleico/FC/Q/NaCl, como agente porogênico (PE-g-MA/FC/Q/NaCl, e avaliar estatisticamente a capacidade de adsorção do cromo (III em solução, com auxílio do software Statistica 5.0®. Os resultados mostraram que a eficiência do processo sofreu influência das dimensões da FC, do teor de Q e do pH da solução contendo Cr (III. A capacidade máxima de remoção de Cr (III por unidade de massa do compósito foi de 42,28 mg.g-1.

40 CFR Table 25 to Subpart G of... - Effective Column Diameter (Fc)

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Effective Column Diameter (Fc) 25 Table..., Table 25 Table 25 to Subpart G of Part 63—Effective Column Diameter (Fc) Column type Fc (feet) 9-inch by 7-inch built-up columns 1.1 8-inch-diameter pipe columns 0.7 No construction details known 1.0 ...

Comparação entre desempenhos de corrida time trial realizados em pista e esteira

Directory of Open Access Journals (Sweden)

Cecília Segabinazi Peserico

2014-05-01

Poucos estudos verificaram a influência do ambiente de teste (campo e laboratório sobre o ritmo de corrida e variáveis fisiológicas obtidas durante o desempenho em corrida de endurance. Portanto, o objetivo deste estudo foi comparar o comportamento da velocidade média (VM, ritmo de corrida, frequência cardíaca (FC e percepção subjetiva de esforço (PSE obtidas durante os desempenhos de corrida em provas time trial de uma hora realizados em pista de atletismo e em esteira. Dezoito homens corredores recreacionais (25,4 ± 3,3 anos realizaram duas performances de uma hora de corrida: uma em esteira e outra em pista de atletismo de 400 m. A PSE e a FC foram registradas a cada 10 minutos, e a VM a cada 15 minutos para a determinação do ritmo de corrida. As variáveis relacionadas aos desempenhos foram comparadas pelo teste t de Student para amostras pareadas. Os valores de VM, FC e PSE obtidos durante diferentes momentos das provas foram comparados pela Anova de dois fatores para medidas repetidas seguido do post hoc de Bonferroni. Para todas as análises, foi adotado nível de significância de P< 0,05. A VM da prova realizada em pista (12,2 ± 0,8 km·h-1 foi superior à prova em esteira (11,8 ± 0,8 km·h-1. Além disso, foram encontradas diferenças entre os dois desempenhos para os valores de frequência cardíaca média e máxima, e para o ritmo de corrida. A partir dessas diferenças, conclui-se que os desempenhos foram influenciados pelo ambiente onde as provas de uma hora foram realizadas.

Mycoplasma infection of cell lines can simulate the expression of Fc receptors by binding of the carbohydrate moiety of antibodies.

Science.gov (United States)

Lemke, H; Krausse, R; Lorenzen, J; Havsteen, B

1985-05-01

During the production of Fc receptor (FcR)-bearing hybridomas it was observed with a particular monoclonal anti-sheep red blood cell antibody (anti-SRBC 1/5, IgG1) that the contamination with Mycoplasma arginini of in vitro cultured cell lines leads to an apparent FcR activity. This property did not correspond with the serological typing since other antibodies of the same isotype could not support FcR rosette formation. Another mycoplasma strain M. orale lacked this property. Analysis of the binding reaction revealed that M. arginini contains a lectin which binds the carbohydrate moiety of the anti-SRBC 1/5 antibody, i.e. anti-SRBC 1/5 synthesized under the influence of tunicamycin or deglycosylated by NaIO4 oxidation did not support rosette formation. These data suggest that binding of antibodies to certain mycoplasma strains may be a pathogenic factor during mycoplasma infections by masking the microorganisms with the host's own defense molecules. The experiments with M. arginini-infected cell lines gain immunological importance since we obtained identical results with staphylococcal protein A, as another bacteriological FcR, and cell lines expressing intrinsic membrane FcR. Although it is an open question whether the glycoconjugates are directly bound by the FcR or else by influencing the three-dimensional structure of the antibodies, it seems possible that FcR in general may be lectins.

A strategy for bacterial production of a soluble functional human neonatal Fc receptor

DEFF Research Database (Denmark)

Andersen, Jan Terje; Justesen, Sune; Berntzen, Gøril

2008-01-01

The major histocompatibility complex (MHC) class I related receptor, the neonatal Fc receptor (FcRn), rescues immunoglobulin G (IgG) and albumin from lysosomal degradation by recycling in endothelial cells. FcRn also contributes to passive immunity by mediating transport of IgG from mother to fetus...

