Informationization nuclear apparatus communication technique
International Nuclear Information System (INIS)
Yu Tiqi; Fang Zongliang; Wen Qilin
2006-01-01
The paper explains the request of communication ability in nuclear technique application area. Based on the actuality of nuclear apparatus communication ability, and mainly combining with the development of communication technique, the authors analyzes the application trend of communication technique applying in nuclear apparatus, for the apparatus and system needing communication ability, they need selecting suitable communication means to make them accomplish the task immediately and effectively. (authors)
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFA408 (Link to dictyBase) - - - Contig-U10972-1 SFA408P (Link... to Original site) SFA408F 509 SFA408Z 686 SFA408P 1195 - - Show SFA408 Library SF (Link to library) Clone ID SFA408 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...YLSXDQVESIIASIKGKVIQLSKDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYVVQHL ...KDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYV
Understanding Variation in Implementation of SFA in the i3 Scale-Up Project
Quint, Janet; Zhu, Pei; Doolittle, Fred
2012-01-01
The main confirmatory research question guiding the design of the impact evaluation is: "What is the impact of Success for All (SFA) on elementary school students' reading achievement, compared to students in non-SFA schools?" An answer to this question will determine the assessment of whether SFA is successful at turning around low-performing…
SFA Adoption: Empirical Evidences from a Case Study
Directory of Open Access Journals (Sweden)
Silvio Cardinali
2014-06-01
Full Text Available Understanding how technology investments create business value is a research priority in today's technology-intensive world. Drawing on a literature review as well as a qualitative study, this research suggests that sales technology can support both: externally focused tasks towards managing customer relationships and internal administrative tasks. To unleash its real potential, sales technology should be designed to enable customer relationships rather than being perceived as a cost cutting tool. Today organisations are forced to constantly invent new ways of interacting with the customer to increase customer loyalty and to decrease the possibility of commoditization. This paper will focus on Sales Force Automation (SFA and its increasing importance. It will explore the purpose of SFA, its advantages and disadvantages, and its future impact on organisations through a qualitative research study: the authors investigated a small company operating in the business-to-business services sector to obtain practical feedback on the organisational and individual implications, the potential benefits and the problems related to adoption of an SFA system.
The impact of non-discretionary factors on DEA and SFA technical efficiency differences.
Kontodimopoulos, Nick; Papathanasiou, Nikolaos D; Flokou, Angeliki; Tountas, Yannis; Niakas, Dimitris
2011-10-01
The purpose of this study was to examine if factors of the external operating environment can explain differences in technical efficiency derived from Data Envelopment Analysis (DEA) and Stochastic Frontier Analysis (SFA). In a sample of 124 dialysis facilities, technical efficiency was compared according to ownership, region, years in operation and size. With second-stage Tobit regression, DEA and SFA efficiency was regressed against these environmental factors to determine their potential for predicting technical efficiency, as well as the efficiency differences between the two frontier methods. DEA expectedly generated lower mean efficiency scores than SFA (68.2% vs. 79.4%, P DEA-SFA efficiency differences was explained by environmental factors. This suggests that in addition to market instabilities, luck, and other related phenomena, decision-makers in their effort to determine optimal resource allocation, should point their attention to the potentially useful insight provided by environmental factors.
International Nuclear Information System (INIS)
Azadeh, A.; Ghaderi, S.F.; Omrani, H.; Eivazy, H.
2009-01-01
This paper presents an integrated data envelopment analysis (DEA)-corrected ordinary least squares (COLS)-stochastic frontier analysis (SFA)-principal component analysis (PCA)-numerical taxonomy (NT) algorithm for performance assessment, optimization and policy making of electricity distribution units. Previous studies have generally used input-output DEA models for benchmarking and evaluation of electricity distribution units. However, this study proposes an integrated flexible approach to measure the rank and choose the best version of the DEA method for optimization and policy making purposes. It covers both static and dynamic aspects of information environment due to involvement of SFA which is finally compared with the best DEA model through the Spearman correlation technique. The integrated approach would yield in improved ranking and optimization of electricity distribution systems. To illustrate the usability and reliability of the proposed algorithm, 38 electricity distribution units in Iran have been considered, ranked and optimized by the proposed algorithm of this study.
Centrifuge Techniques and Apparatus for Transport Experiments in Porous Media
Energy Technology Data Exchange (ETDEWEB)
Earl D. Mattson; Carl D. Paler; Robert W. Smith; Markus Flury
2010-06-01
This paper describes experimental approaches and apparatus that we have developed to study solute and colloid transport in porous media using Idaho National Laboratory's 2-m radius centrifuge. The ex-perimental techniques include water flux scaling with applied acceleration at the top of the column and sub-atmospheric pressure control at the column base, automation of data collection, and remote experimental con-trol over the internet. These apparatus include a constant displacement piston pump, a custom designed liquid fraction collector based on switching valve technology, and modified moisture monitoring equipment. Suc-cessful development of these experimental techniques and equipment is illustrated through application to transport of a conservative tracer through unsaturated sand column, with centrifugal acceleration up to 40 gs. Development of such experimental equipment that can withstand high accelerations enhances the centrifuge technique to conduct highly controlled unsaturated solute/colloid transport experiments and allows in-flight liquid sample collection of the effluent.
Directory of Open Access Journals (Sweden)
Marcus Vinicius Pereira de Souza
2010-12-01
Full Text Available Este artigo apresenta medidas de eficiência para 40 distribuidoras de energia elétrica que operam no setor elétrico brasileiro. As medidas foram obtidas por modelos de análise envoltória de dados (DEA e modelos de fronteira estocástica (SFA, duas técnicas que podem mitigar a assimetria de informação e aprimorar a habilidade do agente regulador comparar os desempenhos das distribuidoras, requisitos fundamentais em esquemas de regulação incentivada. As duas abordagens são apresentadas e os resultados obtidos pelos diferentes modelos são comparados.This paper shows the efficiency measurements of 40 Brazilian electricity distribution companies. The efficiency scores are obtained using the data envelopment analysis (DEA and stochastic frontier analysis (SFA models, techniques that can reduce the information asymmetry and improve the regulator skills to compare the performance of the electricity companies, which are fundamental aspects of regulatory regimes. The two approaches are described, and the main results obtained from the different models are compared.
Omega-6/Omega-3 and PUFA/SFA in Colossoma macropomum Grown in Roraima, Brazil
Directory of Open Access Journals (Sweden)
Antonio Alves Melho Filho
2013-05-01
Full Text Available In this study was evaluated the fatty acids composition of tambaqui (Colossoma macropomum fillet, fish species cultivated in Roraima State, Brazil. For the extraction of tambaqui oil was used Sohxlet device and then it was methylated. The oil was identified using a gas chromatograph and were identified 24 acids and these were divided into characteristic groups such as: saturated fatty acids (SFA, monounsaturated fatty acids (MUFA, polyunsaturated fatty acids (PUFA and series fatty acids omega-6 and omega-3. The ratios obtained were PUFA/SFA and omega-6/omega-3. The results of chromatographic analysis were subjected to tests by variance ANOVA and multiple comparisons of Tukey at 5%. The ratios omega-6/omega-3 and PUFA/SFA showed values of 8.58 and 0.75 respectively.
Stenting of the SFA - indications, techniques,
International Nuclear Information System (INIS)
Rieger, J.; Treitl, M.; Reiser, M.; Ruppert, V.
2006-01-01
Aggressive risk factor modification, change of eating habits, exercise programs, and forceful antiplatelet therapy are the most important tools for the treatment of PAOD in symptomatic patients suffering from intermittent claudication. There are however no guidelines for revascularization at this stage. Endovascular treatment has been increasingly utilized over the last decade and increasingly displaced vascular surgery. Amongst numerous endovascular techniques beside PTA, stents meanwhile play the most important role due to constant technical progress. Results regarding the rate of restenosis or patency rates still remain worse compared to other vascular beds. This paper gives a review over recent results, currently available stent techniques, and possible indications for the endovascular therapy of an artery, which has turned out to be the biggest ordeal for material and construction of stents. (orig.) [de
Are bio-absorbable stents the future of SFA treatment?
Peeters, P; Keirse, K; Verbist, J; Deloose, K; Bosiers, M
2010-02-01
Several limitations inherent to the implantation of a metallic device, such as the occurrence of in-stent re-stenosis, in an arterial lumen intuitively explain the interest for developing bio-absorbable stents. Two main types of bio-absorbable stents currently exist: polymer stents and metallic stents. To date, no studies with bio-absorbable stents have been conducted in the superficial femoral artery (SFA). Because of their strut thickness and lack of radial force, polymer stents are no good candidates for endovascular use. Absorbable metal stents (AMS) do have the potential to perform well for artery treatment, although current evidence from in-human coronary and infrapopliteal studies yield unsatisfactory results. Drastic technological improvements are mandatory before AMS can be considered for every day practice. Yet, it is our belief that further development of other metal and non-metal bio-absorbable stents, with or without drug-coating, may lead to the creation of the ultimate SFA stent.
First experience in international air transportation of RR SFA in Russian-made TUK-19 casks
International Nuclear Information System (INIS)
Kanashov, B.A.; Barinkov, O.P.; Dorofeev, A.N.; Komarov, S.V.; Smirnov, A.V.; Biro, L.; Budu, M.; Ciocanescu, M.
2010-01-01
Traditionally, spent fuel assemblies (SFA) have been transported across the Russian Federation by rail in special railcars. New conditions required SFA shipments by other conveyance, i.e. road, sea and even air transport. The air shipment of the VVR-S research reactor SNF in TUK-19 casks from Magurele, Romania in June 2009 was the first experience after new Russian and international regulations for the safe transport of radioactive material came into effect. The preparatory stage of the shipment focused on the issues associated with radiation and nuclear safety both during the loading and transport operations. The project covered development of a technology and equipment for SFA loading into TUK-19 casks and that for the air shipment. The SFAs were loaded into the TUK-19 casks with a specially designed transfer cask, and the SFA-containing packages were transported in specialized freight 20-foot ISO-containers. The safety of the loading and transport operations was ensured both by reliable engineering solutions, and selected conveyances and routes. The paper shows that the loading and the air shipment of the Romanian SFAs in TUK-19 casks does not contradict Romanian, Russian and international regulations for the safe transport of radioactive material. The outcomes of the SNF shipment from Romania confirmed correctness of the solutions and demonstrated high environmental safety. (author)
Recent Progress in Electrical Insulation Techniques for HTS Power Apparatus
Hayakawa, Naoki; Kojima, Hiroki; Hanai, Masahiro; Okubo, Hitoshi
This paper describes the electrical insulation techniques at cryogenic temperatures, i.e. Cryodielectrics, for HTS power apparatus, e.g. HTS power transmission cables, transformers, fault current limiters and SMES. Breakdown and partial discharge characteristics are discussed for different electrical insulation configurations of LN2, sub-cooled LN2, solid, vacuum and their composite insulation systems. Dynamic and static insulation performances with and without taking account of quench in HTS materials are also introduced.
Modified swelling pressure apparatus using vapor pressure technique for compacted bentonite
International Nuclear Information System (INIS)
Nishimura, Tomoyoshi
2012-01-01
Document available in extended abstract form only. bentonite. The compacted bentonite is found in unsaturated conditions before applying of swelling due to absorption. The behaviour of compacted bentonite is not consistent with the principle and concepts of classical, saturated soil mechanics. An unsaturated soil theoretical framework using soil water characteristic curve has been fairly established over the past several decades. The soil-water characteristic curve is a relationship between soil moisture and soil suction obtained by the axis translation technique, vapor pressure technique or osmotic suction control which is a key feature in unsaturated soil mechanics. The soil-water characteristic curve can be used for prediction of the shear strength, volume change and hydraulic conductivity. Cui et al. 2002 indicated soil-water characteristic curve of expansive clay soil in high soil suction ranges using osmotic suction technique. Tripathy et al. 2010 described the soil-water characteristic curve both using the axis translation technique and vapor pressure technique in the entire soil suction ranges. Nishimura and Koseki 2011 measured suction of bentonite applied high soil suction due vapor pressure using a chilled mirror dew point potentiometer (WP4-T of DECAGON Device). The bentonite with gravimetric water content of 18 % indicated soil suction of 2.8 MPa at least. It is predicted that suction efforts to swelling pressure and shear strength of unsaturated compacted bentonite. This study focuses on the influence of suction on both swelling pressure and shear strength of compacted bentonite. The soil-water characteristic curve (SWCC) tests were conducted for compacted bentonite using both axis-translation technique and vapor pressure technique. The SWCC had a range from 0 kPa to 296 MPa in suction. The compacted bentonite having two different soil suctions were prepared for swelling pressure tests. Newly swelling pressure testing apparatus was developed in order
Prevalence of Avian Pathogenic Escherichia coli (APEC Clone Harboring sfa Gene in Brazil
Directory of Open Access Journals (Sweden)
Terezinha Knöbl
2012-01-01
Full Text Available Escherichia coli sfa+ strains isolated from poultry were serotyped and characterized by polymerase chain reaction (PCR and amplified fragment length polymorphism (AFLP. Isolates collected from 12 Brazilian poultry farms mostly belonged to serogroup O6, followed by serogroups O2, O8, O21, O46, O78, O88, O106, O111, and O143. Virulence genes associated were: iuc 90%, fim 86% neuS 60%, hly 34%, tsh 28%, crl/csg 26%, iss 26%, pap 18%, and 14% cnf. Strains from the same farm presented more than one genotypic pattern belonging to different profiles in AFLP. AFLP showed a clonal relation between Escherichia coli sfa+ serogroup O6. The virulence genes found in these strains reveal some similarity with extraintestinal E. coli (ExPEC, thus alerting for potential zoonotic risk.
International Nuclear Information System (INIS)
Kuosmanen, Timo; Saastamoinen, Antti; Sipiläinen, Timo
2013-01-01
Electricity distribution is a natural local monopoly. In many countries, the regulators of this sector apply frontier methods such as data envelopment analysis (DEA) or stochastic frontier analysis (SFA) to estimate the efficient cost of operation. In Finland, a new StoNED method was adopted in 2012. This paper compares DEA, SFA and StoNED in the context of regulating electricity distribution. Using data from Finland, we compare the impacts of methodological choices on cost efficiency estimates and acceptable cost. While the efficiency estimates are highly correlated, the cost targets reveal major differences. In addition, we examine performance of the methods by Monte Carlo simulations. We calibrate the data generation process (DGP) to closely match the empirical data and the model specification of the regulator. We find that the StoNED estimator yields a root mean squared error (RMSE) of 4% with the sample size 100. Precision improves as the sample size increases. The DEA estimator yields an RMSE of approximately 10%, but performance deteriorates as the sample size increases. The SFA estimator has an RMSE of 144%. The poor performance of SFA is due to the wrong functional form and multicollinearity. - Highlights: • We compare DEA, SFA and StoNED methods in the context of regulation of electricity distribution. • Both empirical comparisons and Monte Carlo simulations are presented. • Choice of benchmarking method has a significant economic impact on the regulatory outcomes. • StoNED yields the most precise results in the Monte Carlo simulations. • Five lessons concerning heterogeneity, noise, frontier, simulations, and implementation
Neutron logging reliability techniques and apparatus
International Nuclear Information System (INIS)
Johnstone, C.W.
1975-01-01
Apparatus and methods for verifying the validity of data derived at least in part by neutron logging of earth formations, and, where indicated, for affording neutron diffusion-corrected values of such data, are disclosed. (WHK)
The speed of progress in the apparatus handling technique in rhythmic gymnastics
Directory of Open Access Journals (Sweden)
Moskovljević Lidija
2013-01-01
Full Text Available Specificity of rhythmic gymnastics as a sport and as a teaching device are apparatus routines. Considering lack of researches, the aim of our study was to determine ages of maturity when the development in apparatus routines performance is greater. Development in essential rope, hoop and ball routine performance was examined two times per year, through four years experimental period. The evaluation is carried out three-member RG-expert committee on a scale of 1 to 10. A total of twenty-seven competitors, examined at ages seven to fourteen, participate in this study. Based on data, we can notice that speed of progress in apparatus handling technique was not equal during observing maturity period. There was not significant development in most of examined routines between seven to nine years of ages. Significant development in this period has been achieved only in two rope routines (Vij1 i Vij2R and one ball routine to (Lop2R. From eleven to twelve years of ages, significant development has been achieved for most of routines, except basic running with rope (Vij1 and hoop routine performed with weaker arm (Obr2L. At 12 to 13 years of ages, development of routines performance has not been statistically significant.
Li, Xiaobin; Top, Eva M; Wang, Yafei; Brown, Celeste J; Yao, Fei; Yang, Shan; Jiang, Yong; Li, Hui
2014-01-01
A self-transmissible broad-host-range (BHR) plasmid pSFA231 was isolated from petroleum-contaminated sediment in Shen-fu wastewater irrigation zone, China, using the triparental mating exogenous plasmid capture method. Based on its complete sequence the plasmid has a size of 41.5 kb and codes for 50 putative open reading frames (orfs), 29 of which represent genes involved in replication, partitioning and transfer functions of the plasmid. Phylogenetic analysis grouped pSFA231 into the newly defined PromA plasmid family, which currently includes five members. Further comparative genomic analysis shows that pSFA231 shares the common backbone regions with the other PromA plasmids, i.e., genes involved in replication, maintenance and control, and conjugative transfer. Nevertheless, phylogenetic divergence was found in specific gene products. We propose to divide the PromA group into two subgroups, PromA-α (pMRAD02, pSB102) and PromA-β (pMOL98, pIPO2T, pSFA231, pTer331), based on the splits network analysis of the RepA protein. Interestingly, a cluster of hypothetical orfs located between parA and traA of pSFA231 shows high similarity with the corresponding regions on pMOL98, pIPO2T, and pTer331, suggesting these hypothetical orfs may represent "essential" plasmid backbone genes for the PromA-β subgroup. Alternatively, they may also be accessory genes that were first acquired and then stayed as the plasmid diverged. Our study increases the available collection of complete genome sequences of BHR plasmids, and since pSFA231 is the only characterized PromA plasmid from China, our findings also enhance our understanding of the genetic diversity of this plasmid group in different parts of the world.
Directory of Open Access Journals (Sweden)
Xiaobin eLi
2015-01-01
Full Text Available A self-transmissible broad-host-range (BHR plasmid pSFA231 was isolated from petroleum-contaminated sediment in Shen-fu wastewater irrigation zone, China, using the triparental mating exogenous plasmid capture method. Based on its complete sequence the plasmid has a size of 41.5 kb and codes for 50 putative open reading frames (orfs, 28 of which represent genes involved in replication, partitioning and transfer functions of the plasmid. Phylogenetic analysis grouped pSFA231 into the newly defined PromA plasmid family, which currently includes five members. Further comparative genomic analysis shows that pSFA231 shares the common backbone regions with the other PromA plasmids, i.e., genes involved in replication, maintenance and control, and conjugative transfer. Nevertheless, phylogenetic divergence was found in specific gene products. We propose to divide the PromA group into two subgroups, PromA-α (pMRAD02, pSB102 and PromA-β (pMOL98, pIPO2T, pSFA231, pTer331, based on the splits network analysis of the RepA protein. Interestingly, a cluster of hypothetical orfs located between parA and traA of pSFA231 shows high similarity with the corresponding regions on pMOL98, pIPO2T and pTer331, suggesting these hypothetical orfs may represent ‘‘essential’’ plasmid backbone genes for the PromA-β subgroup. Alternatively, they may also be accessory genes that were first acquired and then stayed as the plasmid diverged. Our study increases the available collection of complete genome sequences of BHR plasmids, and since pSFA231 is the only characterized PromA plasmid from China, our findings also enhance our understanding of the genetic diversity of this plasmid group in different parts of the world.