29 CFR 4.122 - Contracts for operation of postal contract stations.

Science.gov (United States)

2010-07-01

... Application of the McNamara-O'Hara Service Contract Act Specific Exclusions § 4.122 Contracts for operation of postal contract stations. The Act, in paragraph (7) of section 7, exempts from its provisions “any... 29 Labor 1 2010-07-01 2010-07-01 true Contracts for operation of postal contract stations. 4.122...

Substituição parcial do milho e farelo de soja por sorgo e farelo de caroço de algodão extrusado em rações de frangos de corte - DOI: 10.4025/actascianimsci.v29i2.217 Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations - DOI: 10.4025/actascianimsci.v29i2.217

Directory of Open Access Journals (Sweden)

Jorge Vitor Ludke

2007-11-01

Full Text Available O experimento teve como objetivo avaliar a utilização do sorgo (50% e do farelo de caroço de algodão extrusado (0; 13,33; 26,66 e 39,99% em substituição ao milho e à proteína do farelo de soja em rações de frangos de corte. Foi conduzido um experimento utilizando 300 pintos de corte, machos, distribuídos em um delineamento inteiramente casualizado com cinco tratamentos e cinco repetições de 12 aves por parcela. As variáveis analisadas foram consumo de ração (CR, ganho de peso (GP, conversão alimentar (CA e características de carcaça. Para CR e GP, não houve diferenças estatísticas (p > 0,05 entre o tratamento controle e o segundo tratamento com exceção para CA no período de 22 a 42 dias. Com o resultado para GP houve diferenças significativas (p 0,05 para todos os parâmetros avaliados. Tanto o sorgo quanto o farelo de caroço de algodão extrusado em substituição ao milho e o farelo de soja é possível até 13,31%, melhorando a conversão alimentar.Partial substitution of the corn and soybean for sorghum and expander cottonseed meal in broilers’ rations. The experiment aimed to evaluate the use of sorghum (50% and the expander cottonseed meal (0; 13.33; 26.66; 39.99% in substitution to the corn and the protein of the soybean meal in broilers’ rations. An experiment was carried out using 300 male broiler chicks, distributed in a randomized arrangement with five treatments and five repetitions of 12 birds per parcel. The analyzed variables were ration consumption (RC, weight gain (WG, feed conversion (FC and characteristics of carcass. RC and WG did not present any statistical differences (p > 0.05 between the controlled treatment and the second treatment, except for FC during the period of 22 to 42 days. As for WG, significant statistical differences were found (p 0.05 for all the evaluated parameters. Both sorghum and the expander cottonseed meal in substitution to the corn and the soybean meal are possible, up

Evaluation of covering materials in individual shelters and its effects on physiological responses and performance of dairy calves Avaliação de materiais de cobertura em abrigos individuais sobre respostas fisiológicas e desempenho de bezerros leiteiros

Directory of Open Access Journals (Sweden)

Patrícia C. de F Fonseca

2012-12-01

Full Text Available In Tropical regions, the animal performance is often affected by climate conditions. This study aimed to evaluate covering materials in individual shelters, normally used to house dairy calves, and its influence on the calves physiology and performance. The design used was completely randomized, with a 2x3 factorial arrangement to compare the averages of 5% through the Tukey's test, i.e., both genders- and three types of covering in the shelters (Z - zinc; AC - asbestos cement; and WPAC - white-painted asbestos cement. Parameters evaluated included daily weight gain (DWG, dry matter intake (DMI, feed conversion (FC, rectal temperature (RT, and respiratory frequency (RF. Results showed significant differences (P 0.05 in the FC and the RT, and there were significant differences (P Nos trópicos, o desempenho animal é prejudicado pela ação do clima. Objetivou-se neste trabalho avaliar materiais de cobertura em abrigos individuais sobre a fisiologia e o desempenho de bezerros leiteiros. Utilizou-se o delineamento inteiramente casualizado, fatorial 2 X 3, para a comparação das médias ao nível de 5%, pelo teste de Tukey, ou seja, dois sexos e três tipos de coberturas (Z - zinco; CA - cimento-amianto e CAB - cimento-amianto pintado de branco. Foram medidos o ganho de peso diário (GPD, o consumo alimentar (CMS, a conversão alimentar (CA, a temperatura retal (TR e a frequência respiratória (FR. Os resultados mostraram que houve diferença significativa (P 0,05 para CA e TR e observou-se diferença significativa (P < 0,05 para FR nos tratamentos Z (56,9 mov.min-1, CAB (62,2 mov.min-1 e CA (70,25 mov.min-1. Conclui-se que os diferentes tipos de coberturas não influenciaram no desempenho e no consumo alimentar, mas interferiram na fisiologia de termorregulação dos animais.

Contract types - turnkey

International Nuclear Information System (INIS)

Loeffler, G.

1975-01-01

Turnkey or the turnkey type of contract refers to a system of management according to which one organization accepts total responsibility for completing all parts and all phases of a project. In the case of a power project the turnkey contractor undertakes to design the plant, supply or procure and erect the equipment, build the station and put it into operation. (orig./FW) [de

Cleavage of the interchain disulfide bonds in rituximab increases its affinity for FcγRIIIA.

Science.gov (United States)

Suzuki, Mami; Yamanoi, Ayaka; Machino, Yusuke; Kobayashi, Eiji; Fukuchi, Kaori; Tsukimoto, Mitsutoshi; Kojima, Shuji; Kohroki, Junya; Akimoto, Kazunori; Masuho, Yasuhiko

2013-07-05

The Fc region of human IgG1 mediates effector function via binding to Fcγ receptors and complement activation. The H and L chains of IgG1 antibodies are joined by four interchain disulfide bonds. In this study, these bonds within the therapeutic IgG1 rituximab (RTX) were cleaved either by mild reduction followed by alkylation or by mild S-sulfonation; consequently, two modified RTXs - A-RTX (alkylated) and S-RTX (S-sulfonated) - were formed, and both were almost as potent as unmodified RTX when binding CD20 antigen. Unexpectedly, each modified RTX had a higher binding affinity for FcγRIIIA (CD16A) than did unmodified RTX. However, S-RTX and A-RTX were each less potent than RTX in an assay of antibody-dependent cellular cytotoxicity (ADCC). In this ADCC assay, each modified RTX showed decreased secretion of granzyme B, but no change in perforin secretion, from effector cells. These results provide significant information on the structures within IgG1 that are involved in binding FcγRIIIA, and they may be useful in the development of therapeutic antagonists for FcγRIIIA. Copyright © 2013 Elsevier Inc. All rights reserved.

Efecto de la torta de Sacha Inchi (Plukenetia volubilis sobre el desempeño productivo de juveniles de tilapia roja (Oreochromis sp.

Directory of Open Access Journals (Sweden)

Ricardo Alejandro Miranda-Gelvez

2015-07-01

Full Text Available Background: The cultivation of Sacha Inchi (P. volubilis has been developed in the Peruvian Amazon and in Colombia is grown mainly in the Department of Putumayo. There are proposals nowadays for implementation of this crop in the Catatumbo region (Norte de Santander. Objective: This study assessed the effect of Sacha Inchi cake (SIC (Plukenetia volubilis inclusion as a source of protein in diets for juveniles of red tilapia (Oreochromis sp. Methodology: four experimental diets including SIC as a partial substitute of fishmeal were prepared in the following percentages: 0%, 5%, 10% and 20%. 144 juvenile tilapia with initial weight of 5.8 ± 0.9 g were used, being fed with eight daily rations during 55 days to assess: weight gain (WG, feed conversion (FC, specific growth rate (SGR, protein efficiency ratio (PER, hepatosomatic index (HI and survival rate (%S. Results: The results showed no significant differences (p> 0.05 in any of the diets for FC and %S. However, the parameters: WG, SGR, PER and HI had significantly higher values for inclusions of 0,5 and 10%, being statistically different (p <0.01 from the 20% inclusion level. Conclusion: It is concluded that P. volubilis can replace fish meal up to a 10% level of inclusion.

Relativistic beam self-contraction in the inhomogeneous magnetic field with a neck

International Nuclear Information System (INIS)

Grishin, V.K.