De Majumdar, S; Subinya, M; Korward, J; Pettigrew, A; Scherer, D; Xu, H
2017-01-01
Corticosteroids remain the mainstay therapy for uveitis, a major cause of blindness in the working age population. However, a substantial number of patients cannot benefit from the therapy due to steroids resistance or intolerance. Tacrolimus has been used to treat refractory uveitis through systemic administration. The aim of this study was to evaluate the therapeutic potential of 0.03% tacrolimus eyedrop in mouse models of uveitis. 0.03% tacrolimus in perfluorobutylpentane (F4H5) (0.03% Tacrolimus/SFA) was formulated using a previously published protocol. Tacrolimus suspended in PBS (0.03% Tacrolimus/PBS) was used as a control. In addition, 0.1% dexamethasone (0.1% DXM) was used as a standard therapy control. Endotoxin-induced uveitis (EIU) and experimental autoimmune uveoretinitis (EAU) were induced in adult C57BL/6 mice using protocols described previously. Mice were treated with eyedrops three times/day immediately after EIU induction for 48 h or from day 14 to day 25 post-immunization (for EAU). Clinical and histological examinations were conducted at the end of the experiment. Pharmacokinetics study was conducted in mice with and without EIU. At different times after eyedrop treatment, ocular tissues were collected for tacrolimus measurement. The 0.03% Tacrolimus/SFA eyedrop treatment reduced the clinical scores and histological scores of intraocular inflammation in both EIU and EAU to the levels similar to 0.1% DXM eyedrop treatment. The 0.03% Tacrolimus/PBS did not show any suppressive effect in EIU and EAU. Pharmacokinetic studies showed that 15 min after topical administration of 0.03% Tacrolimus/SFA, low levels of tacrolimus were detected in the retina (48 ng/g tissue) and vitreous (2.5 ng/ml) in normal mouse eyes, and the levels were significantly higher in EIU eyes (102 ng/g tissue in the retina and 24 ng/ml in the vitreous). Tacrolimus remained detectable in intraocular tissues of EIU eyes 6 h after topical administration (68 ng/g retinal tissue, 10
Jelinek, Ronald
2018-01-01
While sales force automation (SFA) and customer relationship management are important concepts in business-to-business selling, many instructors struggle to effectively integrate these topics into their curriculum. The research described in this article offers a role play and two coordinating sets of slides that aim to help students better…
Neutron logging reliability techniques and apparatus
International Nuclear Information System (INIS)
Johnstone, C.W.
1978-01-01
This invention relates in general to neutron logging of earth formations, and in particular, to novel apparatus and procedures for determining the validity, or reliability, of data derived at least in part by logging neutron characteristics of earth formations and, if desired, for affording verifiably accurate indications of such data
Neutron logging reliability techniques and apparatus
International Nuclear Information System (INIS)
Johnstone, C.W.
1974-01-01
This invention relates in general to neutron logging of earth formations, and in particular, to novel apparatus and procedures for determining the validity, or reliability, of data derived at least in part by logging neutron characteristics of earth formations and, if desired, for affording verifiably accurate indications of such data. (author)
Torque application technique and apparatus
Pineault, Raymond P.
1993-11-01
A tool which produces a measured torque is coupled to a bolt head or nut, located in a relatively inaccessible area, by apparatus which includes a wrench member affixed to an adaptor. The wrench member is sized and shaped to engage the fastener to be operated upon and the adaptor has a tubular construction with a tool engaging socket at one end. The adaptor is provided with an elongated slot which accommodates any wires which may pass through the fastener.
Sobol, Monika; Raj, Stanisława; Skiba, Grzegorz
2018-05-01
Consumption of a high-fat diet, rich in SFA, causes deterioration of bone properties. Some studies suggest that feeding inulin to animals may increase mineral absorption and positively affect bone quality; however, these studies have been carried out only on rodents fed a standard diet. The primary objective of this study was to determine the effect of inulin on bone health of pigs (using it as an animal model for humans) fed a high-fat diet rich in SFA, having an unbalanced ratio of lysine:metabolisable energy. It was hypothesised that inulin reduces the negative effects of such a diet on bone health. At 50 d of age, twenty-one pigs were randomly allotted to three groups: the control (C) group fed a standard diet, and two experimental (T and TI) groups fed a high-fat diet rich in SFA. Moreover, TI pigs consumed an extra inulin supply (7 % of daily feed intake). After 10 weeks, whole-body bone mineral content (P=0·0054) and bone mineral density (P=0·0322) were higher in pigs of groups TI and C compared with those of group T. Femur bone mineral density was highest in pigs in group C, lower in group TI and lowest in group T (P=0·001). Femurs of pigs in groups TI and C had similar, but higher, maximum strength compared with femurs of pigs in group T (P=0·0082). In conclusion, consumption of a high-fat diet rich in SFA adversely affected bone health, but inulin supplementation in such a diet diminishes this negative effect.
Wroblewski, David [Mentor, OH; Katrompas, Alexander M [Concord, OH; Parikh, Neel J [Richmond Heights, OH
2009-09-01
A method and apparatus for optimizing the operation of a power generating plant using artificial intelligence techniques. One or more decisions D are determined for at least one consecutive time increment, where at least one of the decisions D is associated with a discrete variable for the operation of a power plant device in the power generating plant. In an illustrated embodiment, the power plant device is a soot cleaning device associated with a boiler.
Directory of Open Access Journals (Sweden)
Mohd Azmarul A Aziz
2015-04-01
Full Text Available Introduction Semantic Feature Analysis (SFA is a treatment for lexical retrieval impairment in which participants are cued by providing semantic information regarding concepts they have difficulty with in naming tasks in an effort to facilitate accurate lexical retrieval (Boyle & Coelho, 1995. People with aphasia are commonly found to have naming deficits and speech-language therapists (SLTs face difficulties in providing an effective treatment method to treat this deficit. This study aims to examine the use of SFA to address naming deficits for nouns and verbs in a Malay patient (KM with non-fluent aphasia. Methods The following tests were administered to the subject pre- and post- treatment: 1 Boston Diagnostic Aphasia Examination (BDAE; 2 Malay Object and Action Test (MOAT; and 3 A series of comprehension and production assessments in Malay. Subject was asked to name 101 and 50 pictures from MOAT. The stimuli were coloured photograph pictures. Treatment and probe (untrained stimuli were selected from pictures that a subject could not name, yielding 40 nouns and 30 verbs. From these, 20 stimuli were randomly chosen as probe items and 20 as treatment stimuli (nouns, 15 treatment and 15 probes (verbs. For the treatment study, single subject A-B-A design was implemented. Three baseline sessions were completed prior to treatment initiation naming for both probe and treatment pictures. Subject attended once-weekly therapy sessions over 8 months. Probes assessing generalizations to untrained pictures were presented at 4th, 8th, and 12th and so on until the end of the programme. Results Results showed that KM’s ability to name trained and untrained picture stimuli improved for both nouns and verbs. KM demonstrated steady improvement in the SFA treatment of trained nouns and verbs: from 5% baseline accuracy to over 90% accuracy at treatment end for nouns and from 0% baseline accuracy to 90% accuracy at treatment end for verbs. Generalizations to
Energy Technology Data Exchange (ETDEWEB)
Pua, Uei, E-mail: druei@yahoo.com [Tan Tock Seng Hospital, Department of Diagnostic Radiology (Singapore)
2015-04-15
Endovascular treatment of the superficial femoral artery (SFA) is challenging in the presence of flush ostial occlusion. One of the main challenges is the availability of access sites for intervention. Contralateral retrograde femoral access followed by cross-over and antegrade intervention while commonly used, may not be feasible in cases of altered iliac anatomy (e.g. kissing iliac stents). Ipsilateral antegrade intervention using common femoral artery (CFA) access in these instances while possible is typically challenging due to inadequate working length of the CFA for interrogation of the SFA ostium, compounded by the lack of sheath stability. The “profunda anchor” technique uses a buddy wire in the profunda femoris artery (PFA) to stabilize the sheath and allow catheter manipulation for antegrade intervention at the level of the SFA ostium. The PFA is further used as a conduit for deployment of closure device to avoid interference with the treated SFA.
International Nuclear Information System (INIS)
Pua, Uei
2015-01-01
Endovascular treatment of the superficial femoral artery (SFA) is challenging in the presence of flush ostial occlusion. One of the main challenges is the availability of access sites for intervention. Contralateral retrograde femoral access followed by cross-over and antegrade intervention while commonly used, may not be feasible in cases of altered iliac anatomy (e.g. kissing iliac stents). Ipsilateral antegrade intervention using common femoral artery (CFA) access in these instances while possible is typically challenging due to inadequate working length of the CFA for interrogation of the SFA ostium, compounded by the lack of sheath stability. The “profunda anchor” technique uses a buddy wire in the profunda femoris artery (PFA) to stabilize the sheath and allow catheter manipulation for antegrade intervention at the level of the SFA ostium. The PFA is further used as a conduit for deployment of closure device to avoid interference with the treated SFA
2016-02-16
experience training military advisors suggests that the commander’s exposure to military advising has a direct affect on who is nominated to advise... Advisor : CAPT Patrick J McCormick, USN 16 February 2016 DISTRIBUTION A. Approved for public release: distribution unlimited. 2 DISCLAIMER The...SFA AT) leader / senior advisor . He advised an Iraqi National Police (INP) Port of Entry Director near the Iraq / Syria Border and Afghan
Directory of Open Access Journals (Sweden)
Zahra Sadeghi
2017-09-01
Discussion: While PCA is more effective for participants with phonological impairments, SFA is more effective for participants with semantic impairments. Therefore, a direct relationship between underlying functional deficit and response to specific treatment was established for all participants.
Directory of Open Access Journals (Sweden)
Karthikeyan Damodharan
2016-01-01
Full Text Available Subintimal angioplasty of lower limb arterial occlusion carries a relatively higher risk of vessel perforation compared to transluminal angioplasty. Vessel perforation is a potentially life threatening complication which requires prompt recognition and management. They are usually managed by endovascular techniques such as low-pressure balloon tamponade, covered stents, and coil embolization of the ruptured artery. We describe a technique of treating vessel perforation following balloon angioplasty. Patient developed a large perforation of the proximal superficial femoral artery (SFA after balloon inflation during subintimal angioplasty of complete SFA occlusion. Following failure of balloon tamponade in sealing the perforation, we successfully treated it by deploying an embolization coil at the site of perforation through the vessel wall followed by balloon tamponade. Our technique could be a useful relatively inexpensive alternative treatment option in the management of vessel perforation compared to covered stents.
Energy Technology Data Exchange (ETDEWEB)
Kersting, Annie B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-06-23
A major scientific challenge in environmental sciences is to identify the dominant processes controlling actinide transport in the environment. It is estimated that currently, over 2200 metric tons of anthropogenic plutonium (Pu) has accumulated worldwide, a number that increases yearly with additional spent nuclear fuel (Ewing et al., 2010). Plutonium has been shown to migrate on the scale of kilometers, giving way to a critical concern that the fundamental biogeochemical processes that control its behavior in the subsurface are not well understood (Kersting et al. 1999; Novikov et al. 2006; Santschi et al. 2002). Neptunium (Np) is less prevalent in the environment; however, it is predicted to be a significant long-term dose contributor in high-level nuclear waste. Our focus on Np chemistry in this Science Plan is intended to help formulate a better understanding of Pu redox transformations in the environment and clarify the differences between the two long-lived actinides. The research approach of our Science Plan combines (1) Fundamental Mechanistic Studies that identify and quantify biogeochemical processes that control actinide behavior in solution and on solids, (2) Field Integration Studies that investigate the transport characteristics of Pu and test our conceptual understanding of actinide transport, and (3) Actinide Research Capabilities that allow us to achieve the objectives of this Scientific Focus Area (SFA) and provide new opportunities for advancing actinide environmental chemistry. These three Research Thrusts form the basis of our SFA Science Program.
National Research Council Canada - National Science Library
Moore, John H; Davis, Christopher C; Coplan, Michael A; Greer, Sandra C
2009-01-01
... specification of the components of apparatus, many new to this edition. Data on the properties of materials and components used by manufacturers are included. Mechanical, optical, and electronic construction techniques carried out in the laboratory, as well as those let out to specialized shops, are also described. Step-by-step instruc...
A new crossed molecular beam apparatus using time-sliced ion velocity imaging technique
International Nuclear Information System (INIS)
Wu Guorong; Zhang Weiqing; Pan Huilin; Shuai Quan; Jiang Bo; Dai Dongxu; Yang Xueming
2008-01-01
A new crossed molecular beam apparatus has been constructed for investigating polyatomic chemical reactions using the time-sliced ion velocity map imaging technique. A unique design is adopted for one of the two beam sources and allows us to set up the molecular beam source either horizontally or vertically. This can be conveniently used to produce versatile atomic or radical beams from photodissociation and as well as electric discharge. Intensive H-atom beam source with high speed ratio was produced by photodissociation of the HI molecule and was reacted with the CD 4 molecule. Vibrational-state resolved HD product distribution was measured by detecting the CD 3 product. Preliminary results were also reported on the F+SiH 4 reaction using the discharged F atom beam. These results demonstrate that this new instrument is a powerful tool for investigating chemical dynamics of polyatomic reactions.
Apparatus and method for implementing power saving techniques when processing floating point values
Kim, Young Moon; Park, Sang Phill
2017-10-03
An apparatus and method are described for reducing power when reading and writing graphics data. For example, one embodiment of an apparatus comprises: a graphics processor unit (GPU) to process graphics data including floating point data; a set of registers, at least one of the registers of the set partitioned to store the floating point data; and encode/decode logic to reduce a number of binary 1 values being read from the at least one register by causing a specified set of bit positions within the floating point data to be read out as 0s rather than 1s.
Analysis apparatus and method of analysis
International Nuclear Information System (INIS)
1976-01-01
A continuous streaming method developed for the excution of immunoassays is described in this patent. In addition, a suitable apparatus for the method was developed whereby magnetic particles are automatically employed for the consecutive analysis of a series of liquid samples via the RIA technique
Electro-Optical Sensing Apparatus and Method for Characterizing Free-Space Electromagnetic Radiation
Zhang, Xi-Cheng; Libelo, Louis Francis; Wu, Qi
1999-09-14
Apparatus and methods for characterizing free-space electromagnetic energy, and in particular, apparatus/method suitable for real-time two-dimensional far-infrared imaging applications are presented. The sensing technique is based on a non-linear coupling between a low-frequency electric field and a laser beam in an electro-optic crystal. In addition to a practical counter-propagating sensing technique, a co-linear approach is described which provides longer radiated field--optical beam interaction length, thereby making imaging applications practical.
The ALPHA antihydrogen trapping apparatus
Energy Technology Data Exchange (ETDEWEB)
Amole, C. [Department of Physics and Astronomy, York University, Toronto ON Canada, M3J 1P3 (Canada); Andresen, G.B. [Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Ashkezari, M.D. [Department of Physics, Simon Fraser University, Burnaby, BC Canada, V5A 1S6 (Canada); Baquero-Ruiz, M. [Department of Physics, University of California at Berkeley, Berkeley, CA 94720-7300 (United States); Bertsche, W. [Department of Physics, College of Science, Swansea University, Swansea SA2 8PP (United Kingdom); School of Physics and Astronomy, University of Manchester, Manchester M13 9PL (United Kingdom); The Cockcroft Institute, Warrington WA4 4AD (United Kingdom); Bowe, P.D. [Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Butler, E. [Physics Department, CERN, CH-1211 Geneva 23 (Switzerland); Capra, A. [Department of Physics and Astronomy, York University, Toronto ON Canada, M3J 1P3 (Canada); Carpenter, P.T. [Department of Physics, Auburn University, Auburn, AL 36849-5311 (United States); Cesar, C.L. [Instituto de Física, Universidade Federal do Rio de Janeiro, Rio de Janeiro 21941-972 (Brazil); Chapman, S. [Department of Physics, University of California at Berkeley, Berkeley, CA 94720-7300 (United States); Charlton, M.; Deller, A.; Eriksson, S. [Department of Physics, College of Science, Swansea University, Swansea SA2 8PP (United Kingdom); Escallier, J. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Fajans, J. [Department of Physics, University of California at Berkeley, Berkeley, CA 94720-7300 (United States); Friesen, T. [Department of Physics and Astronomy, University of Calgary, Calgary AB, Canada, T2N 1N4 (Canada); Fujiwara, M.C.; Gill, D.R. [TRIUMF, 4004 Wesbrook Mall, Vancouver BC, Canada V6T 2A3 (Canada); Gutierrez, A. [Department of Physics and Astronomy, University of British Columbia, Vancouver BC, Canada V6T 1Z4 (Canada); and others
2014-01-21
The ALPHA collaboration, based at CERN, has recently succeeded in confining cold antihydrogen atoms in a magnetic minimum neutral atom trap and has performed the first study of a resonant transition of the anti-atoms. The ALPHA apparatus will be described herein, with emphasis on the structural aspects, diagnostic methods and techniques that have enabled antihydrogen trapping and experimentation to be achieved.
Semiconductor apparatus and method of fabrication for a semiconductor apparatus
2010-01-01
The invention relates to a semiconductor apparatus (1) and a method of fabrication for a semiconductor apparatus (1), wherein the semiconductor apparatus (1) comprises a semiconductor layer (2) and a passivation layer (3), arranged on a surface of the semiconductor layer (2), for passivating the
Construction apparatus for thermochemical hydrogen production process
Energy Technology Data Exchange (ETDEWEB)
Kubo, S.; Nakajima, H.; Higashi, S.; Onuki, K.; Akino, S.S.N. [Japan Atomic Energy Research Inst., Ibaraki-ken (Japan). Nuclear Heat Utilization Engineering Lab
2001-06-01
Studies have been carried out at the Japan Atomic Energy Research Institute (JAERI) on hydrogen production through thermochemical processes such as water-splitting. These studies are classified with iodine-sulphur cycle studies using heat from high temperature gas-cooled reactors. An experimental apparatus was constructed with fluorine resin, glass and quartz. It can produce hydrogen at a rate of 50 litres per hour. Electricity provides the heat required for the operation. The closed chemical process requires special control techniques. The process flow diagram for the apparatus was designed based on the results of previous studies including one where hydrogen production was successfully achieved at a rate of one liter per hour for 48 hours. Experimental operations under atmospheric pressure will be carried out for the next four years to develop the process. The data will be used in the next research and development programs aimed at designing a bench-scale apparatus. 7 refs., 1 tab., 8 figs.