1979-01-01

For production of short bunches of relativistic electrons and accompanying electromagnetic fields with amplitudes (up to MW/cm), considered was self-contraction of a relativistic electron beam (REB) in a magnetic field with a neck. REB dynamics in a ferrodielectric channel with permeability >> 1 was considered as well. It is shown, that in a such system, 10 m beam with a current up to ten kA is contracted to a length of approximately 0.5 m. Also the possible ways of application of the considered method of REB contraction are shown. For instance, a slow REB, fearing a great field, can be used for the capture and subsequent acceleration of heavy ions. The contracted beam application for generating powerful pulses of a h.f. field with, in fact, a homogeneous spectrum up to 100-300 MHz and total field energy up to 10-15% of initial beam energy is of great interest as well

ENFORCEMENT OF MORTGAGE CONTRACT

Directory of Open Access Journals (Sweden)

Alisa A. BELU

2016-07-01

Full Text Available A chattel mortgage contract is the expression of a real guarantee that gives the creditor precedence over other creditors, in addition to the general pledge upon the belongings of the debtor. It refers to the sale of mortgaged movable assets, exclusively or prioritized in favor of the mortgaging creditor, in case the debtor does not comply with his / her commitments, under the signed mortgage contract. Beginning from this purpose, shared by both sides (as the chattel mortgage contract is synallagmatic, in case the debtor is unable to fulfill his / her commitments, the sides reach a situation of enforcement of the signed chattel mortgage contract. Given the legal status of the chattel mortgage contract [Art. 2387-2477 Noul Cod Civil , Universul Juridic, Bucureşti, 2016, ISBN 978-606-673-792-0], the principle of binding force of the contract and the principle according to which signed legal conventions will entail legal effects, the Romanian law maker developed the proper legal framework for the enforcement of the chattel mortgage contract. [art. 622 si urm. Noul Cod de Procedură Civilă, ed. Hamangiu, Bucureşti, 2016, ISBN 978-606-27-0459-9].

Efeitos de um programa de hidroterapia na pressão arterial e freqüência cardíaca de mulheres idosas sedentárias Effects of a hidrotherapy program on blood pressure and heart rate in elderly, sedentary women

Directory of Open Access Journals (Sweden)

Juliana Monteiro Candeloro

2008-01-01

Full Text Available Este estudo visou analisar as conseqüências cardiocirculatórias (na pressão arterial, PA, e freqüência cardíaca, FC de um programa de hidroterapia cujo objetivo clínico era ganho de força muscular e flexibilidade para mulheres idosas saudáveis e sedentárias. Participaram 16 idosas, de 65 a 70 anos. O programa constou de 32 sessões, com uma hora de duração cada, de exercícios em imersão para ganho de força muscular e flexibilidade, com grau de dificuldade crescente, em sete fases. As quatro primeiras sessões foram usadas para adaptação ao meio aquático e desconsideradas para coleta de dados. As medidas de PA e FC foram coletadas ao final de cada fase, em quatro momentos: repouso fora da água, em repouso 3 minutos após imersão, em imersão ao final dos exercícios, e três minutos após a saída da piscina. Os dados foram analisados estatisticamente com nível de significância a pThis study aimed at analysing cardiocirculatory effects (on blood pressure, BP, and heart rate, HR of a hydrotherapy program of which the purpose was to increase muscle force and flexibility of 16 sedentary, healthy, 65-to-70 year-old women. The program consisted of 32 1-hour sessions of strength and flexibility training exercises, with increasing degree of difficulty in seven phases. The first four sessions were used for adaptation to the aquatic environment and the respective data were not considered. BP and HR were monitored at the end of each phase in four different moments: at rest before diving, at rest 3 minutes after immersion, still immerged at the end of exercises, and at rest, 3 minutes after exiting the pool. Collected measures were statistically analysed, and significance level set at p<0.05. Results show significant mean at-rest systolic BP decrease of 5.6 mmHg, and mean at-rest diastolic BP decrease of 9.7 mmHg, from the 5th (base session to the 32nd (last session; participants' BP classification turned from threshold-normal to

New cholescintigraphic agent: ruthenium-97-DISIDA

Energy Technology Data Exchange (ETDEWEB)

Zanzi, I.; Srivastava, S.C.; Meinken, G,E.; Robeson, W.; Mausner, L.F.; Fairchild, R.G.; Margouleff, D.

1986-06-01

These studies demonstrate the first application of Ru-97-DISIDA in human subjects. High quality images were obtained. Scintigraphic findings in patients with hepatobiliary disorders were consistent with the biodistribution data obtained in experinmental animals and with other imaging procedures and clinical findings. Administration of Ru-97-DISIDA I.V. and of a solid test meal labeled with Tc-99m-Sulfur Colloid allowed simulateneous detection and quantification of deodenogastric reflux and determination of the gastric emptying rate. This represents an advantage as compared to the currently used techniques which necessitate two separate studies if a solid meal is used, or would mandate a liquid meal for a simultaneous study. The excellent nuclear decay characteristics of Ru-97 (tl/2 69.6 h, gamma 216 keV, 86%, no betas) permit delayed study of the hepatobiliary system with considerably less radiation exposure than I-131 Rose Bengal and with a marked improvement in image quality. 5 refs., 3 figs., 3 tabs.