International Nuclear Information System (INIS)
Langenberger, Herbert; Schillinger, Martin; Plank, Christina; Sabeti, Schila; Dick, Petra; Cejna, Manfred; Lammer, Johannes; Minar, Erich; Loewe, Christian
2012-01-01
Background: Multidetector CT angiography (CTA) is a non-invasive imaging technique for evaluation of peripheral vascular disease. CTA might be particularly useful for assessment of intermediate- and long-term morphological outcome after endovascular treatment. Validation of CTA vs. the current imaging standard, colour Doppler ultrasonography (CDUS), for quantification of native and in-stent re-stenosis in the superficial femoral artery (SFA) is required. Methods: Seventy randomized patients who underwent stent implantation (n = 47) or balloon angioplasty (n = 23) underwent 6-month follow-up with CDUS and CTA. CTA was compared with CDUS in both sub-groups of patients in terms of binary re-stenosis (>50% lumen narrowing) and re-occlusion. Agreement between CTA and CDUS was assessed using Kappa (κ) statistics with 95% confidence intervals, and correlation coefficients. Results: Binary re-stenosis was detected in 16/70 (22.9%) patients by CTA and 17/70 (24.3%) patients by CDUS (κ = 0.88, 95% CI: 0.80–0.96). Re-stenosis rates after balloon angioplasty were 39.1% (9/23) on CTA and CDUS (κ = 0.82, 95% CI: 0.66–0.98), and after stent implantation 14.9% (7/47) on CTA and 17.0% (8/47) on CDUS (κ = 0.92, 95% CI: 0.84–1.00). Re-occlusions were detected in 3/70 (4.3%) patients by both CTA and CDUS (κ = 0.65; 95% CI 0.54–0.76). Significant correlations (r = 0.85, p < 0.001) were noted between degree of re-stenosis on CTA and peak velocity ratio on CDUS. The correlation coefficient was higher in patients after balloon angioplasty (r = 0.94, p < 0.001) than in patients after stent implantation (r = 0.71, p < 0.001). Conclusion: CTA and CDUS show excellent agreement for evaluation of native and in-stent re-stenosis after endovascular treatment of SFA obstructions. CTA is an appropriate non-invasive imaging modality for follow-up after endovascular therapy
Directory of Open Access Journals (Sweden)
Ir Ascarya
2014-03-01
Full Text Available This study will measure and compare the efficiency of Conventional and Islamic banks in Indonesia using parametric approach stochastic frontier approach (SFA and distribution free approach (DFA. These measurements will provide comprehensive and robust results of efficiency of individual bank compare to its peer group. The results using parametric SFA show that in 2002, conventional banks (0.79 were slightly more efficient than Islamic banks (0.77, while in 2003, the efficiency of Islamic banks improved to 0.84 and the efficiency of conventional banks worsen to 0.76, so that Islamic banks have become more efficient than conventional banks. Conventional and Islamic banks have been improving and converged to the highest level of efficiency (1.00 since 2004. The DFA results show that conventional banks (0.89 are only slightly more efficient than Islamic banks (0.87. Conventional public bank (0.93 is the most efficient, while Islamic regional bank (0.84 is the least efficient. Moreover, efficient banks (conventional and Islamic do not always have lower OCOI (operating costs divided by operating income, while banks with better OCOI usually are more profitable (have better return on assets or ROA. Therefore, technically, Islamic banks have shown their readiness to compete head to head with their conventional counterparts. However, other aspects, such as, number of networks and branches, service quality, convenience, products and services provided, human resources, and pricing, should have become the next priorities for improvements.JEL Classification : C10, C33, G21, G28Keywords : Islamic Banking, Efficiency, Stochastic Frontier Approach, Distribution Free Approach
DEFF Research Database (Denmark)
2017-01-01
The present invention relates to the field of filtering, more precisely the present invention concerns an apparatus and a method for the separation of dry matter from a medium and the use of said apparatus. One embodiment discloses an apparatus for the separation of dry matter and liquid from a m...
Multipactor discharge apparatus
International Nuclear Information System (INIS)
1976-01-01
The invention deals with a multipactor discharge apparatus which can be used for tuning microwave organs such as magnetron oscillators and other cavity resonators. This apparatus is suitable for delivering an improved tuning effect in a resonation organ wherefrom the working frequency must be set. This apparatus is equipped with two multipactor discharge electrodes set in a configuration such to that a net current flows from one electrode to another. These electrodes are parallel and flat. The apparatus can be used in magnetron devices as well for continuous waves as for impulses
International Nuclear Information System (INIS)
Span, F.J.
1988-01-01
The patent concerns a gamma tomography apparatus for medical diagnosis. The apparatus comprises a gamma scintillation camera head and a suspension system for supporting and positioning the camera head with respect for the patient. Both total body scanning and single photon emission tomography can be carried out with the apparatus. (U.K.)
An automatic refolding apparatus for preparative-scale protein production.
Directory of Open Access Journals (Sweden)
Yanye Feng
Full Text Available Protein refolding is an important process to recover active recombinant proteins from inclusion bodies. Refolding by simple dilution, dialysis and on-column refolding methods are the most common techniques reported in the literature. However, the refolding process is time-consuming and laborious due to the variability of the behavior of each protein and requires a great deal of trial-and-error to achieve success. Hence, there is a need for automation to make the whole process as convenient as possible. In this study, we invented an automatic apparatus that integrated three refolding techniques: varying dilution, dialysis and on-column refolding. We demonstrated the effectiveness of this technology by varying the flow rates of the dilution buffer into the denatured protein and testing different refolding methods. We carried out different refolding methods on this apparatus: a combination of dilution and dialysis for human stromal cell-derived factor 1 (SDF-1/CXCL12 and thioredoxin fused-human artemin protein (Trx-ARTN; dilution refolding for thioredoxin fused-human insulin-like growth factor I protein (Trx-IGF1 and enhanced fluorescent protein (EGFP; and on-column refolding for bovine serum albumin (BSA. The protein refolding processes of these five proteins were preliminarily optimized using the slowly descending denaturants (or additives method. Using this strategy of decreasing denaturants concentration, the efficiency of protein refolding was found to produce higher quantities of native protein. The standard refolding apparatus configuration can support different operations for different applications; it is not limited to simple dilution, dialysis and on-column refolding techniques. Refolding by slowly decreasing denaturants concentration, followed by concentration or purification on-column, may be a useful strategy for rapid and efficient recovery of active proteins from inclusion bodies. An automatic refolding apparatus employing this
An extraordinary tabletop speed of light apparatus
Pegna, Guido
2017-09-01
A compact, low-cost, pre-aligned apparatus of the modulation type is described. The apparatus allows accurate determination of the speed of light in free propagation with an accuracy on the order of one part in 104. Due to the 433.92 MHz radio frequency (rf) modulation of its laser diode, determination of the speed of light is possible within a sub-meter measuring base and in small volumes (some cm3) of transparent solids or liquids. No oscilloscope is necessary, while the required function generators, power supplies, and optical components are incorporated into the design of the apparatus and its receiver can slide along the optical bench while maintaining alignment with the laser beam. Measurement of the velocity factor of coaxial cables is also easily performed. The apparatus detects the phase difference between the rf modulation of the laser diode by further modulating the rf signal with an audio frequency signal; the phase difference between these signals is then observed as the loudness of the audio signal. In this way, the positions at which the minima of the audio signal are found determine where the rf signals are completely out of phase. This phase detection method yields a much increased sensitivity with respect to the display of coincidence of two signals of questionable arrival time and somewhat distorted shape on an oscilloscope. The displaying technique is also particularly suitable for large audiences as well as in unattended exhibits in museums and science centers. In addition, the apparatus can be set up in less than one minute.
International Nuclear Information System (INIS)
Gonczy, J.D.; Boroski, W.N.; Niemann, R.C.; Otavka, J.G.; Ruschman, M.K.; Schoo, C.J.
1989-09-01
The multilayer insulation (MLI) system for the Superconducting Super Collider (SSC) consists of full cryostat length assemblies of aluminized polyester film fabricated in the form of blankets and installed as blankets to the 4.5K cold mass and the 20K and 80K thermal radiation shields. Approximately 40,000 MLI blankets will be required in the 10,000 cryogenic devices comprising the SSC accelerator. Each blanket is nearly 17 meters long and 1.8 meters wide. This paper reports the blanket design, an apparatus, and the fabrication method used to mass produce pre-fabricated MLI blankets. Incorporated in the blanket design are techniques which automate quality control during installation of the MLI blankets in the SSC cryostat. The apparatus and blanket fabrication method insure consistency in the mass produced blankets by providing positive control of the dimensional parameters which contribute to the thermal performance of the MLI blanket. By virtue of the fabrication process, the MLI blankets have inherent features of dimensional stability three-dimensional uniformity, controlled layer density, layer-to-layer registration, interlayer cleanliness, and interlayer material to accommodate thermal contraction differences. 11 refs., 6 figs., 1 tab
Method and apparatus for controlling LCL converters using asymmetric voltage cancellation techniques
Wu, Hunter; Sealy, Kylee Devro; Sharp, Bryan Thomas; Gilchrist, Aaron
2016-01-26
A method and apparatus for LCL resonant converter control utilizing Asymmetric Voltage Cancellation is described. The methods to determine the optimal trajectory of the control variables are discussed. Practical implementations of sensing load parameters are included. Simple PI, PID and fuzzy logic controllers are included with AVC for achieving good transient response characteristics with output current regulation.
Math, Souvik; Horn, Roger; Jayaram, Vikram; Biswas, Sanjay Kumar
2007-04-15
Currently data obtained from surface force apparatus experiments are convoluted with the mechanical response of glue of unknown thickness, used to bond mica sheets to the substrates. This paper describes a formulation to precisely deconvolute out the forces between the mica sheets by determining the thickness of glue, knowing the mechanical properties of the glue. The formulation consists of a general solution based on the noniterative Hankel transform of the Laplace equation. The generality is achieved by treating all the layers except the one in contact as an effective lumped system consisting of a set of springs in series, where each spring represents a layer. The solution is validated by nanoindentation of trilayer systems consisting of layers with widely diverse mechanical properties, some differing from each other by three orders of magnitude. SFA experiments are done with carefully metered slabs of glue. The proposed method is validated by comparing the actual glue thicknesses with those determined using the present analysis.
Ruiz-Roso, B; Cuesta, I; Varela-Moreiras, G; Carmena, R; Pérez-Olleros, L
2000-07-01
The diet usually consumed by a community of 18 normolipemic monks was studied. It included olive oil as cooking fat (basal period BP). This diet was modified by substituting olive oil for sunflower oil during a 21-day period (experimental period EP). The precise individual weighing technique was utilised for the determination of intake, and by means of the food composition tables (FCTs) the energy and nutrient of the diet were calculated. By chemical analysis of the duplicate sample (CA) of the cooked dishes the lipid intake was also determined. Total serum cholesterol HDL and LDL cholesterol, serum triglycerides, AI and B-100 apolipoproteins and Lp(a) were also analysed. Similarly the absolute and relative values for SFA, MUFA and PUFA obtained by both techniques were also different and these were maintained when the (PUFA + MUFA)/SFA ratio was calculated by both techniques and in the two periods. The correction of the lipid intake by means of the CA technique did not improve either the correlation between the intake or the plasma lipid concentration or the cholesterolemia prediction (r = 0.83 for FCT and CA).
Improved cold neutron radiographic apparatus and method
International Nuclear Information System (INIS)
1981-01-01
An improved cold neutron radiography technique is described in which the neutron temperature is matched to the specific material to be analyzed. In addition to a beam source and detector the apparatus incorporates a cryogenic refrigerator which enables the moderator material to be cooled to a predetermined adjustable temperature below the Bragg edge temperature of the sample. (U.K.)
Electroless plating apparatus for discrete microsized particles
International Nuclear Information System (INIS)
Mayer, A.
1978-01-01
Method and apparatus are disclosed for producing very uniform coatings of a desired material on discrete microsized particles by electroless techniques. Agglomeration or bridging of the particles during the deposition process is prevented by imparting a sufficiently random motion to the particles that they are not in contact with each other for a time sufficient for such to occur
Borehole sealing method and apparatus
International Nuclear Information System (INIS)
Hartley, J.N.; Jansen, G. Jr.
1977-01-01
A method and apparatus is described for sealing boreholes in the earth. The borehole is blocked at the sealing level, and a sealing apparatus capable of melting rock and earth is positioned in the borehole just above seal level. The apparatus is heated to rock-melting temperature and powdered rock or other sealing material is transported down the borehole to the apparatus where it is melted, pooling on the mechanical block and allowed to cool and solidify, sealing the hole. Any length of the borehole can be sealed by slowly raising the apparatus in the borehole while continuously supplying powdered rock to the apparatus to be melted and added to the top of the column of molten and cooling rock, forming a continuous borehole seal. The sealing apparatus consists of a heater capable of melting rock, including means for supplying power to the heater, means for transporting powdered rock down the borehole to the heater, means for cooling the apparatus and means for positioning the apparatus in the borehole. 5 claims, 1 figure
Apparatus for drying sugar cubes
Derckx, H.A.J.; Torringa, H.M.
1999-01-01
Device for drying sugar cubes containing a heating apparatus for heating and dehumidifying the sugar cubes, a conditioning apparatus for cooling off and possibly further dehumidifying the sugar cubes and a conveying apparatus for conveying the sugar cubes through the heating apparatus and the
Zhao, Gutian; Cai, Di; Wu, Gensheng; Tan, Qiyan; Xiang, Li; Zhang, Yin; Xiang, Nan
2014-11-01
A novel approach for studying the adsorption and evaporation processes of molecularly thin methanol film by the modified surface forces apparatus (M-SFA) is reported. This method can be used precisely to measure the thickness, morphology, and mechanical properties of the film confined between two mica surfaces in a real-time manner at gas atmosphere. By observing the adsorption and evaporation processes of the methanol molecule, it is found that the first adsorbed layer of the methanol film on the mica surface behaves as a solid-like structure. The thickness of this layer is measured to be about 3.2 Å, approximately equal to the diameter of a methanol molecule. Besides, this first adsorbed layer can carry normalized loads of more than 5.6 atm due to the carrying capacity conserved by the bond of mica-OH. The outer layers of the methanol film are further adsorbed with the increase of the exposure time, which are liquid-like and can be easily eliminated out from the substrate. The present study suggests that the interacting mode between hydroxy and mica is of great potential in material science and biomedical systems. © 2014 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Monteith, W.D.
1983-01-01
Training apparatus for use in contamination surveillance uses a mathematical model of a hypothetical contamination source (e.g. nuclear, bacteriological or chemical explosion or leak) to determine from input data defining the contamination source, the contamination level at any location within a defined exercise area. The contamination level to be displayed by the apparatus is corrected to real time from a real time clock or may be displayed in response to a time input from a keyboard. In a preferred embodiment the location is defined by entering UTM grid reference coordinates using the keyboard. The mathematical model used by a microprocessor of the apparatus for simulation of contamination levels in the event of a nuclear explosion is described. (author)
Energy Technology Data Exchange (ETDEWEB)
Slattery, Michael M.; Goh, Gerard S.; Power, Sarah; Given, Mark F.; McGrath, Frank P.; Lee, Michael J., E-mail: mlee@rcsi.ie [Beaumont Hospital, Department of Radiology (Ireland)
2015-06-15
PurposeTo prospectively compare the procedural time and complication rates of ultrasound-guided and fluoroscopy-assisted antegrade common femoral artery (CFA) puncture techniques.Materials and MethodsHundred consecutive patients, undergoing a vascular procedure for which an antegrade approach was deemed necessary/desirable, were randomly assigned to undergo either ultrasound-guided or fluoroscopy-assisted CFA puncture. Time taken from administration of local anaesthetic to vascular sheath insertion in the superficial femoral artery (SFA), patients’ age, body mass index (BMI), fluoroscopy radiation dose, haemostasis method and immediate complications were recorded. Mean and median values were calculated and statistically analysed with unpaired t tests.ResultsSixty-nine male and 31 female patients underwent antegrade puncture (mean age 66.7 years). The mean BMI was 25.7 for the ultrasound-guided (n = 53) and 25.3 for the fluoroscopy-assisted (n = 47) groups. The mean time taken for the ultrasound-guided puncture was 7 min 46 s and for the fluoroscopy-assisted technique was 9 min 41 s (p = 0.021). Mean fluoroscopy dose area product in the fluoroscopy group was 199 cGy cm{sup 2}. Complications included two groin haematomas in the ultrasound-guided group and two retroperitoneal haematomas and one direct SFA puncture in the fluoroscopy-assisted group.ConclusionUltrasound-guided technique is faster and safer for antegrade CFA puncture when compared to the fluoroscopic-assisted technique alone.
Pore roller filtration apparatus
DEFF Research Database (Denmark)
2014-01-01
The present invention relates to the field of filtering, more precisely the present invention concerns an apparatus and a method for the separation of dry matter from a medium and the use of said apparatus. One embodiment discloses an apparatus for the separation of dry matter from a medium, comp...
Zhang, Xi-Cheng; Riordan, Jenifer Ann; Sun, Feng-Guo
2000-08-29
Apparatus and methods for characterizing free-space electromagnetic energy, and in particular, apparatus/method suitable for real-time two-dimensional far-infrared imaging applications are presented. The sensing technique is based on a non-linear coupling between a low-frequency electric (or magnetic) field and a laser beam in an electro-optic (or magnetic-optic) crystal. In addition to a practical counter-propagating sensing technique, a co-linear approach is described which provides longer radiated field-optical beam interaction length, thereby making imaging applications practical.
Microelectromechanical acceleration-sensing apparatus
Lee, Robb M [Albuquerque, NM; Shul, Randy J [Albuquerque, NM; Polosky, Marc A [Albuquerque, NM; Hoke, Darren A [Albuquerque, NM; Vernon, George E [Rio Rancho, NM
2006-12-12
An acceleration-sensing apparatus is disclosed which includes a moveable shuttle (i.e. a suspended mass) and a latch for capturing and holding the shuttle when an acceleration event is sensed above a predetermined threshold level. The acceleration-sensing apparatus provides a switch closure upon sensing the acceleration event and remains latched in place thereafter. Examples of the acceleration-sensing apparatus are provided which are responsive to an acceleration component in a single direction (i.e. a single-sided device) or to two oppositely-directed acceleration components (i.e. a dual-sided device). A two-stage acceleration-sensing apparatus is also disclosed which can sense two acceleration events separated in time. The acceleration-sensing apparatus of the present invention has applications, for example, in an automotive airbag deployment system.
Apparatus for gamma ray radiography
International Nuclear Information System (INIS)
Kobayashi, Masatoshi; Enomoto, Shigemasa; Oga, Hiroshi
1979-01-01
This is the standard of Japan Non-Destructive Inspection Society, NDIS 1101-79, which stipulates on the design, construction and testing method of the apparatuses for gamma ray radiography used for taking industrial radiograms. The gamma ray apparatuses stipulated in this standard are those containing sealed radioactive isotopes exceeding 100 μCi, which emit gamma ray. The gamma ray apparatuses are classified into three groups according to their movability. The general design conditions, the irradiation dose rate and the sealed radiation sources for the gamma ray apparatuses are stipulated. The construction of the gamma ray apparatuses must be in accordance with the notification No. 52 of the Ministry of Labor, and safety devices and collimators must be equipped. The main bodies of the gamma ray apparatuses must pass the vibration test, penetration test, impact test and shielding efficiency test. The method of each test is described. The attached equipments must be also tested. The tests according to this standard are carried out by the makers of the apparatuses. The test records must be made when the apparatuses have passed the tests, and the test certificates are attached. The limit of guarantee by the endurance test must be clearly shown. The items to be shown on the apparatuses are stipulated. (Kako, I.)
International Nuclear Information System (INIS)
Moir, R.W.
1981-01-01
A mirror plasma apparatus which utilizes shielding by arc discharge to form a blanket plasma and lithium walls to reduce neutron damage to the wall of the apparatus. An embodiment involves a rotating liquid lithium blanket for a tandem mirror plasma apparatus wherein the first wall of the central mirror cell is made of liquid lithium which is spun with angular velocity great enough to keep the liquid lithium against the first material wall, a blanket plasma preventing the lithium vapor from contaminating the plasma
Water intake fish diversion apparatus
International Nuclear Information System (INIS)
Taft, E.P. III; Cook, T.C.