Effect of sintering condition on the microstructure and electrical properties of lead-free (Na0.5K0.5NbO3 - Bi0.5(Na0.83K0.170.5TiO3 ceramics

Directory of Open Access Journals (Sweden)

Wang Chun Huy

2017-01-01

Full Text Available In this work, the piezoelectric ceramic system of the (1-x(Na0.5K0.5NbO3 - xBi(Na0.83K0.17TiO3 with composition close to the morphotropic phase boundary is studied. (Na0.5K0.5NbO3 with 0∼5 mole% Bi(Na0.83K0.17TiO3 has been prepared following the conventional mixed oxide process. The effect of sintering time on the properties of 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics is discussed. For 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.46 and 155 p/CN, respectively, at the sintering of 1100 °C for 3 h. Dielectric and piezoelectric properties have maximum values at the sintering temperature of 1100 °C for 5 h. For 0.97(Na0.5K0.5NbO3 -0.03Bi(Na0.83K0.17TiO3 ceramics, the electromechanical coupling coefficients of the thickness mode kt and the piezoelectric constant d33 reach 0.56 and 190, respectively, at the sintering of 1100 °C for 5 h. The effect of prolonging the sintering time to the 0.97(Na0.5K0.5NbO3-0.03Bi(Na0.83K0.17TiO3 system is a helpful method on ceramic processing to improve densification and properties.

48 CFR 212.570 - Applicability of certain laws to contracts and subcontracts for the acquisition of commercially...

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Applicability of Certain Laws to the Acquisition of Commercial Items 212.570 Applicability of certain laws to contracts and... laws to contracts and subcontracts for the acquisition of commercially available off-the-shelf items...

Comportamento ingestivo de ovinos alimentados com dietas compostas de silagem de capim-elefante amonizada ou não e subprodutos agroindustriais Ingestive behaviour of sheep fed with ammoniated or non-ammoniated elephantgrass silage and agro industrial by-products

Directory of Open Access Journals (Sweden)

Gleidson Giordano Pinto de Carvalho

2006-08-01

Full Text Available Foram estudados os efeitos do uso de silagem de capim-elefante amonizada ou não com uréia (5% na base da MS e da substituição do concentrado (milho e farelo de soja por farelo de cacau (FC ou torta de dendê (TD na dieta sobre o comportamento ingestivo de ovinos Santa Inês. Dezoito ovinos machos não-castrados (peso médio inicial de 22,62 kg, alojados em baias individuais, foram distribuídos em delineamento experimental inteiramente casualizado, com seis tratamentos, dois volumosos (silagem de capim-elefante amonizada ou não com uréia e três níveis de substituição do concentrado (milho + farelo de soja por farelo de cacau ou torta de dendê (0% FC e TD, 40% FC e 40% TD na dieta, fornecida na proporção de 60:40 volumoso:concentrado. O período experimental foi de 78 dias, sendo 15 dias destinados à adaptação dos animais às dietas. Os animais foram observados a cada cinco minutos, durante dois períodos de 24 horas/dia, no final do período experimental. Foram registrados o tempo despendido em alimentação, ruminação e ócio e o número e o tempo de mastigações merícicas por bolo ruminado. Não houve diferença entre os tempos de alimentação, ruminação e ócio. A amonização do capim-elefente e a inclusão do farelo de cacau no concentrado aumentaram a eficiência de ruminação, mas a maioria dos parâmetros do comportamento ingestivo avaliados não sofreu alterações.The effects of feeding elephantgrass silage ammoniated or not with urea (5% DM basis and the concentrate replacement (corn and soybean meal by cocoa meal (CM or palm cake (PC on the ingestive behaviour of 18 Santa Inês non-castrated male sheep averaging 22.62 kg of initial body weight were studied. The animals were allotted to individual pensas a completely randomized design with six treatments, two roughages (elephantgrass silage ammoniated with urea or not and three concentrate replacement level with by cocoa meal or palm cake (0% CM and PC, 40% CM

Estudio de la carga interna en pádel amateur mediante la frecuencia cardíaca

Directory of Open Access Journals (Sweden)

Jesús Díaz García

2017-03-01

Full Text Available Los objetivos de este estudio fueron evaluar el nivel de condición física de 8 sujetos amateur de pádel, definir su perfil energético de esfuerzo en juego real mediante registro de frecuencia cardíaca (FC, y proponer un conjunto de variables justificadas de esta, que permita analizar el perfil de carga interna en pádel. Mediante prueba de esfuerzo incremental máxima en cinta de correr se obtuvieron parámetros ergoespirométricos, respiratorios y sus equivalentes cardíacos, introducidos en el sistema de registro de la FC Polar Team. Los sujetos disputaron 7 partidos de entrenamiento de 1 hora de duración y 72-96 horas de separación entre ellos, obteniéndose como variables: consumo máximo de oxígeno (VO2 máx y porcentaje (% de VO2 máx en el umbral anaeróbico; en prueba de esfuerzo, FC máx., media y mín., y zonas de trabajo metabólicas (rangos de FC. Los resultados presentan VO2 máx de 51,15 ± 5,73 ml · kg–1 · min–1, FC máx. durante el juego de 154,75 ± 7,25 ppm, FC med de 130,0 ± 10,4 ppm para tiempo de juego y 89,75 % del tiempo de juego en zona de trabajo aeróbica. Como conclusión, el esfuerzo al que son sometidos durante el juego a nivel cardiorrespiratorio los jugadores amateur de pádel se basa casi exclusivamente en metabolismos aeróbicos. Además, las variables máx., mín. y media de FC para tiempos de juego y descanso y el establecimiento de zonas de trabajo de FC pueden aportarnos información importante sobre lo que ocurre en el juego a nivel cardiorrespiratorio.

PRODUCCIÓN DE BIOMASA Y EXOPOLISACÁRIDOS DE Grifóla frondosa BAJO CULTIVO SUMERGIDO UTILIZANDO FUENTES DE CARBONO NO CONVENCIONALES

OpenAIRE

Zapata, Paula; Rojas, Diego; Fernández, Carlos; Ramírez, David; Restrepo, Gloria; Orjuela, Viviana; Arroyave, Marcela; Gómez, Tatiana; Atehortüa, Lucía

2007-01-01

Grifóla frondosa es un hongo Basidiomycete comestible y medicinal que produce polisacáridos tipo glucanos (β-1,6 y β-1,3) con actividad antitumoral e inmunomoduladora. Para el presente trabajo, el objetivo fue evaluar la incidencia de diferentes fuentes de carbono (FC) en la producción de biomasa y exopolisacári-dos (EPS), bajo condiciones de cultivo sumergido, utilizando un diseño estadístico factorial con dos factores: fuente de carbono (FC(1-7)) y medio (MB y MS). La máxima produ...

Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D.

NARCIS (Netherlands)

Kapur, R.; Della Valle, L.; Verhagen, O.J.; Hipgrave Ederveen, A.; Ligthart, P.; de Haas, M.; Kumpel, B.; Wuhrer, M.; van der Schoot, C.E.; Vidarsson, G.

2015-01-01

Background RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions

Prophylactic anti-D preparations display variable decreases in Fc-fucosylation of anti-D

NARCIS (Netherlands)

Kapur, Rick; Della Valle, Luciana; Verhagen, Onno J. H. M.; Hipgrave Ederveen, Agnes; Ligthart, Peter; de Haas, Masja; Kumpel, Belinda; Wuhrer, Manfred; van der Schoot, C. Ellen; Vidarsson, Gestur

2015-01-01

RhIG is obtained from hyperimmunized healthy anti-D donors (HIDs) boosted with D+ red blood cells (RBCs). One hypothesis for its mechanism of action is fast clearance of opsonized D+ RBCs through Fcγ receptor (FcγR)III. Levels of immunoglobulin (Ig)G Fc-fucosylation influence interactions with

Long-term contracts and take-or-pay clauses in natural gas markets

International Nuclear Information System (INIS)

Creti, A.; Villeneuve, B.

2004-01-01

Theoretical and empirical research on long-term contracts inspired by the American experience are surveyed, with emphasis on the analysis of the role of take-or-pay clauses and price indexation rules, and whether regulation distorts optimal contract duration. The underlying motivation is to analyze the economic fundamentals of the European Union provisions on long-term contracts in the natural gas industry, and to highlight the features that differentiate them from the American experience. The impacts of long term contracts in the opening to competition of the European Union natural gas sector, and the apparent confusion between contract duration and flexibility as applied to long-term contracts in the European Union, are also explored. 29 refs., 2 tabs

NRG1-Fc improves metabolic health via dual hepatic and central action.