1995-01-01
A fish diversion apparatus uses a plane screen to divert fish for variety of types of water intakes in order to protect fish from injury and death. The apparatus permits selection of a relatively small screen angle, for example ten degrees, to minimize fish injury. The apparatus permits selection of a high water velocity, for example ten feet per second, to maximize power generation efficiency. The apparatus is especially suitable retrofit to existing water intakes. The apparatus is modular to allow use plural modules in parallel to adjust for water flow conditions. The apparatus has a floor, two opposite side walls, and a roof which define a water flow passage and a plane screen within the passage. The screen is oriented to divert fish into a fish bypass which carries fish to a safe discharge location. The dimensions of the floor, walls, and roof are selected to define the dimensions of the passage and to permit selection of the screen angle. The floor is bi-level with a level upstream of the screen and a level beneath screen selected to provide a uniform flow distribution through the screen. The apparatus may include separation walls to provide a water flow channel between the apparatus and the water intake. Lead walls may be used to adjust water flow conditions into the apparatus. The apparatus features stoplog guides near its upstream and downstream ends to permit the water flow passage to be dewatered. 3 figs
Maeda, S; Kobayashi, H; Ueno, K
1973-07-01
An improved apparatus has been constructed for zone-melting chromatography. An essential feature of the apparatus is that the length of the molten zone can be kept constant during a zone-melting operation, by employing heating and cooling compartments which are separated from each other by double partition plates. Each compartment is heated or cooled with jets of hot or cold air. The apparatus is suitable for organic materials melting in the range between 40 degrees and 180 degrees . The distribution of metal ion along the column after zone melting of copper acetylacetonate in 2-methoxynaphthalene was a smooth curve. The plot of the position of maximum concentration, x(max), against the number of zone passes, n, gave a relationship in accordance with theoretical prediction.
Miller, Richard Dean; Thom, Robert Anthony
2017-10-10
A light shielding apparatus for blocking light from reaching an electronic device, the light shielding apparatus including left and right support assemblies, a cross member, and an opaque shroud. The support assemblies each include primary support structure, a mounting element for removably connecting the apparatus to the electronic device, and a support member depending from the primary support structure for retaining the apparatus in an upright orientation. The cross member couples the left and right support assemblies together and spaces them apart according to the size and shape of the electronic device. The shroud may be removably and adjustably connectable to the left and right support assemblies and configured to take a cylindrical dome shape so as to form a central space covered from above. The opaque shroud prevents light from entering the central space and contacting sensitive elements of the electronic device.
Design of neutral particle incident heating apparatus for large scale helical apparatus
Energy Technology Data Exchange (ETDEWEB)
Kaneko, Osamu; Oka, Yoshihide; Osakabe, Masaki; Takeiri, Yasuhiko; Tsumori, Katsuyoshi; Akiyama, Ryuichi; Asano, Eiji; Kawamoto, Toshikazu; Kuroda, Tsutomu [National Inst. for Fusion Science, Nagoya (Japan)
1997-02-01
In the Institute of Nuclear Fusion Science, construction of the large scale helical apparatus has been progressed favorably, and constructions of the heating apparatus as well as of electron resonance apparatus were begun in their orders under predetermined manner since 1994 fiscal year. And, on 1995 fiscal year, construction of neutral particle incident heating apparatus, leading heat apparatus, was begun under 3 years planning. The plasma heating study system adopted the study results developed in this institute through the large scale hydrogen negative ion source and also adopted thereafter development on nuclear fusion study by modifying the original specification set at the beginning of the research plan before 7 years. As a result, system design was changed from initial 125 KeV to 180 KeV in the beam energy and to execute 15 MW incidence using two sets beam lines, to begin its manufacturing. Here is described on its new design with reason of its modifications. (G.K.)
Apparatus for use in radioimmunoassays
International Nuclear Information System (INIS)
Chen, C-H.; Tsay, H-M.; Heyer, R.E.
1979-01-01
Apparatus for solid-phase antibody separation techniques used in radioimmunoassays is described in this invention. It consists of a rectangular prism tray with multiple wells protruding into its interior from one side. Near the base of the tray is an orifice used for creating evacuated condition within the structure. At the base of each well there is an orifice of such size and shape as to retain an aqueous liquid under given pressure conditions but permit the evacuation of this liquid at reduced pressure. The outlet of these orifices is in the shape of an inverted conical frustrum. Each of the wells contains an antibody coated disc of porous cellulose paper surrounded by a plastic support. The porous nature of the cellulose paper ensures contact between the antibody coating and the antigen. The use of antibody coated porous cellulose paper in combination with the vacuum operated apparatus simplifies the manipulative steps whilst still maintaining the sensitivity of the radioimmunoassay. It also obviates the need for aspiration and thus lessens the risk of contamination from one sample to another. (UK)
BETA (Bitter Electromagnet Testing Apparatus)
Bates, Evan M.; Birmingham, William J.; Rivera, William F.; Romero-Talamas, Carlos A.
2017-10-01
The Bitter Electromagnet Testing Apparatus (BETA) is a 1-Tesla (T) prototype of the 10-T Adjustable Long Pulse High-Field Apparatus (ALPHA). These water-cooled resistive magnets use high DC currents to produce strong uniform magnetic fields. Presented here is the successful completion of the BETA project and experimental results validating analytical magnet designing methods developed at the Dusty Plasma Laboratory (DPL). BETA's final design specifications will be highlighted which include electromagnetic, thermal and stress analyses. The magnet core design will be explained which include: Bitter Arcs, helix starters, and clamping annuli. The final version of the magnet's vessel and cooling system are also presented, as well as the electrical system of BETA, which is composed of a unique solid-state breaker circuit. Experimental results presented will show the operation of BETA at 1 T. The results are compared to both analytical design methods and finite element analysis calculations. We also explore the steady state maximums and theoretical limits of BETA's design. The completion of BETA validates the design and manufacturing techniques that will be used in the succeeding magnet, ALPHA.
Gamma apparatuses for radiotherapy
International Nuclear Information System (INIS)
Sul'kin, A.G.
1986-01-01
Scientific and technical achievements in development and application of gamma therapeutic apparatuses for external and intracavity irradiations are generalized. Radiation-physical parameters of apparatuses providing usability of progressive methods in radiotherapy of onclogical patients are given. Optimization of main apparatus elements, ensurance of its operation reliability, reduction of errors of irradiation plan reproduction are considered. Attention is paid to radiation safety
Instability of confined water films between elastic surfaces
de Beer, Sissi; 't Mannetje, Dieter; Zantema, Sietske; Mugele, Friedrich
2010-01-01
We investigated the dynamics of nanometer thin water films at controlled ambient humidity adsorbed onto two atomically smooth mica sheets upon rapidly bringing the surfaces into contact. Using a surface forces apparatus (SFA) in imaging mode, we found that the water films break up into a
Waste Water Treatment Apparatus and Methods
Littman, Howard (Inventor); Plawsky, Joel L. (Inventor); Paccione, John D. (Inventor)
2014-01-01
An improved draft tube spout fluid bed (DTSFB) mixing, handling, conveying, and treating apparatus and systems, and methods for operating are provided. The apparatus and systems can accept particulate material and pneumatically or hydraulically conveying the material to mix and/or treat the material. In addition to conveying apparatus, a collection and separation apparatus adapted to receive the conveyed particulate material is also provided. The collection apparatus may include an impaction plate against which the conveyed material is directed to improve mixing and/or treatment. The improved apparatus are characterized by means of controlling the operation of the pneumatic or hydraulic transfer to enhance the mixing and/or reacting by controlling the flow of fluids, for example, air, into and out of the apparatus. The disclosed apparatus may be used to mix particulate material, for example, mortar; react fluids with particulate material; coat particulate material, or simply convey particulate material.
Construction of shallow land simulation apparatuses
International Nuclear Information System (INIS)
Yamamoto, Tadatoshi; Ohtsuka, Yoshiro; Takebe, Shinichi; Ohnuki, Toshihiko; Ogawa, Hiromichi; Harada, Yoshikane; Saitoh, Kazuaki; Wadachi, Yoshiki
1984-07-01
Shallow land simulation apparatuses in which natural soil can be used as testing soil have been constructed to investigate the migration characteristics of radionuclides in a disposal site. These apparatuses consist of aerated zone apparatus and aquifer zone one. In the aerated zone apparatus, aerated soil upon ground water level is contained in the soil column (d: 30cm x h: 120cm). In the aquifer zone apparatus, aquifer soil laying ground water level is contained in the soil vessel (b: 90cm x l: 270cm x h: 45cm). This report describes the outline of shallow land simulation apparatuses : function of apparatuses and specification of devices, analysis of obstructions, safety rules, analysis of accidents and operation manual. (author)
Castro-González, María Isabel; Carrillo-Domínguez, Silvia
2015-09-01
the regular consumption of fish brings benefits to health due to its content of n-3 fatty acids, but cooking enhances or damages the concentration of fatty acids (FA) since they are susceptible to oxidation by temperatures and cooking times. to analyze the effect of six cooking techniques on total lipids (TL) and (FA) content in marlin and hake and select which one helps the best conservation of health beneficial FA. fillets were subjected to different cooking techniques: steam (ST), foiled-aluminum-paper (FAP), foiled- banana-leaf (FBL), gas-oven (GO), microwave-oven (MO) and fried-lightly (FL). FA were identified by gas chromatography/FID. Marlin: FL increased the concentration of TL and MO decreased it. Statistically, PUFA, SFA and EPA + DHA increased with FAP, MUFA decreased with FBL and increased in FL. Hake: FL increased concentration in all groups of FA while ST decreased it. SFA values and index of atherogenicity (IA), thrombogenicity (IT), peroxidisability and hipocolesterolemic/ hipercolesterolemic fatty acid ratio (HH) found, suggested that hake is a fish with greater health benefits, regardless of the technique you employ. By its EPA + DHA content, marlin seems to be an excellent choice if cooked FAP. FL technique in both species decreased the IA, IT and significantly increased the HH; however n3/n6 ratio decreased. ST seems to be the least desirable cooking technique for both species. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Federal Laboratory Consortium — This test apparatus, when combined with the National Full-Scale Aerodynamics Complex, produces a thorough, full-scale test capability. The Large Rotor Test Apparatus...
Nachbar, Henry D.; Korytkowski, Alfred S.
1991-01-01
A grinding apparatus for grinding the interior portion of a valve stem receiving area of a valve. The apparatus comprises a faceplate, a plurality of cams mounted to an interior face of the faceplate, a locking bolt to lock the faceplate at a predetermined position on the valve, a movable grinder and a guide tube for positioning an optical viewer proximate the area to be grinded. The apparatus can either be rotated about the valve for grinding an area of the inner diameter of a valve stem receiving area or locked at a predetermined position to grind a specific point in the receiving area.
International Nuclear Information System (INIS)
Wrigglesworth, K.J.; Knowles, J.F.
1987-01-01
The patent concerns a pipework inspection apparatus, which is capable of negotiating bends in pipework. The apparatus comprises a TV camera system, which contains an optical section and an electronics section, which are connected by a flexible coupling. The system can be pulled or pushed along the bore of the pipework. (U.K.)
Apparatus and method for pulsed laser deposition of materials on wires and pipes
Fernandez, Felix E.
2003-01-01
Methods and apparatuses are disclosed which allow uniform coatings to be applied by pulsed laser deposition (PLD) on inner and outer surfaces of cylindrical objects, such as rods, pipes, tubes, and wires. The use of PLD makes this technique particularly suitable for complex multicomponent materials, such as superconducting ceramics. Rigid objects of any length, i.e., pipes up to a few meters, and with diameters from less than 1 centimeter to over 10 centimeters can be coated using this technique. Further, deposition is effected simultaneously onto an annular region of the pipe wall. This particular arrangement simplifies the apparatus, reduces film uniformity control difficulties, and can result in faster operation cycles. In addition, flexible wires of any length can be continuously coated using the disclosed invention.
Zhu, Yanwei; Yi, Fajun; Meng, Songhe; Zhuo, Lijun; Pan, Weizhen
2017-11-01
Improving the surface heat load measurement technique for vehicles in aerodynamic heating environments is imperative, regarding aspects of both the apparatus design and identification efficiency. A simple novel apparatus is designed for heat load identification, taking into account the lessons learned from several aerodynamic heating measurement devices. An inverse finite difference scheme (invFDM) for the apparatus is studied to identify its surface heat flux from the interior temperature measurements with high efficiency. A weighted piecewise regression filter is also proposed for temperature measurement prefiltering. Preliminary verification of the invFDM scheme and the filter is accomplished via numerical simulation experiments. Three specific pieces of apparatus have been concretely designed and fabricated using different sensing materials. The aerodynamic heating process is simulated by an inductively coupled plasma wind tunnel facility. The identification of surface temperature and heat flux from the temperature measurements is performed by invFDM. The results validate the high efficiency, reliability and feasibility of heat load measurements with different heat flux levels utilizing the designed apparatus and proposed method.
International Nuclear Information System (INIS)
Zhu, Yanwei; Yi, Fajun; Meng, Songhe; Zhuo, Lijun; Pan, Weizhen
2017-01-01
Improving the surface heat load measurement technique for vehicles in aerodynamic heating environments is imperative, regarding aspects of both the apparatus design and identification efficiency. A simple novel apparatus is designed for heat load identification, taking into account the lessons learned from several aerodynamic heating measurement devices. An inverse finite difference scheme (invFDM) for the apparatus is studied to identify its surface heat flux from the interior temperature measurements with high efficiency. A weighted piecewise regression filter is also proposed for temperature measurement prefiltering. Preliminary verification of the invFDM scheme and the filter is accomplished via numerical simulation experiments. Three specific pieces of apparatus have been concretely designed and fabricated using different sensing materials. The aerodynamic heating process is simulated by an inductively coupled plasma wind tunnel facility. The identification of surface temperature and heat flux from the temperature measurements is performed by invFDM. The results validate the high efficiency, reliability and feasibility of heat load measurements with different heat flux levels utilizing the designed apparatus and proposed method. (paper)
Tartari, Flamur; Buzo, Stiliano; Vyshka, Gentian
2009-01-01
The apparatus invented by Dr. Luigj Benusi in 1943, in Tirana, was a practical application of the Kowarsky technique and Ambard laws, helping in determining blood urea levels and very important to a variety of diseases, mainly kidney disorders. The apparatus was invented and prepared from very simple laboratory materials, such as glasses, test tubes, corks and volumetric cylinders. Technologically, it was based upon the determination of blood urea through hypobromite, and, among the advantages of the apparatus of Benusi, were its extreme simplicity, the smaller amount of blood needed for producing results (2 milliliters), as well as an easiest way to clean up and to manage the apparatus from a practical point of everyday use.
International Nuclear Information System (INIS)
1981-01-01
Apparatus for performing a quantitative radioimmunoassay comprising: a substantially spherical bead for carrying an antibody and a gripper for gripping said bead, said gripper comprising an integrally formed unit having a single elongate handle portion and a plurality of resilient fingers arranged at the base of the handle so that when said bead is secured within said fingers, said bead may be freely rotated about any diametric axis of the bead. In particular the invention relates to an apparatus for a two site immunoradiometric assay for serum ferritin in human blood samples. (author)
Wolfgang, F.; Nicol, J.
1962-11-01
Transformer apparatus is designed for measuring the amount of a paramagnetic substance dissolved or suspended in a diamagnetic liquid. The apparatus consists of a cluster of tubes, some of which are closed and have sealed within the diamagnetic substance without any of the paramagnetic material. The remaining tubes are open to flow of the mix- ture. Primary and secondary conductors are wrapped around the tubes in such a way as to cancel noise components and also to produce a differential signal on the secondaries based upon variations of the content of the paramagnetic material. (AEC)
International Nuclear Information System (INIS)
Leung, P.M.; Webb, H.P.J.
1985-01-01
This invention relates to apparatus for applying intracavitary radiotherapy. In previously-known systems radioactive material is conveyed to a desired location within a patient by transporting a chain of balls pneumatically to and from an appropriately inserted applicator. According to this invention a ball chain for such a purpose comprises several radioactive balls separated by non-radioactive tracer balls of radiographically transparent material of lower density and surface hardness than the radioactive balls. The invention also extends to radiotherapy treatment apparatus comprising a storage, sorting and assembly system
The standardization of an apparatus for the mixing of soil samples ...
African Journals Online (AJOL)
Quantitative determination of nematode populations in soils frequently necessitates the mixing of representative soil samples to form a homogeneous, compound sample from which the nematodes are extracted. A mixing apparatus was developed and standardized with the aid of a spectrophotometric technique by which ...
Apparatus for Teaching Physics.
Gottlieb, Herbert H., Ed.
1981-01-01
Describes: (1) a variable inductor suitable for an inductance-capacitance bridge consisting of a fixed cylindrical solenoid and a moveable solenoid; (2) long-range apparatus for demonstrating falling bodies; and (3) an apparatus using two lasers to demonstrate ray optics. (SK)
International Nuclear Information System (INIS)
1979-01-01
This invention relates to a radiation imaging apparatus. It relates more particularly to apparatus of this general type which employs stationary X-ray source and detector arrays capable of acquiring multiple ultrafast scans per second to facilitate the dynamic study of moving human organs such as the beating heart. While the invention has many applications, it has particular utility in connection with computerized tomographic (CT) scanners. (Auth.)
Probabilistic Slow Features for Behavior Analysis
Zafeiriou, Lazaros; Nicolaou, Mihalis A.; Zafeiriou, Stefanos; Nikitidis, Symeon; Pantic, Maja
A recently introduced latent feature learning technique for time-varying dynamic phenomena analysis is the so-called slow feature analysis (SFA). SFA is a deterministic component analysis technique for multidimensional sequences that, by minimizing the variance of the first-order time derivative
Learning slow features for behavior analysis
Zafeiriou, Lazaros; Nicolaou, Mihalis A.; Zafeiriou, Stefanos; Nikitids, Symeon; Pantic, Maja
2013-01-01
A recently introduced latent feature learning technique for time varying dynamic phenomena analysis is the socalled Slow Feature Analysis (SFA). SFA is a deterministic component analysis technique for multi-dimensional sequences that by minimizing the variance of the first order time derivative
A portable X-ray diffraction apparatus for in situ analyses of masters' paintings
Eveno, Myriam; Duran, Adrian; Castaing, Jacques
2010-09-01
It is rare that the analyses of materials in paintings can be carried out by taking micro-samples. Valuable works of art are best studied in situ by non-invasive techniques. For that purpose, a portable X-ray diffraction and fluorescence apparatus has been designed and constructed at the C2RMF. This apparatus has been used for paintings of Rembrandt, Leonardo da Vinci, Van Gogh, Mantegna, etc. Results are given to illustrate the performance of X-ray diffraction, especially when X-ray fluorescence does not bring sufficient information to conclude.
A portable X-ray diffraction apparatus for in situ analyses of masters' paintings
International Nuclear Information System (INIS)
Eveno, Myriam; Duran, Adrian; Castaing, Jacques
2010-01-01
It is rare that the analyses of materials in paintings can be carried out by taking micro-samples. Valuable works of art are best studied in situ by non-invasive techniques. For that purpose, a portable X-ray diffraction and fluorescence apparatus has been designed and constructed at the C2RMF. This apparatus has been used for paintings of Rembrandt, Leonardo da Vinci, Van Gogh, Mantegna, etc. Results are given to illustrate the performance of X-ray diffraction, especially when X-ray fluorescence does not bring sufficient information to conclude. (orig.)
International Nuclear Information System (INIS)
Marmo, A.R.
1979-01-01
An improved design of a sludge recovery apparatus used in the fabrication of nuclear fuel is described. This apparatus provides for automatic separation of sludge from the grinder coolant, drying of the sludge into a flowable powder and transfer of the dry powder to a salvage container. It can be constructed to comply with criticality-safe-geometry requirements and to obviate need for operating personnel in its immediate vicinity. (UK)
International Nuclear Information System (INIS)
Mitchell, J.B.A.; Grover, J.R.
1978-11-01
A proposed atomic and moleuclar beam apparatus is described for photon interaction studies using the National Sychrotron Light Source at the Brookhaven National Laboratory. This apparatus will employ ultrahigh vacuum techniques compatible with storage ring operation. Supersonic nozzle sources will be used to produce the beams and signal detection will be accomplished using a quadrupole mass analysis system. The equipment is intended for use both by in-house and outside users and primary consideration has been given to flexibility of design. The application of photoionization techniques to the study of crossed beam reactive scattering with particular emphasis on internal energy distribution analysis is discussed
Apparatuses And Systems For Embedded Thermoelectric Generators
Hussain, Muhammad M.; Inayat, Salman Bin; Smith, Casey Eben
2013-01-01
An apparatus and a system for embedded thermoelectric generators are disclosed. In one embodiment, the apparatus is embedded in an interface where the ambient temperatures on two sides of the interface are different. In one embodiment, the apparatus is fabricated with the interface in integrity as a unitary piece. In one embodiment, the apparatus includes a first thermoelectric material embedded through the interface. The apparatus further includes a second thermoelectric material embedded through the interface. The first thermoelectric material is electrically coupled to the second thermoelectric material. In one embodiment, the apparatus further includes an output structure coupled to the first thermoelectric material and the second thermoelectric material and configured to output a voltage.
Apparatuses And Systems For Embedded Thermoelectric Generators
Hussain, Muhammad M.
2013-08-08
An apparatus and a system for embedded thermoelectric generators are disclosed. In one embodiment, the apparatus is embedded in an interface where the ambient temperatures on two sides of the interface are different. In one embodiment, the apparatus is fabricated with the interface in integrity as a unitary piece. In one embodiment, the apparatus includes a first thermoelectric material embedded through the interface. The apparatus further includes a second thermoelectric material embedded through the interface. The first thermoelectric material is electrically coupled to the second thermoelectric material. In one embodiment, the apparatus further includes an output structure coupled to the first thermoelectric material and the second thermoelectric material and configured to output a voltage.
Gray, C.F.; Thompson, R.H.
1958-10-01
An improved apparatus for the melting and casting of uranium is described. A vacuum chamber is positioned over the casting mold and connected thereto, and a rod to pierce the oxide skin of the molten uranium is fitted into the bottom of the melting chamber. The entire apparatus is surrounded by a jacket, and operations are conducted under a vacuum. The improvement in this apparatus lies in the fact that the top of the melting chamber is fitted with a plunger which allows squeezing of the oxide skin to force out any molten uranium remaining after the skin has been broken and the molten charge has been cast.
Self-propelled pulse X-ray apparatus Sirena-1
International Nuclear Information System (INIS)
Danil'chenko, N.T.; Ershov, L.S.; Il'chenko, A.V.; Krasil'nikov, S.B.; Kristalinskij, A.L.; Lozovoj, L.N.; Markov, S.N.; Morgovskij, L.Ya.
1984-01-01
The structure and specifications of a self-propelled pulse X-ray apparatus ''Sirena-1'' for testing oilt and gas pipelines welded joints are described. The apparatus is designed on the base of pulse X-ray apparatus MIRA. Apparatus control is realized by means of the 137 Cs source or manual control desk. The apparatus ensures perfect control sensitivity
International Nuclear Information System (INIS)
1981-01-01
An X-ray apparatus is described for determining the size and location of brain tumours by tomography during pneumoencephalography. The apparatus comprises an image recording device arranged opposite an X-ray source and a frame mounted on a tiltable patient table and rotatable with respect to the table. A patient support is arranged in the frame and is rotatable with respect to the frame. Air injected into the patients' spinal column travels up into the brain and displaces some of the cerebral fluid. Tomographic X-ray exposures are made of the air bubble which moves around in the brain cavities as the patient is rotated. (U.K.)
International Nuclear Information System (INIS)
Sashin, D.; Sternglass, E.J.
1982-01-01
The apparatus of the present invention provides radiography apparatus wherein the use of a flat, generally rectangular beam or a fan-shaped beam of radiation in combination with a collimator, scintillator and device for optically coupling a self-scanning array of photodiodes to the scintillator means will permit production of images or image data with high contrast sensitivity and detail. It is contemplated that the self-scanning array of photodiodes may contain from about 60 to 2048, and preferably about 256 to 2048, individual photodiode elements per inch of object width, thereby permitting maximum data collection to produce a complete image or complete collection of image data
International Nuclear Information System (INIS)
Elsner, H.J.
1979-01-01
Calibration apparatus for verifying the position and orientation of transducers used in nuclear reactor vessel inspection apparatus is disclosed. A tank, filled with water, the operating inspection medium, is fitted with a movable mounting assembly adapted to securely accommodate a transducer and the mounting assembly in which it is normally secured during an inspection procedure. The tank is also provided with a slidably mounted target positioned therein at a predetermined distance from the target which is selected to avoid the distortion effects in the near field of the transducer response. The calibration apparatus can be used to check the normal transducer mounting for either perpendicularity or angular orientation by moving the tank's mounting assembly via a lead screw with which it is threadingly engaged. 6 claims
1304-IJBCS-Article-Rosaine N Yegbemey Jacob
African Journals Online (AJOL)
hp
Rice producers' efficiency is widely assessed by using the Stochatistic Frontier Analysis (SFA). But because of gaps between the output(s) implied ... This indicates the sensitivity of the sector, subject to several and various interventions .... (DEA), the statistical techniques (OLS and. SFA) and the Index Number Techniques.
Method And Apparatus For Evaluatin Of High Temperature Superconductors
Fishman, Ilya M.; Kino, Gordon S.
1996-11-12
A technique for evaluation of high-T.sub.c superconducting films and single crystals is based on measurement of temperature dependence of differential optical reflectivity of high-T.sub.c materials. In the claimed method, specific parameters of the superconducting transition such as the critical temperature, anisotropy of the differential optical reflectivity response, and the part of the optical losses related to sample quality are measured. The apparatus for performing this technique includes pump and probe sources, cooling means for sweeping sample temperature across the critical temperature and polarization controller for controlling a state of polarization of a probe light beam.
Tomographic apparatus for reconstructing planar slices from non-absorbed and non-scattered radiation
International Nuclear Information System (INIS)
1980-01-01
After briefly reviewing the history of computerised tomography, the deficiencies inherent in the various methods that have been adopted are discussed, e.g. slow data collection time, blurring of images and poor spatial resolution. Tomographic apparatus and processing methods are then described which can overcome these problems. The apparatus consists of a fan-shaped source of X-rays and a detector array which both rotate around the patient being examined. The data reduction process is derived in great detail; it is claimed that digital processing using convolution techniques is much faster than conventional methods. (U.K.)
Development of an apparatus to measure thermophysical properties of wind tunnel heat transfer models
Romanowski, R. F.; Steinberg, I. H.
1974-01-01
The apparatus and technique for measuring the thermophysical properties of models used with the phase-change paint method for obtaining wind tunnel heat transfer data are described. The method allows rapid measurement of the combined properties in a transient manner similar to an actual wind tunnel test. An effective value of the thermophysical properties can be determined which accounts for changes in thermal properties with temperature or with depth into the model surface. The apparatus was successfully tested at various heating rates between 19,000 and 124,000 watts per square meter.
International Nuclear Information System (INIS)
Tomita, Chuji.
1980-01-01
A principal object of the present invention is to provide an X-ray apparatus which is such that the distance between the surface of the patient's table and the floor on which the apparatus is installed is sufficiently small in the horizontal position of the patient's table of the roentgenographical pedestal and that the rotation of the pedestal from the horizontal position to a tilted position and further to the vertical position of the table can be carried out smoothly. (auth)
Nuclear core baffling apparatus
International Nuclear Information System (INIS)
Cooper, F.W. Jr.; Silverblatt, B.L.; Knight, C.B.; Berringer, R.T.
1979-01-01
An apparatus for baffling the flow of reactor coolant fluid into and about the core of a nuclear reactor is described. The apparatus includes a plurality of longitudinally aligned baffle plates with mating surfaces that allow longitudinal growth with temperature increases while alleviating both leakage through the aligned plates and stresses on the components supporting the plates
Radioactive waste material melter apparatus
Newman, D.F.; Ross, W.A.
1990-04-24
An apparatus for preparing metallic radioactive waste material for storage is disclosed. The radioactive waste material is placed in a radiation shielded enclosure. The waste material is then melted with a plasma torch and cast into a plurality of successive horizontal layers in a mold to form a radioactive ingot in the shape of a spent nuclear fuel rod storage canister. The apparatus comprises a radiation shielded enclosure having an opening adapted for receiving a conventional transfer cask within which radioactive waste material is transferred to the apparatus. A plasma torch is mounted within the enclosure. A mold is also received within the enclosure for receiving the melted waste material and cooling it to form an ingot. The enclosure is preferably constructed in at least two parts to enable easy transport of the apparatus from one nuclear site to another. 8 figs.
Radioactive waste material melter apparatus
International Nuclear Information System (INIS)
Newman, D.F.; Ross, W.A.
1990-01-01
An apparatus for preparing metallic radioactive waste material for storage is disclosed. The radioactive waste material is placed in a radiation shielded enclosure. The waste material is then melted with a plasma torch and cast into a plurality of successive horizontal layers in a mold to form a radioactive ingot in the shape of a spent nuclear fuel rod storage canister. The apparatus comprises a radiation shielded enclosure having an opening adapted for receiving a conventional transfer cask within which radioactive waste material is transferred to the apparatus. A plasma torch is mounted within the enclosure. A mold is also received within the enclosure for receiving the melted waste material and cooling it to form an ingot. The enclosure is preferably constructed in at least two parts to enable easy transport of the apparatus from one nuclear site to another. 8 figs
The design of high-temperature thermal conductivity measurements apparatus for thin sample size
Directory of Open Access Journals (Sweden)
Hadi Syamsul
2017-01-01
Full Text Available This study presents the designing, constructing and validating processes of thermal conductivity apparatus using steady-state heat-transfer techniques with the capability of testing a material at high temperatures. This design is an improvement from ASTM D5470 standard where meter-bars with the equal cross-sectional area were used to extrapolate surface temperature and measure heat transfer across a sample. There were two meter-bars in apparatus where each was placed three thermocouples. This Apparatus using a heater with a power of 1,000 watts, and cooling water to stable condition. The pressure applied was 3.4 MPa at the cross-sectional area of 113.09 mm2 meter-bar and thermal grease to minimized interfacial thermal contact resistance. To determine the performance, the validating process proceeded by comparing the results with thermal conductivity obtained by THB 500 made by LINSEIS. The tests showed the thermal conductivity of the stainless steel and bronze are 15.28 Wm-1K-1 and 38.01 Wm-1K-1 with a difference of test apparatus THB 500 are −2.55% and 2.49%. Furthermore, this apparatus has the capability to measure the thermal conductivity of the material to a temperature of 400°C where the results for the thermal conductivity of stainless steel is 19.21 Wm-1K-1 and the difference was 7.93%.
Fractionation and rectification apparatus
Energy Technology Data Exchange (ETDEWEB)
Sauerwald, A
1932-05-25
Fractionation and rectifying apparatus with a distillation vessel and a stirring tube, drainage tubes leading from its coils to a central collecting tube, the drainage tubes being somewhat parallel and attached to the outer half of the stirring tube and partly on the inner half of the central collecting tube, whereby distillation and rectification can be effected in a single apparatus.
42 CFR 84.74 - Apparatus containers; minimum requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Apparatus containers; minimum requirements. 84.74...-Contained Breathing Apparatus § 84.74 Apparatus containers; minimum requirements. (a) Apparatus may be equipped with a substantial, durable container bearing markings which show the applicant's name, the type...
Specifications for surface reaction analysis apparatus
International Nuclear Information System (INIS)
Teraoka, Yuden; Yoshigoe, Akitaka
2001-03-01
A surface reaction analysis apparatus was installed at the JAERI soft x-ray beamline in the SPring-8 as an experimental end-station for the study of surface chemistry. The apparatus is devoted to the study concerning the influence of translational kinetic energy of incident molecules to chemical reactions on solid surfaces with gas molecules. In order to achieve the research purpose, reactive molecular scattering experiments and photoemission spectroscopic measurements using synchrotron radiation are performed in that apparatus via a supersonic molecular beam generator, an electron energy analyzer and a quadrupole mass analyzer. The detail specifications for the apparatus are described in this report. (author)
A simple apparatus for measuring the blood urea, manufactured by Dr. Luigj Benusi in 1943 in Albania
Tartari, Flamur; Buzo, Stiliano; Vyshka, Gentian
2009-01-01
The apparatus invented by Dr. Luigj Benusi in 1943, in Tirana, was a practical application of the Kowarsky technique and Ambard laws, helping in determining blood urea levels and very important to a variety of diseases, mainly kidney disorders. The apparatus was invented and prepared from very simple laboratory materials, such as glasses, test tubes, corks and volumetric cylinders. Technologically, it was based upon the determination of blood urea through hypobromite, and, among the advantage...
Radioactive waste processing apparatus
Nelson, R.E.; Ziegler, A.A.; Serino, D.F.; Basnar, P.J.
1985-08-30
Apparatus for use in processing radioactive waste materials for shipment and storage in solid form in a container is disclosed. The container includes a top, and an opening in the top which is smaller than the outer circumference of the container. The apparatus includes an enclosure into which the container is placed, solution feed apparatus for adding a solution containing radioactive waste materials into the container through the container opening, and at least one rotatable blade for blending the solution with a fixing agent such as cement or the like as the solution is added into the container. The blade is constructed so that it can pass through the opening in the top of the container. The rotational axis of the blade is displaced from the center of the blade so that after the blade passes through the opening, the blade and container can be adjusted so that one edge of the blade is adjacent the cylindrical wall of the container, to insure thorough mixing. When the blade is inside the container, a substantially sealed chamber is formed to contain vapors created by the chemical action of the waste solution and fixant, and vapors emanating through the opening in the container. The chamber may be formed by placing a removable extension over the top of the container. The extension communicates with the apparatus so that such vapors are contained within the container, extension and solution feed apparatus. A portion of the chamber includes coolant which condenses the vapors. The resulting condensate is returned to the container by the force of gravity.
Switched-mode power supply apparatus and method
2013-01-01
The present invention relates to a switched-mode power supply apparatus and a corresponding method. For an effective compensation of non-linearities caused by dead- time and voltage drops in the switching power amplifier of the apparatus, an apparatus is proposed comprising a switching power
Switched-mode power supply apparatus and method
2013-01-01
The present invention relates to a switched-mode power supply apparatus and a corresponding method. For an effective compensation of non-linearities caused by dead-time and voltage drops in the switching power amplifier of the apparatus, an apparatus is proposed comprising a switching power
Ballard, A.E.; Brigham, H.R.
1958-10-28
An apparatus whereby relatlvely volatile solvents may be contacted with volatile or non-volatile material without certaln attendant hazards is described. A suitable apparatus for handling relatively volatlle liqulds may be constructed comprising a tank, and a closure covering the tank and adapted to be securely attached to an external suppont. The closure is provided with a rigidly mounted motor-driven agitator. This agitator is connected from the driving motor lnto the lnterlor of the tank through a gland adapted to be cooled witb inert gas thereby eliminating possible hazard due to frictional heat. The closure is arranged so that the tank may be removed from it without materially dlsturbing the closure which, as described, carrles the motor driven agitator and other parts.
Apparatus for ultrasonic nebulization
International Nuclear Information System (INIS)
Olson, K.W.; Haas, W.J. Jr.; Fassel, V.A.
1978-01-01
An improved apparatus is described for ultrasonic nebulization of liquid samples or suspensions in which the piezoelectric transducer is protected from chemical attack and erosion. The transducer is protected by being bonded to the inner surface of a glass plate which forms one end wall of a first hollow body provided with apparatus for circulating a fluid for cooling and stabilizing the transducer. The glass plate, which is one-half wavelength in thickness to provide an acoustically coupled outer nebulizing surface, seals an opening in a second hollow body which encloses an aerosol mixing chamber. The second body includes apparatus for delivering the sample solution to the nebulizing surface, a gas inlet for providing a flow of carrier gas for transporting the aerosol of the nebulized sample and an aerosol outlet
Nuclear magnetic resonance method and apparatus
International Nuclear Information System (INIS)
Young, I.R.
1983-01-01
In a method of investigating the distribution of a quantity in a chosen region of a body (E) by nuclear magnetic resonance techniques movement of the body during the investigation is monitored by probes (A, B C) (C extends orthogonally to A and B) attached to the body and responsive to magnetic fields applied to the body during the investigation. An apparatus for carrying out the method is also described. If movement is detected, due compensation may be made during processing of the collected data, or the latter may be re-ascertained after appropriate adjustment e.g. a change in the RF excitation frequency. (author)
Test sample handling apparatus
International Nuclear Information System (INIS)
1981-01-01
A test sample handling apparatus using automatic scintillation counting for gamma detection, for use in such fields as radioimmunoassay, is described. The apparatus automatically and continuously counts large numbers of samples rapidly and efficiently by the simultaneous counting of two samples. By means of sequential ordering of non-sequential counting data, it is possible to obtain precisely ordered data while utilizing sample carrier holders having a minimum length. (U.K.)
Infrared microscope inspection apparatus
Forman, Steven E.; Caunt, James W.
1985-02-26
Apparatus and system for inspecting infrared transparents, such as an array of photovoltaic modules containing silicon solar cells, includes an infrared microscope, at least three sources of infrared light placed around and having their axes intersect the center of the object field and means for sending the reflected light through the microscope. The apparatus is adapted to be mounted on an X-Y translator positioned adjacent the object surface.
Apparatus and methods for investigations into acoustic properties of electronic melts
International Nuclear Information System (INIS)
Glazov, V.M.; Timoshenko, V.I.; Kim, S.G.
1985-01-01
Apparatus and highly sensitive methods of systematic investigations into acoustic properties of electronic melts are described. A variant of a measuring cell to investigate agressive melts is presented. A new technique for the reception of an acoustic contact with high transmission capacity of ultrasonic wave based on utilization of clarified layers of liquid boron anhydride is described. Results of calibration tests on lead and aluminium melts point to a good agreement with literature data. High sensitivity of the above technique allows one to reveal thin structural effects in melts
Maurye, Praveen; Basu, Arpita; Bandyopadhyay, Tapas Kumar; Biswas, Jayanta Kumar; Mohanty, Bimal Prasana
2017-08-01
PAGE is the most widely used technique for the separation and biochemical analysis of biomolecules. The ever growing field of proteomics and genomics necessitates the analysis of many proteins and nucleic acid samples to understand further about the structure and function of cells. Simultaneous analysis of multiple protein samples often requires casting of many PAGE gels. Several variants of multi-gel casting/electrophoresis apparatuses are frequently used in research laboratories. Requirement of supplementary gels to match the growing demand for analyzing additional protein samples sometimes become a cause of concern. Available apparatuses are not amenable to and therefore, not recommended for any modification to accommodate additional gel casting units other than what is prescribed by the manufacturer. A novel apparatus is described here for casting multiple PAGE gels comprising four detachable components that provide enhanced practicability and performance of the apparatus. This newly modified apparatus promises to be a reliable source for making multiple gels in less time without hassle. Synchronized functioning of unique components broaden the possibilities of developing inexpensive, safe, and time-saving multi-gel casting apparatus. This apparatus can be easily fabricated and modified to accommodate desired number of gel casting units. The estimated cost (∼$300) for fabrication of the main apparatus is very competitive and effortless assembly procedure can be completed within ∼30 min. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Support of nuclear fusion apparatus
International Nuclear Information System (INIS)
Watarai, Tetsuo; Ito, Yutaka.