Science.gov (United States)

Zhang, Peng; Kuang, Henry; He, Yanlin; Idiga, Sharon O; Li, Siming; Chen, Zhimin; Yang, Zhao; Cai, Xing; Zhang, Kezhong; Potthoff, Matthew J; Xu, Yong; Lin, Jiandie D

2018-03-08

Neuregulins (NRGs) are emerging as an important family of signaling ligands that regulate glucose and lipid homeostasis. NRG1 lowers blood glucose levels in obese mice, whereas the brown fat-enriched secreted factor NRG4 protects mice from high-fat diet-induced insulin resistance and hepatic steatosis. However, the therapeutic potential of NRGs remains elusive, given the poor plasma half-life of the native ligands. Here, we engineered a fusion protein using human NRG1 and the Fc domain of human IgG1 (NRG1-Fc) that exhibited extended half-life in circulation and improved potency in receptor signaling. We evaluated its efficacy in improving metabolic parameters and dissected the mechanisms of action. NRG1-Fc treatment triggered potent AKT activation in the liver, lowered blood glucose, improved insulin sensitivity, and suppressed food intake in obese mice. NRG1-Fc acted as a potent secretagogue for the metabolic hormone FGF21; however, the latter was largely dispensable for its metabolic effects. NRG1-Fc directly targeted the hypothalamic POMC neurons to promote membrane depolarization and increase firing rate. Together, NRG1-Fc exhibits improved pharmacokinetic properties and exerts metabolic benefits through dual inhibition of hepatic gluconeogenesis and caloric intake.

Induction of functional Fc receptors in P388 leukemia cells. Requirement for multiple differentiation signals.

Science.gov (United States)

Cohen, D A; Stotelmyer, N L; Kaplan, A M

1985-04-01

The development of functional Fc receptors (FcR) during induced differentiation with the tumor promoter, phorbol myristate acetate (PMA), was studied in the murine tumor cell line, P388. PMA induced the appearance of FcR on the membranes of P388 cells as indicated by the binding of IgG-coated sheep red blood cells (IgG-SRBC). Concentrations of PMA as low as 1 ng/ml were sufficient to induce the expression of FcR as well as to inhibit cellular division and to induce adherence in the P388 tumor cell line; however, optimal FcR induction occurred at PMA concentrations of 10-100 ng/ml. Immunofluorescent analysis with heat-aggregated myeloma proteins indicated that PMA induced FcR which were capable of binding IgG2a and IgG2b immunoglobulins, but not IgG1. Adherence to a substratum was determined to be a second required signal for expression of FcR, since PMA induction of P388 tumor cells in teflon dishes failed to fully develop FcR and adherence of P388 cells to poly-L-lysine-coated culture dishes in the absence of PMA was insufficient for FcR expression. FcR which appeared after PMA induction were non-functional in the sense that membrane-bound IgG-SRBC were not ingested to any significant extent by the tumor cells. However, if FcR induction occurred in the presence conA-induced rat spleen cell culture supernatants, phagocytosis of membrane-bound erythrocytes occurred. These findings suggest that for the expression of FcR which are capable of particle internalization, at least three identifiable membrane-transmitted signals are required during differentiation.

Crescimento de mudas de Eucalyptus camaldulensis em substratos à base de casca de arroz carbonizada

Directory of Open Access Journals (Sweden)

Dagma Kratz

2016-06-01

Full Text Available RESUMO Com base na importância do substrato na produção de mudas florestais, objetivou-se, com este trabalho, avaliar a viabilidade técnica de 13 substratos, preparados com misturas de substrato comercial à base de casca de pinus e vermiculita (SC, casca de arroz carbonizada com diferentes granulometrias [maior que 2 mm (CAC1, CAC com granulometria entre 1 - 2 mm (CAC2, CAC com granulometria entre 0,5 - 1 mm (CAC3, CAC com granulometria menor que 0,5 mm (CAC4], fibra de coco (FC e vermiculita média (VM, na produção de mudas de Eucalyptus camaldulensis, e a correlação de suas propriedades físicas e químicas com seu crescimento. Foram utilizados tubetes de 55 cm³. As mudas permaneceram 60 dias em estufa de vidro e 30 dias a pleno sol. Foram avaliadas a altura, diâmetro de colo, fitomassas secas aérea e radicial, facilidade de retirada do tubete, agregação das raízes ao substrato e relação entre altura e diâmetro de colo. Concluiu-se que o substrato formado por CAC pura, em diferentes granulometrias e em mistura com os outros componentes, é viável tecnicamente para a produção de mudas de Eucalyptus camaldulensis, embora aquele formado pela mistura de 50% de CAC e VM tenha resultado em maior crescimento das mudas. As propriedades dos substratos, densidade aparente, pH e capacidade de troca catiônica são importantes na produção de mudas, pois apresentaram correlações significativas com as variáveis biométricas.