1975-01-01
Object: To integrally form a bed for a body for supporting a vacuum container, coil and the like and a bed for a current transformer for supporting the current transformer prior to installation thereof on the floor thereby facilitating assembly and installation. Structure: To provide a base common to a current transformer bed and a body bed without direct installation thereof on the floor. Prior to installation of the current transformer bed and body bed, they are fastened to the base by means of bolts and welded integrally, and the thus formed base is fixed to the floor by means of anchor bolts. Since the current transformer bed and the body bed are formed integrally through the common base, apparatus may easily be carried in and disassembling and re-assembling of apparatus become unnecessary when installed. Further, since the positional relation of the current transformer bed and body bed does not depend on accuracy at the time of installation but depends on accuracy when apparatus manufactured, the toroidal type nuclear fusion apparatus of good accuracy may be obtained. (Yoshihara, H.)
International Nuclear Information System (INIS)
Howard, A.G.
1981-01-01
An air-cleaning, heat-exchange apparatus includes a main housing portion connected by means of an air inlet fan to the kitchen exhaust stack of a restaurant. The apparatus includes a plurality of heat exchangers through which a heat-absorptive fluid is circulated, simultaneously, by means of a suitable fluid pump. These heat exchangers absorb heat from the hot exhaust gas, out of the exhaust stack of the restaurant, which flows over and through these heat exchangers and transfers this heat to the circulating fluid which communicates with remote heat exchangers. These remote heat exchangers further transfer this heat to a stream of air, such as that from a cold-air return duct for supplementing the conventional heating system of the restaurant. Due to the fact that such hot exhaust gas is heavily grease laden , grease will be deposited on virtually all internal surfaces of the apparatus which this exhaust gas contacts. Consequently, means are provided for spraying these contacted internal surfaces , as well as the hot exhaust gas itself, with a detergent solution in which the grease is soluble, thereby removing grease buildup from these internal surfaces
A Study on Test Technology to Diagnose the Power Apparatus
Energy Technology Data Exchange (ETDEWEB)
Kim, K H; Kang, Y S; Jeon, Y K; Lee, W Y; Kang, D S; Kyu, H S; Sun, J H; Jo, K H [Korea Electrotechnology Research Institute (Korea, Republic of); Jung, J S; Mun, Y T; Lee, K H; Jung, E H; Kim, J H [Korea Water Resources Corporation (Korea, Republic of)
1997-02-01
In this study, we have educated KOWACO(Korea Water Resources Corporation) specialists about the insulation diagnostic technology and trained them the insulation diagnostic test and estimation method of power apparatus. The main results of this study are as follows; A. Education of basic high-voltage engineering. B. Research of insulation characteristic and deterioration mechanism in power apparatus C. Discussion on high-voltage test standard specifications. D. Study on insulation deterioration diagnostics in power apparatus. E. Field testing of insulation diagnosis in power apparatus. F. Engineering of insulation diagnostic testing apparatus to diagnose power apparatus. KOWACO specialists are able to diagnose insulation diagnostic test of power apparatus through this study. As they have instruments to diagnose power apparatus, they can do the test and estimation of the power apparatus insulation diagnosis. (author). refs., figs., tabs.
Apparatus Named after Our Academic Ancestors--I
Greenslade, Thomas B., Jr.
2010-01-01
Let us now praise famous physicists, and the apparatus named after them, with apologies to the writer of Ecclesiastes. I once compiled a list of about 300 pieces of apparatus known to us as X's Apparatus. Some of the values of X are familiar, like Wheatstone and Kelvin and Faraday, but have you heard of Pickering or Rhumkorff or Barlow? In an…
21 CFR 886.4100 - Radiofrequency electrosurgical cautery apparatus.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Radiofrequency electrosurgical cautery apparatus... SERVICES (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4100 Radiofrequency electrosurgical cautery apparatus. (a) Identification. A radiofrequency electrosurgical cautery apparatus is an AC...
APPARATUS FOR ELECTRON BEAM HEATING CONTROL
Jones, W.H.; Reece, J.B.
1962-09-18
An improved electron beam welding or melting apparatus is designed which utilizes a high voltage rectifier operating below its temperature saturation region to decrease variations in electron beam current which normally result from the gas generated in such apparatus. (AEC)
Uranium dioxide calcining apparatus
International Nuclear Information System (INIS)
Cole, E.A.; Peterson, R.S.
1978-01-01
This invention relates to an improved continuous calcining apparatus for consistently and controllably producing from calcinable reactive solid compounds of uranium, such as ammonium diuranate, uranium dioxide (UO 2 ) having an oxygen to uranium ratio of less than 2.2. The apparatus comprises means at the outlet end of a calciner kiln for receiving hot UO 2 , means for cooling the UO 2 to a temperature of below 100 deg C and conveying the cooled UO 2 to storage or to subsequent UO 2 processing apparatus where it finally comes into contact with air, the means for receiving cooling and conveying being sealed to the outlet end of the calciner and being maintained full of UO 2 and so operable as to exclude atmospheric oxygen from coming into contact with any UO 2 which is at elevated temperatures where it would readily oxidize, without the use of extra hydrogen gas in said means. (author)
International Nuclear Information System (INIS)
Bistolfi, F.; Grillo Ruggeri, F.; Siragusa, A.
1987-01-01
Rectal constipation, anal incontinence and constipation combined with incontinence, are often caused by organic or simply functional changes in the pelvic floor and sphincterial apparatus. Therefore morphological as well as manometric and electromyographic studies of these anatomical parts are required. This is possible by combining two techniques: Intestinal Transit Time (ITT) and Defecatory Proctogram with Balloon (DPB). Personal experience of 38 patients with constipation with or without incontinence is reported. The results lead to the following conclusion: 1) ITT is a simple and non-invasive radiological technique that provides us with objective evidence of an impairment, i.e. constipation, whose symptoms are often only subjective; especially is allows us to identify rectal constipation, that can be caused by impairment of the anal sphincteral apparatus. 2) Using an uroprophylactic with a collar that adapts to the size of the anal duct, DPB always permits visualization of the duct with good representation of the recto-anal angle, whose changes may be the expression of organic or only functional impairments of the anal sphincterial apparatus. Increasing use of the two radiological techniques is therefore recommended in the diagnosis of alterations of the pelvic floor or anal sphincter
Horn, Kevin M [Albuquerque, NM
2006-03-28
A scanned, pulsed, focused laser irradiation apparatus can measure and image the photocurrent collection resulting from a dose-rate equivalent exposure to infrared laser light across an entire silicon die. Comparisons of dose-rate response images or time-delay images from before, during, and after accelerated aging of a device, or from periodic sampling of devices from fielded operational systems allows precise identification of those specific age-affected circuit structures within a device that merit further quantitative analysis with targeted materials or electrical testing techniques. Another embodiment of the invention comprises a broad-beam, dose rate-equivalent exposure apparatus. The broad-beam laser irradiation apparatus can determine if aging has affected the device's overall functionality. This embodiment can be combined with the synchronized introduction of external electrical transients into a device under test to simulate the electrical effects of the surrounding circuitry's response to a radiation exposure.
Rezaei, Satar; Zandian, Hamed; Baniasadi, Akram; Moghadam, Telma Zahirian; Delavari, Somayeh; Delavari, Sajad
2016-02-01
Hospitals are the most expensive health services provider in the world. Therefore, the evaluation of their performance can be used to reduce costs. The aim of this study was to determine the efficiency of the hospitals at the Kurdistan University of Medical Sciences using stochastic frontier analysis (SFA). This was a cross-sectional and retrospective study that assessed the performance of Kurdistan teaching hospitals (n = 12) between 2007 and 2013. The Stochastic Frontier Analysis method was used to achieve this aim. The numbers of active beds, nurses, physicians, and other staff members were considered as input variables, while the inpatient admission was considered as the output. The data were analyzed using Frontier 4.1 software. The mean technical efficiency of the hospitals we studied was 0.67. The results of the Cobb-Douglas production function showed that the maximum elasticity was related to the active beds and the elasticity of nurses was negative. Also, the return to scale was increasing. The results of this study indicated that the performances of the hospitals were not appropriate in terms of technical efficiency. In addition, there was a capacity enhancement of the output of the hospitals, compared with the most efficient hospitals studied, of about33%. It is suggested that the effect of various factors, such as the quality of health care and the patients' satisfaction, be considered in the future studies to assess hospitals' performances.
21 CFR 868.5165 - Nitric oxide administration apparatus.
2010-04-01
... apparatus. (a) Identification. The nitric oxide administration apparatus is a device used to add nitric oxide to gases that are to be breathed by a patient. The nitric oxide administration apparatus is to be used in conjunction with a ventilator or other breathing gas administration system. (b) Classification...
International Nuclear Information System (INIS)
Reuter, F.A.; Moorman, Ch.J.
1985-01-01
An apparatus for charging a dosimeter which has a capacitor connected between first and second electrodes and a movable electrode in a chamber electrically connected to the first electrode. The movable electrode deflects varying amounts depending upon the charge present on said capacitor. The charger apparatus includes first and second charger electrodes couplable to the first and second dosimeter electrodes. To charge the dosimeter, it is urged downwardly into a charging socket on the charger apparatus. The second dosimeter electrode, which is the dosimeter housing, is electrically coupled to the second charger electrode through a conductive ring which is urged upwardly by a spring. As the dosimeter is urged into the socket, the ring moves downwardly, in contact with the second charger electrode. As the dosimeter is further urged downwardly, the first dosimeter electrode and first charger electrode contact one another, and an insulator post carrying the first and second charger electrodes is urged downwardly. Downward movement of the post effects the application of a charging potential between the first and second charger electrodes. After the charging potential has been applied, the dosimeter is moved further into the charging socket against the force of a relatively heavy biasing spring until the dosimeter reaches a mechanical stop in the charging socket
Hydraulic Apparatus for Mechanical Testing of Nuts
Hinkel, Todd J.; Dean, Richard J.; Hacker, Scott C.; Harrington, Douglas W.; Salazar, Frank
2004-01-01
The figure depicts an apparatus for mechanical testing of nuts. In the original application for which the apparatus was developed, the nuts are of a frangible type designed for use with pyrotechnic devices in spacecraft applications in which there are requirements for rapid, one-time separations of structures that are bolted together. The apparatus can also be used to test nonfrangible nuts engaged without pyrotechnic devices. This apparatus was developed to replace prior testing systems that were extremely heavy and immobile and characterized by long setup times (of the order of an hour for each nut to be tested). This apparatus is mobile, and the setup for each test can now be completed in about five minutes. The apparatus can load a nut under test with a static axial force of as much as 6.8 x 10(exp 5) lb (3.0 MN) and a static moment of as much as 8.5 x 10(exp 4) lb in. (9.6 x 10(exp 3) N(raised dot)m) for a predetermined amount of time. In the case of a test of a frangible nut, the pyrotechnic devices can be exploded to break the nut while the load is applied, in which case the breakage of the nut relieves the load. The apparatus can be operated remotely for safety during an explosive test. The load-generating portion of the apparatus is driven by low-pressure compressed air; the remainder of the apparatus is driven by 110-Vac electricity. From its source, the compressed air is fed to the apparatus through a regulator and a manually operated valve. The regulated compressed air is fed to a pneumatically driven hydraulic pump, which pressurizes oil in a hydraulic cylinder, thereby causing a load to be applied via a hydraulic nut (not to be confused with the nut under test). During operation, the hydraulic pressure is correlated with the applied axial load, which is verified by use of a load cell. Prior to operation, one end of a test stud (which could be an ordinary threaded rod or bolt) is installed in the hydraulic nut. The other end of the test stud passes
Flow analysis techniques for phosphorus: an overview.
Estela, José Manuel; Cerdà, Víctor
2005-04-15
A bibliographical review on the implementation and the results obtained in the use of different flow analytical techniques for the determination of phosphorus is carried out. The sources, occurrence and importance of phosphorus together with several aspects regarding the analysis and terminology used in the determination of this element are briefly described. A classification as well as a brief description of the basis, advantages and disadvantages of the different existing flow techniques, namely; segmented flow analysis (SFA), flow injection analysis (FIA), sequential injection analysis (SIA), all injection analysis (AIA), batch injection analysis (BIA), multicommutated FIA (MCFIA), multisyringe FIA (MSFIA) and multipumped FIA (MPFIA) is also carried out. The most relevant manuscripts regarding the analysis of phosphorus by means of flow techniques are herein classified according to the detection instrumental technique used with the aim to facilitate their study and obtain an overall scope. Finally, the analytical characteristics of numerous flow-methods reported in the literature are provided in the form of a table and their applicability to samples with different matrixes, namely water samples (marine, river, estuarine, waste, industrial, drinking, etc.), soils leachates, plant leaves, toothpaste, detergents, foodstuffs (wine, orange juice, milk), biological samples, sugars, fertilizer, hydroponic solutions, soils extracts and cyanobacterial biofilms are tabulated.
Surface Forces Apparatus measurements of interactions between rough and reactive calcite surfaces.
Dziadkowiec, Joanna; Javadi, Shaghayegh; Bratvold, Jon Einar; Nilsen, Ola; Røyne, Anja
2018-05-28
Nm-range forces acting between calcite surfaces in water affect macroscopic properties of carbonate rocks and calcite-based granular materials, and are significantly influenced by calcite surface recrystallization. We suggest that the repulsive mechanical effects related to nm-scale surface recrystallization of calcite in water could be partially responsible for the observed decrease of cohesion in calcitic rocks saturated with water. Using the Surface Forces Apparatus (SFA), we simultaneously followed the calcite reactivity and measured the forces in water in two surface configurations: between two rough calcite surfaces (CC), or between rough calcite and a smooth mica surface (CM). We used nm-scale rough, polycrystalline calcite films prepared by Atomic Layer Deposition (ALD). We measured only repulsive forces in CC in CaCO 3 -saturated water, which was related to roughness and possibly to repulsive hydration effects. Adhesive or repulsive forces were measured in CM in CaCO 3 -saturated water depending on calcite roughness, and the adhesion was likely enhanced by electrostatic effects. The pull-off adhesive force in CM became stronger with time and this increase was correlated with a decrease of roughness at contacts, which parameter could be estimated from the measured force-distance curves. That suggested a progressive increase of real contact areas between the surfaces, caused by gradual pressure-driven deformation of calcite surface asperities during repeated loading-unloading cycles. Reactivity of calcite was affected by mass transport across nm to µm-thick gaps between the surfaces. Major roughening was observed only for the smoothest calcite films, where gaps between two opposing surfaces were nm-thick over µm-sized areas, and led to force of crystallization that could overcome confining pressures of the order of MPa. Any substantial roughening of calcite caused a significant increase of the repulsive mechanical force contribution.
Radiative Gasification Apparatus
Federal Laboratory Consortium — This apparatus, developed at EL, determines gasification rate (mass loss rate) of a horizontally oriented specimen exposed in a nitrogen environment to a controlled...
Electroplating method and apparatus
International Nuclear Information System (INIS)
Looney, R.B.; Smith, W.E.L.
1978-01-01
Disclosed is an apparatus for high speed electroplating or anodizing tubular members such as nuclear reactor fuel elements. A loading arm positions the member on a base for subsequent support by one of two sets of electrical contacts. A carriage assembly positions electrodes into and around the member. Electrolyte is pumped between the electrodes and the member while electric current is applied. Programmed controls sequentially employ each of the two sets of contacts to expose all surfaces of the member to the electrolyte. The member is removed from the apparatus by an unloading arm
Electroplating method and apparatus
Looney, Robert B.; Smith, William E. L.
1978-06-20
An apparatus for high speed electroplating or anodizing tubular members such as nuclear reactor fuel elements. A loading arm positions the member on a base for subsequent support by one of two sets of electrical contacts. A carriage assembly positions electrodes into and around the member. Electrolyte is pumped between the electrodes and the member while electric current is applied. Programmed controls sequentially employ each of the two sets of contacts to expose all surfaces of the member to the electrolyte. The member is removed from the apparatus by an unloading arm.
The Acoustical Apparatus of Rudolph Koenig.
Greenslade, Thomas B., Jr.
1992-01-01
Discusses the history of Rudolph Koenig's contribution to the development of acoustical apparatus. Contributions include the clock fork to determine absolute acoustic frequencies, a forerunner of the oscilloscope called the manometric flame, and an acoustic interference apparatus used in the Fourier synthesis of musical sounds. (MDH)
BROACHING AND TUBE-INSTALLING APPARATUS
Frantz, C.E.; Cawley, W.E.
1961-05-16
An apparatus is given for sizing long holes in graphite bodies. The apparatus comprises a shaft having 3 spiral broach cutting elements and a straight broach cutting element rotatably mounted thereon. The broach cutting elements are keyed to each other in end to end relationship with the straight broach cutting element at one end of the shaft. The spiral broach cutting elements when considered toward the straight broach cutting element increase in diameter and the cutting teeth thereon increase in lead angle. The straight broach cutting element, when considered in the same direction, increases in diameter from the minimum to maximum diameters of the spiral broach cutting elements. No longitudinal movement of the broach cutting elements is permitted on the shsft snd means are provided for the removal of chips from the apparatus.
Directory of Open Access Journals (Sweden)
T.Handono Eko Prabowo
2014-08-01
Full Text Available This research attempts to provide performance measurement model for the consumer industry listed on Indonesia Stock Exchange (IDX by using the data envelopment analysis (DEA and the stochastic frontier analysis (SFA. There were 36 panel irms analyzed over the period of 2000-2005 or 216 pooled observations. The output variable was total sales and input variables were labor, inventory, ixed assets and capital. Z-variables are age of the irm, size of the irm, market share and time period. Empirical indings reveal that the average technical eficiency (mean TE for consumer industry was 0.6630. The study indicates the existence of output slacks (output deicits and input slacks (input wastages in the consumer industry's operation. The study also shows that the joint effect of four z-variables on the technical ineficiencies of the consumer industry was signiicant although the individual effects of one or more variables might not be statistically signiicant. ";} // -->activate javascript
Apparatus and method for nuclear magnetic resonance scanning and mapping
International Nuclear Information System (INIS)
Damadian, R.V.
1983-01-01
An improved apparatus and method is disclosed for analyzing the chemical and structural composition of a specimen including whole-body specimens which may include, for example, living mammals, utilizing nuclear magnetic resonance (NMR) techniques. A magnetic field space necessary to obtain an NMR signal characteristic of the chemical structure of the specimen is focused to provide a resonance domain of selectable size, which may then be moved in a pattern with respect to the specimen to scan the specimen
International Nuclear Information System (INIS)
Keats, A.B.
1981-01-01
An improved monitoring apparatus for use with process plants, such as nuclear reactors, is described. System failure in the acquisition of data from the plant, owing to stuck signals, is avoided by arranging input signals from transducers in the plant in a test pattern. (U.K.)
47 CFR 32.2311 - Station apparatus.
2010-10-01
... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.2311 Station apparatus... company shall prepare a list of station apparatus which shall be used as its list of disposition units for... technicians, and others, shall be included in Account 2114, Tools and other work equipment, Account 2220...
Retrograde Tibiopedal Access as a Bail-Out Procedure for Endovascular Intervention Complications
Directory of Open Access Journals (Sweden)
Ahmed Amro
2016-01-01
Full Text Available Introduction. Retrograde pedal access has been well described in the literature as a secondary approach for limb salvage in critical limb ischemia (CLI patients. In this manuscript we are presenting a case where retrograde tibiopedal access has been used as a bail-out procedure for the management of superficial femoral artery (SFA intervention complications. Procedure/Technique. After development of a perforation while trying to cross the totally occluded mid SFA using the conventional CFA access, we were able to cross the mid SFA lesion after accessing the posterior tibial artery in a retrograde fashion and delivered a self-expanding stent which created a flap that sealed the perforation without the need for covered stent. Conclusion. Retrograde tibiopedal access is a safe and effective approach for delivery of stents from the distal approach and so can be used as a bail-out technique for SFA perforation.
Technical note: CT-guided biopsy of lung masses using an automated guiding apparatus
International Nuclear Information System (INIS)
Chellathurai, Amarnath; Kanhirat, Saneej; Chokkappan, Kabilan; Swaminathan, Thiruchendur S; Kulasekaran, Nadhamuni
2009-01-01
Automated guiding apparatuses for CT-guided biopsies are now available. We report our experience with an indigenous system to guide lung biopsies. This system gave results similar to those with the manual technique. Automated planning also appears to be technically easier, it requires fewer number of needle passes, consumes less time, and requires fewer number of check scans
low-cost apparatus from locally available materials for teaching
African Journals Online (AJOL)
unesco
twofold: i) to design and produce appropriate low cost apparatus from locally .... How are the low-cost and manufactured apparatus compared in terms of cost and efficiency? ... BASIC TOOLS FOR THE LOW COST APPARATUS PRODUCTION.
Tomographic scanning apparatus
International Nuclear Information System (INIS)
1981-01-01
This patent specification relates to a tomographic scanning apparatus using a fan beam and digital output signal, and particularly to the design of the gas-pressurized ionization detection system. (U.K.)
International Nuclear Information System (INIS)
Elsner, H.J.
1981-01-01
The invention provides a calibration apparatus suitable for verifying the position and orientation of transducers used in reactor vessel ultrasonic inspection. The apparatus includes moveable mounting means which secures a transducer within the tank in its normal inspection orientation. A drive is also provided for moving the transducer in the tank relative to a target. The target is slidably positioned in the tank at a distance from the transducer which is selected to avoid the distortion effects in the near field of the transducer. The drive mechanism may be provided with graduated indicia of travel, or a scale may be affixed to the side of the tank. (L.L.)
CFT and RTD methods for wastewater treatment plants apparatus investigation
International Nuclear Information System (INIS)
Palige, J.; Owczarczyk, A.; Dobrowolski, A.; Ptaszek, S.
2006-01-01
Two methods, residence time distributions (RTD) and computational fluid dynamics (CFD) are most effective for solid and wastewater phases investigations of flow dynamics. On the basis of measured (in tracer experiment) RTD function, the model of flow can be proposed for the unit under investigation. The experimental and numerical RTD functions were compared for different technological parameters values of processes (apparatus geometry, flow rate, location and construction of input and output). Numerical RTD function was obtained by DRW (discrete random walk) technique - determination of residence times of many liquid particles. The usefulness of these techniques was checked on a large scale laboratory model of settler. Satisfactory agreement of the data obtained by both methods - tracer and CFD - was observed
Tomographic scanning apparatus
International Nuclear Information System (INIS)
1981-01-01
Details are presented of a tomographic scanning apparatus, its rotational assembly, and the control and circuit elements, with particular reference to the amplifier and multiplexing circuits enabling detector signal calibration. (U.K.)
Apparatus for washing out halogens
Energy Technology Data Exchange (ETDEWEB)
Pier, M; Hahn, J; Kroenig, W
1941-03-26
An apparatus is described for washing out of halogens and the like or liquid halogen compounds from the products, which are formed on pressure hydrogenation or splitting of carbon-containing material in the presence of halogens or halogen compounds, consisting of a washing apparatus installed between the reaction vessel and the hot separator, which is inclined in relatively small space for steam regulation and contains, with the steam, arranged baffles, especially spirals.
Method and apparatus for measuring underground fluid flow characteristics
International Nuclear Information System (INIS)
Paap, H.J.; Richter, A.P.; Peelman, H.E.; Arnold, D.M.; Scot, H.D.
1979-01-01
This invention relates to the use of neutron activation techniques to measure the azimuth and speed of the horizontal fluid flow in earth formations in the vicinity of a well borehole and the analysis of the resultant gamma radiation based on count rate data obtained as functions of horizontal direction and time. The apparatus consisting of a sonde (a downhole well logging tool) equipped with a neutron source, a gamma detector and a rotatable shield with collimator slot and the data processing equipment located at the surface, are described. (UK)
Tomographic scanning apparatus
International Nuclear Information System (INIS)
1981-01-01
Details are given of a tomographic scanning apparatus, with particular reference to a multiplexer slip ring means for receiving output from the detectors and enabling interfeed to the image reconstruction station. (U.K.)
WE-DE-201-08: Multi-Source Rotating Shield Brachytherapy Apparatus for Prostate Cancer
Energy Technology Data Exchange (ETDEWEB)
Dadkhah, H; Wu, X [University of Iowa, Iowa City, Iowa (United States); Kim, Y; Flynn, R [University of Iowa Hospitals and Clinics, Iowa City, IA (United States)
2016-06-15
Purpose: To introduce a novel multi-source rotating shield brachytherapy (RSBT) apparatus for the precise simultaneous angular and linear positioning of all partially-shielded 153Gd radiation sources in interstitial needles for treating prostate cancer. The mechanism is designed to lower the detrimental dose to healthy tissues, the urethra in particular, relative to conventional high-dose-rate brachytherapy (HDR-BT) techniques. Methods: Following needle implantation, the delivery system is docked to the patient template. Each needle is coupled to a multi-source afterloader catheter by a connector passing through a shaft. The shafts are rotated by translating a moving template between two stationary templates. Shaft walls as well as moving template holes are threaded such that the resistive friction produced between the two parts exerts enough force on the shafts to bring about the rotation. Rotation of the shaft is then transmitted to the shielded source via several keys. Thus, shaft angular position is fully correlated with the position of the moving template. The catheter angles are simultaneously incremented throughout treatment as needed, and only a single 360° rotation of all catheters is needed for a full treatment. For each rotation angle, source depth in each needle is controlled by a multi-source afterloader, which is proposed as an array of belt-driven linear actuators, each of which drives a source wire. Results: Optimized treatment plans based on Monte Carlo dose calculations demonstrated RSBT with the proposed apparatus reduced urethral D{sub 1cc} below that of conventional HDR-BT by 35% for urethral dose gradient volume within 3 mm of the urethra surface. Treatment time to deliver 20 Gy with multi-source RSBT apparatus using nineteen 62.4 GBq {sup 153}Gd sources is 117 min. Conclusions: The proposed RSBT delivery apparatus in conjunction with multiple nitinol catheter-mounted platinum-shielded {sup 153}Gd sources enables a mechanically feasible
Apparatus for filtering radioactive fluids
International Nuclear Information System (INIS)
Gischel, E.H.
1975-01-01
Apparatus is provided for filtering radioactive particles from the cooling and/or auxiliary process water of a nuclear reactor, or nuclear fuel processing plant, or other installations wherein radioactive fluid systems are known to exist. The apparatus affords disposal of the captured particles in a manner which minimizes the exposure of operating personnel to radioactivity. The apparatus comprises a housing adapted to contain a removable filter cartridge assembly, a valve normally closing the lower end of the housing, an upwardly-open shipping cask located below the valve, and an elongated operating rod assembly projecting upwardly from the filter cartridge assembly and through the upper end of the housing to enable a workman to dismount the filter cartridge assembly from its housing and to lower the filter cartridge assembly through the valve and into the cask from a remote location above the housing. (U.S.)
Matrix isolation sublimation: An apparatus for producing cryogenic beams of atoms and molecules
Energy Technology Data Exchange (ETDEWEB)
Sacramento, R. L.; Alves, B. X.; Silva, B. A.; Wolff, W.; Cesar, C. L. [Instituto de Física, Universidade Federal do Rio de Janeiro, Caixa Postal 68528, 21941-972 Rio de Janeiro, RJ (Brazil); Oliveira, A. N. [Instituto de Física, Universidade Federal do Rio de Janeiro, Caixa Postal 68528, 21941-972 Rio de Janeiro, RJ (Brazil); INMETRO, Av. Nossa Senhora das Graças, 50 25250-020 Duque de Caxias, RJ (Brazil); Li, M. S. [Instituto de Física de São Carlos, Universidade de São Paulo, Ave. Trabalhador São Carlense, 400, 13565-590 São Carlos, SP (Brazil)
2015-07-15
We describe the apparatus to generate cryogenic beams of atoms and molecules based on matrix isolation sublimation. Isolation matrices of Ne and H{sub 2} are hosts for atomic and molecular species which are sublimated into vacuum at cryogenic temperatures. The resulting cryogenic beams are used for high-resolution laser spectroscopy. The technique also aims at loading atomic and molecular traps.
Schlenk Techniques for Anionic Polymerization
Ratkanthwar, Kedar
2015-09-01
Anionic polymerization-high vacuum techniques (HVTs) are doubtlessly the most prominent and reliable experimental tools to prepare polymer samples with well-defined and, in many cases, complex macromolecular architectures. Due to the high demands for time and skilled technical personnel, HVTs are currently used in only a few research laboratories worldwide. Instead, most researchers in this filed are attracted to more facile Schlenk techniques. The basic principle of this technique followed in all laboratories is substantially the same, i.e. the use of alternate vacuum and inert gas atmosphere in glass apparatus for the purification/charging of monomer, solvents, additives, and for the manipulation of air-sensitive compounds such as alkyl metal initiators, organometallic or organic catalysts. However, it is executed quite differently in each research group in terms of the structure of Schlenk apparatus (manifolds, connections, purification/storage flasks, reactors, etc.), the use of small supplementary devices (soft tubing, cannulas, stopcocks, etc.) and experimental procedures. The operational methods are partly purpose-oriented while also featured by a high flexibility, which makes it impossible to describe in detail each specific one. In this chapter we will briefly exemplify the application of Schlenk techniques for anionic polymerization by describing the performance of a few experiments from our own work.
Process and apparatus for cracking petroleum, etc
Energy Technology Data Exchange (ETDEWEB)
1931-04-25
Process for catalytic cracking of petroleum and similar material at normal pressure, characterized by the oil vaporized in a vaporizer being treated in a first catalyst-chamber and in a separator attached to it, light constituents being separated, and then its being run into a second apparatus-group (vaporizer, catalyst-chamber, and separator), further groups following in series, whereby the catalyst works in a separate catalyst apparatus with ever-increasing activity time on the always lesser but always more difficult to crack material, so that in the whole apparatus a methodical cracking process is effected.
Apparatus for concentrating by dual temperature exchange
International Nuclear Information System (INIS)
Spevack, J.S.
1975-01-01
Improvements in an apparatus for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. The first fluid is a vaporizable liquid and the auxiliary fluid a gas, the apparatus having means for cascading the auxiliary fluid and the feed fluid in vapor and preferably also in liquid form. The apparatus also contains new combinations of means for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations of the system. The reactants in the example given are hydrogen sulfide gas and liquid water
Method and apparatus for producing microspherical particles
International Nuclear Information System (INIS)
Egli, W.; Bailey, W.H.; Leary, D.F.; Lansley, R.J.
1979-01-01
This invention relates generally to a method and apparatus for producing microspherical particles and more particularly to a method and apparatus which are particularly useful in connection with the sol-gel process for the production of nuclear fuel kernels. (U.K.)
Tomographic scanning apparatus
International Nuclear Information System (INIS)
1981-01-01
This patent specification describes a tomographic scanning apparatus, with particular reference to the adjustable fan beam and its collimator system, together with the facility for taking a conventional x-radiograph without moving the patient. (U.K.)
An apparatus for the determination of speeds of sound in fluids
International Nuclear Information System (INIS)
Gedanitz, Holger; Davila, Maria J.; Baumhoegger, Elmar; Span, Roland
2010-01-01
An apparatus for accurate measurements of the sound velocity in fluids is described, which is based on the pulse-echo technique, and operates up to 30 MPa in the temperature range between (250 and 350) K. The expanded uncertainties (k = 2) in the speed of sound measurements are 0.006%, 6 mK in the temperature, 2.1 hPa in the pressure up to 3 MPa, and 23.9 hPa above this value. Measurements of the speed of sound for nitrogen from (250 to 350) K and for water at temperatures between (303.15 and 323.15) K are presented at pressures up to 30 MPa to validate the new apparatus. The expanded overall uncertainty of the measurements on nitrogen and water were estimated to be 0.011% and 0.006%, respectively. The speed of sound of both fluids was compared with literature sources showing an excellent agreement among them, with relative deviations lower than 0.01% in nitrogen and 0.006% in water.
Two-dimensional heat flow apparatus
McDougall, Patrick; Ayars, Eric
2014-06-01
We have created an apparatus to quantitatively measure two-dimensional heat flow in a metal plate using a grid of temperature sensors read by a microcontroller. Real-time temperature data are collected from the microcontroller by a computer for comparison with a computational model of the heat equation. The microcontroller-based sensor array allows previously unavailable levels of precision at very low cost, and the combination of measurement and modeling makes for an excellent apparatus for the advanced undergraduate laboratory course.
Front lighted optical tooling method and apparatus
International Nuclear Information System (INIS)
Stone, W. J.
1985-01-01
An optical tooling method and apparatus uses a front lighted shadowgraphic technique to enhance visual contrast of reflected light. The apparatus includes an optical assembly including a fiducial mark, such as cross hairs, reflecting polarized light with a first polarization, a polarizing element backing the fiducial mark and a reflective surface backing the polarizing element for reflecting polarized light bypassing the fiducial mark and traveling through the polarizing element. The light reflected by the reflecting surface is directed through a second pass of the polarizing element toward the frontal direction with a polarization differing from the polarization of the light reflected by the fiducial mark. When used as a tooling target, the optical assembly may be mounted directly to a reference surface or may be secured in a mounting, such as a magnetic mounting. The optical assembly may also be mounted in a plane defining structure and used as a spherometer in conjunction with an optical depth measuring instrument. A method of measuring a radius of curvature of an unknown surface includes positioning the spherometer on a surface between the surface and a depth measuring optical instrument. As the spherometer is frontally illuminated, the distance from the depth measuring instrument to the fiducial mark and the underlying surface are alternately measured and the difference in these measurements is used as the sagittal height to calculate a radius of curvature
Lim, Chanoong; Park, Sohee; Park, Jinwoo; Ko, Jina; Lee, Dong Woog; Hwang, Dong Soo
2018-04-12
Various xenobiotics interact with biological membranes, and precise evaluations of the molecular interactions between them are essential to foresee the toxicity and bioavailability of existing or newly synthesized molecules. In this study, surface forces apparatus (SFA) measurement and Langmuir trough based tensiometry are performed to reveal nanomechanical interaction mechanisms between potential toxicants and biological membranes for ex vivo toxicity evaluation. As a toxicant, polyhexamethylene guanidine (PHMG) was selected because PHMG containing humidifier disinfectant and Vodka caused lots of victims in both S. Korea and Russia, respectively, due to the lack of holistic toxicity evaluation of PHMG. Here, we measured strong attraction (Wad ∼4.2 mJ/m 2 ) between PHMG and head group of biological membranes while no detectable adhesion force between the head group and control molecules was measured. Moreover, significant changes in π-A isotherm of 1,2-Dipalmitoyl-sn-glycero-3-phosphatidylcholine (DPPC) monolayers were measured upon PHMG adsorption. These results indicate PHMG strongly binds to hydrophilic group of lipid membranes and alters the structural and phase behavior of them. More importantly, complementary utilization of SFA and Langmuir trough techniques are found to be useful to predict the potential toxicity of a chemical by evaluating the molecular interaction with biological membranes, the primary protective barrier for living organisms. Copyright © 2018 Elsevier B.V. All rights reserved.
Optical fiber stripper positioning apparatus
Fyfe, Richard W.; Sanchez, Jr., Amadeo
1990-01-01
An optical fiber positioning apparatus for an optical fiber stripping device is disclosed which is capable of providing precise axial alignment between an optical fiber to be stripped of its outer jacket and the cutting blades of a stripping device. The apparatus includes a first bore having a width approximately equal to the diameter of an unstripped optical fiber and a counter bore axially aligned with the first bore and dimensioned to precisely receive a portion of the stripping device in axial alignment with notched cutting blades within the stripping device to thereby axially align the notched cutting blades of the stripping device with the axis of the optical fiber to permit the notched cutting blades to sever the jacket on the optical fiber without damaging the cladding on the optical fiber. In a preferred embodiment, the apparatus further includes a fiber stop which permits determination of the length of jacket to be removed from the optical fiber.
The Conservation Ideological State Apparatus
Directory of Open Access Journals (Sweden)
Jared D Margulies
2018-01-01
Full Text Available This article considers Louis Althusser's theory of the ideological state apparatuses (ISAs for advancing political ecology scholarship on the functioning of the state in violent environments. I reflect on a series of events in which a state forest department in South India attempted to recast violent conflicts between themselves and local communities over access to natural resources and a protected area as a debate over human-wildlife conflicts. Through the example of conservation as ideology in Wayanad, Kerala, I show how the ISAs articulate the functioning of ideology within the state apparatuses in order for us to understand the larger mechanics of the state apparatus and the reproduction of the relations of production necessary for the reproduction of capitalism. Revisiting the ISAs as a theoretical framework for studies in political ecology and conservation is timely given the resurgence of militarised conservation tactics, the emancipatory aims of Althusser's theory, and political ecology's turn towards praxis.
The Apparatus of Digital Archaeology
Directory of Open Access Journals (Sweden)
Jeremy Huggett
2017-06-01
Full Text Available Digital Archaeology is predicated upon an ever-changing set of apparatuses – technological, methodological, software, hardware, material, immaterial – which in their own ways and to varying degrees shape the nature of Digital Archaeology. Our attention, however, is perhaps inevitably more closely focused on research questions, choice of data, and the kinds of analyses and outputs. In the process we tend to overlook the effects the tools themselves have on the archaeology we do beyond the immediate consequences of the digital. This article introduces cognitive artefacts as a means of addressing the apparatus more directly within the context of the developing archaeological digital ecosystem. It argues that a critical appreciation of our computational cognitive artefacts is key to understanding their effects on both our own cognition and on the creation of archaeological knowledge. In the process, it defines a form of cognitive digital archaeology in terms of four distinct methods for extracting cognition from the digital apparatus layer by layer.
Scintillation counting apparatus
International Nuclear Information System (INIS)
Noakes, J.E.
1978-01-01
Apparatus is described for the accurate measurement of radiation by means of scintillation counters and in particular for the liquid scintillation counting of both soft beta radiation and gamma radiation. Full constructional and operating details are given. (UK)
Schiffer, A.; Gardner, M. N.; Lynn, R. H.; Tagarielli, V. L.