Validity and efficacy of the labor contract

Directory of Open Access Journals (Sweden)

Jorge Toyama

2012-12-01

Full Text Available The validity and efficacy of the labor contract as well as cases of nullity and defeasibility import an analysis of scopes of the supplementary application of Civil Code taking into account the peculiarities of Labor Law. Labor contract, while legal business has as regulatory framework to the regulations of Civil Code but it is necessary to determine, in each case, whether to apply fully this normative body, or modulate its supplemental application, or simply conclude that it doesn’t result compatible its regulation due to the special nature of labor relations. Specifically, this issue will be analyzed from cases of nullity and defeasibility of the labor contract.

Biodisponibilidad de lisina para el pollo en crecimiento de cuatro harinas de subproductos avícolas

Directory of Open Access Journals (Sweden)

Arturo Cortes Cuevas

2011-01-01

Full Text Available Para conocer la biodisponibilidad de lisina para el pollo de cuatro lotes de harinas de subproductos avícolas (HSA mexicanas, se realizaron dos experimentos. En el Exp 1, se emplearon 168 pollitos de 1 a 21 días de edad y en el Exp 2, 210 pollitos de 7 a 21 días, en ambos experimentos las aves se distribuyeron completamente al azar en siete tratamientos con tres repeticiones cada uno. Los tratamientos fueron, 1 dieta basal sorgo-soya-ajonjolí (deficiente en lisina, 2 dieta basal + 0.05% de L-lisina, 3 dieta basal+0.10% de L-lisina, 4 dieta basal+0.05% de lisina a partir de HSA A o B, 5 dieta basal+0.10% de lisina a partir de HSA A o B, 6 dieta basal+0.05% de lisina a partir de HSA C o D y 7 dieta basal+0.10% de lisina a partir de HSA C o D. Los resultados del crecimiento se explicaron por la ecuación de regresión lineal múltiple de, Y=265.074+0.04288X1+0.0417X2+0.04085X3 , en donde X1 fue L-lisina, X2 la HSA A y X3 la HSA C (Exp 1 y del Exp 2 por Y=129.131+ 0.06764X1+0.06437X2+0.06614X3, en donde X1 fue L-lisina, X2 la HSA B y X3 la HSA D. Al comparar las pendientes de las HSA, con la de L-lisina considerada como 100 %, se obtuvieron biodisponibilidades de la HSA A de 97.2 %, C de 95.2 %, B de 95.2 % y D de 97.8 %. En base a los resultados obtenidos, se puede concluir que la calidad proteica de los cuatro lotes de harinas evaluadas, resultaron similares y de buena calidad.

46 CFR 97.05-1 - Duty of officers.

Science.gov (United States)

2010-10-01

... Lakes. These notices may be obtained free of charge, by making application to Commander, 9th Coast Guard... Edition), published by the Commander, 9th Coast Guard District, contain announcements and information on... in the U.S. Consulates where they may be inspected. [CGFR 66-33, 31 FR 15286, Dec. 6, 1966, as...

Monoclonal antibodies and Fc fragments for treating solid tumors

Directory of Open Access Journals (Sweden)

Eisenbeis AM

2012-01-01

Full Text Available Andrea M Eisenbeis, Stefan J GrauDepartment of Neurosurgery, University Hospital of Cologne, Cologne, GermanyAbstract: Advances in biotechnology, better understanding of pathophysiological processes, as well as the identification of an increasing number of molecular markers have facilitated the use of monoclonal antibodies and Fc fragments in various fields in medicine. In this context, a rapidly growing number of these substances have also emerged in the field of oncology. This review will summarize the currently approved monoclonal antibodies used for the treatment of solid tumors with a focus on their clinical application, biological background, and currently ongoing trials.Keywords: targeted therapy, monoclonal antibodies, cancer, biological therapy