2017-03-01
Experiments were conducted on an aqueous growth medium containing cultures of Escherichia coli (E. coli) XL1-Blue, to investigate, in a single experiment, the effect of two types of dynamic mechanical loading on cellular integrity. A bespoke shock tube was used to subject separate portions of a planktonic bacterial culture to two different loading sequences: (i) shock compression followed by cavitation, and (ii) shock compression followed by spray. The apparatus allows the generation of an adjustable loading shock wave of magnitude up to 300 MPa in a sterile laboratory environment. Cultures of E. coli were tested with this apparatus and the spread-plate technique was used to measure the survivability after mechanical loading. The loading sequence (ii) gave higher mortality than (i), suggesting that the bacteria are more vulnerable to shear deformation and cavitation than to hydrostatic compression. We present the results of preliminary experiments and suggestions for further experimental work; we discuss the potential applications of this technique to sterilize large volumes of fluid samples.
Directory of Open Access Journals (Sweden)
mohsen mirzaee
2017-02-01
Full Text Available Introduction: Urinary tract infection (UTI caused by E coli is one of the most common diseases in community. Colonization of E. coli and its attachment to the uroepithelium are mediated by adhesions such as P, Fim and S fimbriae. The present study was aimed to evaluate the prevalence of fimbrial virulence genes in Escherichia coli (E. coli isolates from the patients with urinary tract infection in Tehran, Boroujerd and Sanandaj cities, Iran. Methods: In this descriptive cross sectional study, 150 clinical isolates of uropathogenic E.coli were collected from the patients with urinary tract infection. All bacterial isolates were identified by standard biochemical laboratory methods; the fim, pap and sfa genes were detected using the PCR and Multiplex-PCR methods. Results: One hundred forty-five (96.66% isolates were positive for fim gene, one hundred forty (93.33% isolates were positive for pap gene and seven (4.66 isolates were positive for sfa gene. Whole of the isolates were possessed at least one of the three virulence genes. Six (4% isolates were positive for all genes. Conclusion: The findings of this study showed the high frequency of fim and P fimbriae among uropathogenic E.coli isolates from the patients with urinary tract infection. Because of the higher prevalence of UTI in the presence of these genes, detection of the genes in urine samples may help in more suspicious and rapid management of UTI.
Smith, C.M.
1993-10-12
The present invention relates to an apparatus for handling a workpiece comprising a vessel that is longitudinally extensible and pressurizable, and a nonextensible and laterally flexible member on the vessel. The member constrains one side of the vessel to be nonextensible, causing the vessel to bend in the direction of the nonextensible member when pressurized. 8 figures.
Crary, Michael A; Carnaby, Giselle D; Sia, Isaac
2014-09-01
The aim of this study was to compare spontaneous swallow frequency analysis (SFA) with clinical screening protocols for identification of dysphagia in acute stroke. In all, 62 patients with acute stroke were evaluated for spontaneous swallow frequency rates using a validated acoustic analysis technique. Independent of SFA, these same patients received a routine nurse-administered clinical dysphagia screening as part of standard stroke care. Both screening tools were compared against a validated clinical assessment of dysphagia for acute stroke. In addition, psychometric properties of SFA were compared against published, validated clinical screening protocols. Spontaneous SFA differentiates patients with versus without dysphagia after acute stroke. Using a previously identified cut point based on swallows per minute, spontaneous SFA demonstrated superior ability to identify dysphagia cases compared with a nurse-administered clinical screening tool. In addition, spontaneous SFA demonstrated equal or superior psychometric properties to 4 validated, published clinical dysphagia screening tools. Spontaneous SFA has high potential to identify dysphagia in acute stroke with psychometric properties equal or superior to clinical screening protocols. Copyright © 2014 National Stroke Association. Published by Elsevier Inc. All rights reserved.
A Simple Apparatus for Fast Ion Exchange Separations
Energy Technology Data Exchange (ETDEWEB)
Samsahl, K
1964-09-15
An apparatus suitable for very fast ion exchange group separations in radiochemistry has been elaborated. The apparatus which consists of a system of glass tubes with pistons driven by the same force, allows the exact adjustment of influent solutions to a long series of ion-exchange columns. The practical application of the apparatus to the simultaneous separation of six groups of trace elements in the neutron activation analysis of biological material is described.
A Simple Apparatus for Fast Ion Exchange Separations
International Nuclear Information System (INIS)
Samsahl, K.
1964-09-01
An apparatus suitable for very fast ion exchange group separations in radiochemistry has been elaborated. The apparatus which consists of a system of glass tubes with pistons driven by the same force, allows the exact adjustment of influent solutions to a long series of ion-exchange columns. The practical application of the apparatus to the simultaneous separation of six groups of trace elements in the neutron activation analysis of biological material is described
SCANNING AND TRACKING MONITORING APPARATUS AND METHOD
DEFF Research Database (Denmark)
2017-01-01
Disclosed is a scanning monitoring apparatus for medical imaging, the scanning monitoring apparatus comprising a controller unit and a display, wherein the controller unit during a scanning session is configured to obtain tracking data (102) of a subject in a medical scanner, obtain scanner data ...
Apparatus for blending small particles
International Nuclear Information System (INIS)
Bradley, R.A.; Reese, C.R.; Sease, J.D.
1975-01-01
An apparatus is described for blending small particles and uniformly loading the blended particles in a receptacle. Measured volumes of various particles are simultaneously fed into a funnel to accomplish radial blending and then directed onto the apex of a conical splitter which collects the blended particles in a multiplicity of equal subvolumes. Thereafter the apparatus sequentially discharges the subvolumes for loading in a receptacle. A system for blending nuclear fuel particles and loading them into fuel rod molds is described in a preferred embodiment
Driven dynamics of simplified tribological models
International Nuclear Information System (INIS)
Vanossi, A; Braun, O M
2007-01-01
Over the last decade, remarkable developments in nanotechnology, notably the use of atomic and friction force microscopes (AFM/FFM), the surface-force apparatus (SFA) and the quartz-crystal microbalance (QCM), have provided the possibility to build experimental devices able to perform analysis on well-characterized materials at the nano- and microscale. Simultaneously, tremendous advances in computing hardware and methodology (molecular dynamics techniques and ab initio calculations) have dramatically increased the ability of theoreticians to simulate tribological processes, supplying very detailed information on the atomic scale for realistic sliding systems. This acceleration in experiments and computations, leading often to very detailed yet complex data, has deeply stimulated the search, rediscovery and implementation of simpler mathematical models such as the generalized Frenkel-Kontorova and Tomlinson models, capable of describing and interpreting, in a more immediate way, the essential physics involved in nonlinear sliding phenomena
Driven dynamics of simplified tribological models
Energy Technology Data Exchange (ETDEWEB)
Vanossi, A [CNR-INFM National Research Center S3 and Department of Physics, University of Modena and Reggio Emilia, Via Campi 213/A, 41100 Modena (Italy); Braun, O M [Institute of Physics, National Academy of Sciences of Ukraine, 03028 Kiev (Ukraine)
2007-08-01
Over the last decade, remarkable developments in nanotechnology, notably the use of atomic and friction force microscopes (AFM/FFM), the surface-force apparatus (SFA) and the quartz-crystal microbalance (QCM), have provided the possibility to build experimental devices able to perform analysis on well-characterized materials at the nano- and microscale. Simultaneously, tremendous advances in computing hardware and methodology (molecular dynamics techniques and ab initio calculations) have dramatically increased the ability of theoreticians to simulate tribological processes, supplying very detailed information on the atomic scale for realistic sliding systems. This acceleration in experiments and computations, leading often to very detailed yet complex data, has deeply stimulated the search, rediscovery and implementation of simpler mathematical models such as the generalized Frenkel-Kontorova and Tomlinson models, capable of describing and interpreting, in a more immediate way, the essential physics involved in nonlinear sliding phenomena.
Method of magnetic separation and apparatus therefore
Oder, Robin R. (Inventor)
1991-01-01
An apparatus for magnetically separating and collecting particulate matter fractions of a raw sample according to relative magnetic susceptibilities of each fraction so collected is disclosed. The separation apparatus includes a splitter which is used in conjunction with a magnetic separator for achieving the desired fractionation.
Assembly and handling apparatus for the EBFA Marx generator
International Nuclear Information System (INIS)
Staller, G.E.; Hiett, G.E.; Hamilton, I.D.; Aker, M.F.; Daniels, G.A.
1979-05-01
Marx generators, a major slow-pulsed power component in Sandia Laboratories' Electron Beam Fusion Accelerator (EBFA), were assembled at a remote facility modified to utilize an assembly-line technique. Due to the size and weight of the various components, as well as the final Marx generator assembly, special handling apparatus was designed. Time and manpower constraints required that this assembly be done in parallel with the construction of the Electron Beam Fusion Facility (EBFF). The completed Marx generators were temporarily stored and then moved from the assembly building to the EBFF using special transportation racks designed specifically for this purpose
Superconducting magnetic shielding apparatus and method
Clem, John R.; Clem, John R.
1983-01-01
Disclosed is a method and apparatus for providing magnetic shielding around a working volume. The apparatus includes a hollow elongated superconducting shell or cylinder having an elongated low magnetic pinning central portion, and two high magnetic pinning end regions. Transition portions of varying magnetic pinning properties are interposed between the central and end portions. The apparatus further includes a solenoid substantially coextensive with and overlying the superconducting cylinder, so as to be magnetically coupled therewith. The method includes the steps passing a longitudinally directed current through the superconducting cylinder so as to depin magnetic reservoirs trapped in the cylinder. Next, a circumferentially directed current is passed through the cylinder, while a longitudinally directed current is maintained. Depinned magnetic reservoirs are moved to the end portions of the cylinder, where they are trapped.
Superconducting magnetic shielding apparatus and method
Clem, J.R.
1982-07-09
Disclosed is a method and apparatus for providing magnetic shielding around a working volume. The apparatus includes a hollow elongated superconducting shell or cylinder having an elongated low magnetic pinning central portion, and two high magnetic pinning end regions. Transition portions of varying magnetic pinning properties are interposed between the central and end portions. The apparatus further includes a solenoid substantially coextensive with and overlying the superconducting cylinder, so as to be magnetically coupled therewith. The method includes the steps passing a longitudinally directed current through the superconducting cylinder so as to depin magnetic reservoirs trapped in the cylinder. Next, a circumferentially directed current is passed through the cylinder, while a longitudinally directed current is maintained. Depinned magnetic reservoirs are moved to the end portions of the cylinder, where they are trapped.
International Nuclear Information System (INIS)
Chase, R.R.P.; Tisue, G.T.
1975-01-01
A unique laboratory apparatus has been designed, constructed, and tested for analyzing the low Reynolds number hydrodynamic behavior of water-borne particulates. The system consists of an isothermal sedimentation chamber, collimated light sources, photographic optics, and monitoring devices. This apparatus is capable of providing dynamic information on water-borne particulates in the size range 2 μm to 700 μm, while simulating a realistic environment. Because of its flexibility, the equipment is being used to determine the kinematic behavior of gravitationally unstable organic mineral aggregates. The importance of organic mineral aggregates has been well established during the past decade. This material is believed to be a potential food source for marine biota at the lowest levels of the food chain. Organic mineral aggregates are also known to concentrate trace elements and other toxic substances and may be part of the control mechanism by which elemental concentrations are maintained in the water column. The benthic fluid mud layer and deep pelagic nepholoid layer consist, in part, of these sediments. Subsea petroleum reserves are thought to be the result of biogeochemical cycling of the organic-mineral complex. Undoubtedly, a fundamental study of these aggregates would be of value to many research interests
Radiation therapy apparatus having retractable beam stopper
International Nuclear Information System (INIS)
Coad, G.L.
1983-01-01
This invention relates to a radiation therapy apparatus which utilized a linear translation mechanism for positioning a beam stopper. An apparatus is described wherein the beam stopper is pivotally attached to the therapy machine with an associated drive motor in such a way that the beam stopper retracts linearly
Apparatus for separating solids from a liquid
Rem, P.C.; Berkhout, S.P.M.
2007-01-01
The invention relates to an apparatus and a method for separating a material stream consisting of several materials. The materials to be separated have different densities or density ranges, so that the material of the highest density can be discharged through a screen of the apparatus, while the
Development and application of PIE apparatuses for high-burnup LWR fuels
International Nuclear Information System (INIS)
Harada, Katsuya; Mita, Naoaki; Nishino, Yasuharu; Amano, Hidetoshi
1999-01-01
The Reactor Fuel Examination Facility (RFEF) is developing the following post irradiation examination apparatuses: Ion Microprobe mass analyzer (IMA), Pellet Thermal Capacity measuring apparatus (PTC), Micro Density Measuring apparatus MDM, Shield-type Field Emission Scanning Electron Microscope (FE-SEM). The present paper mainly describes several technical topics of these apparatuses. (author)
Apparatus for controlling fluidized beds
Rehmat, A.G.; Patel, J.G.
1987-05-12
An apparatus and process are disclosed for control and maintenance of fluidized beds under non-steady state conditions. An ash removal conduit is provided for removing solid particulates from a fluidized bed separate from an ash discharge conduit in the lower portion of the grate supporting such a bed. The apparatus and process of this invention is particularly suitable for use in ash agglomerating fluidized beds and provides control of the fluidized bed before ash agglomeration is initiated and during upset conditions resulting in stable, sinter-free fluidized bed maintenance. 2 figs.
Apparatus and method for radiation processing of materials
International Nuclear Information System (INIS)
Neuberg, W.B.; Luniewski, R.
1983-01-01
A method and apparatus for radiation degradation processing of polytetrafluoroethylene makes use of a simultaneous irradiation, agitation and cooling. The apparatus is designed to make efficent use of radiation in the processing. (author)
International Nuclear Information System (INIS)
Forneris, J.L.; Hicks, W.W.; Keller, J.H.; McKenna, C.M.; Siermarco, J.A.; Mueller, W.F.
1981-01-01
The invention relates to ion bombardment or implantation apparatus. It comprises an apparatus for bombarding a target with a beam of ions, including an arrangement for measuring the ion beam current and controlling the surface potential of the target. This comprises a Faraday cage formed, at least in part, by the target and by walls adjacent to, and electrically insulated from, the target and surrounding the beam. There is at least one electron source for supplying electrons to the interior of the Faraday cage and means within the cage for blocking direct rectilinear radiation from the source to the target. The target current is measured and combined with the wall currents to provide a measurement of the ion beam current. The quantity of electrons supplied to the interior of the cage can be varied to control the target current and thereby the target surface potential. (U.K.)
Report upon inquiry into radiation apparatus
International Nuclear Information System (INIS)
1984-10-01
In this report the committee has provided its assessment of the need and justification for the law to provide for the control of the provision of radiation apparatus, the planning needs for the provision of diagnostic and therapeutic facilities, the location of such facilities, the appropriateness or otherwise of existing legislation, the necessity for any further legislative needs and the criteria governing the provision of such radiation apparatus
Apparatus and method for gelling liquefied gasses
Elliott, Adam (Inventor); DiSalvo, Roberto (Inventor); Shepherd, Phillip (Inventor); Kosier, Ryan (Inventor)
2011-01-01
A method and apparatus for gelling liquid propane and other liquefied gasses includes a temperature controlled churn mixer, vacuum pump, liquefied gas transfer tank, and means for measuring amount of material entering the mixer. The apparatus and method are particularly useful for the production of high quality rocket fuels and propellants.
Apparatus Named after Our Academic Ancestors, III
Greenslade, Thomas B., Jr.
2014-01-01
My academic ancestors in physics have called on me once more to tell you about the apparatus that they devised, and that many of you have used in your demonstrations and labs. This article is about apparatus named after François Arago, Heinrich Helmholtz, Leon Foucault, and James Watt.
Wiederholt, Erwin
1983-01-01
DTA is a technique in which the temperature difference between sample/reference is measured as a function of temperature, while both are subject to a controlled temperature program. Use of a simple DTA-apparatus in demonstrating catalytic effects of manganese dioxide and aluminum oxide on decomposition temperature of potassium chlorate is…
Apparatuses, Systems and Methods for Cleaning Photovoltaic Devices
Eitelhuber, Georg
2013-01-01
Embodiments of solar panel cleaning apparatuses, solar panel cleaning systems, and solar panel cleaning methods are disclosed. In certain embodiments, the disclosed solar panel cleaning apparatuses, systems and methods do may not require any water
Metering apparatus and tariffs for electricity supply
International Nuclear Information System (INIS)
1990-01-01
Conference papers presented cover system economies and tariff structure with papers on pricing of electricity and new metering technologies. Other topics reviewed include metering apparatus design, electronic metering apparatus and solid phase metering technology. Meter data retrieval, bulk supply metering, test equipment and maintenance, and legal requirements and standards are discussed. (author)
Apparatus bias and place conditioning with ethanol in mice.
Cunningham, Christopher L; Ferree, Nikole K; Howard, MacKenzie A
2003-12-01
Although the distinction between "biased" and "unbiased" is generally recognized as an important methodological issue in place conditioning, previous studies have not adequately addressed the distinction between a biased/unbiased apparatus and a biased/unbiased stimulus assignment procedure. Moreover, a review of the recent literature indicates that many reports (70% of 76 papers published in 2001) fail to provide adequate information about apparatus bias. This issue is important because the mechanisms underlying a drug's effect in the place-conditioning procedure may differ depending on whether the apparatus is biased or unbiased. The present studies were designed to assess the impact of apparatus bias and stimulus assignment procedure on ethanol-induced place conditioning in mice (DBA/2 J). A secondary goal was to compare various dependent variables commonly used to index conditioned place preference. Apparatus bias was manipulated by varying the combination of tactile (floor) cues available during preference tests. Experiment 1 used an unbiased apparatus in which the stimulus alternatives were equally preferred during a pre-test as indicated by the group average. Experiment 2 used a biased apparatus in which one of the stimuli was strongly preferred by most mice (mean % time on cue = 67%) during the pre-test. In both studies, the stimulus paired with drug (CS+) was assigned randomly (i.e., an "unbiased" stimulus assignment procedure). Experimental mice received four pairings of CS+ with ethanol (2 g/kg, i.p.) and four pairings of the alternative stimulus (CS-) with saline; control mice received saline on both types of trial. Each experiment concluded with a 60-min choice test. With the unbiased apparatus (experiment 1), significant place conditioning was obtained regardless of whether drug was paired with the subject's initially preferred or non-preferred stimulus. However, with the biased apparatus (experiment 2), place conditioning was apparent only when
Apparatus for carbonization of bituminous materials
Energy Technology Data Exchange (ETDEWEB)
Krupa, G
1924-08-25
Apparatus is described for carbonization of bituminous fuels and bituminous shale, in which the material to be carbonized slips continuously over sloping surfaces of a retort arranged in a zigzag and thereby it is exposed to a continuously increasing heating. The apparatus is characterized by the sloping surface being of a boxlike solid hearth with internal heating through which every hearth can be heated directly to a determined constant degree of heat.
Sartory, Walter K.; Eveleigh, John W.
1976-01-01
A method and apparatus for operating a continuous flow blood separation centrifuge are provided. The hematocrit of the entrant whole blood is continuously maintained at an optimum constant value by the addition of plasma to the entrant blood. The hematocrit of the separated red cells is monitored to indicate the degree of separation taking place, thereby providing a basis for regulating the flow through the centrifuge.
Apparatus for making an X-ray photograph of an object
International Nuclear Information System (INIS)
Yang, K.-H.; Gruenke, L.A.
1979-01-01
A method and apparatus are described for ion-valve radiography allowing a multiplicity of copies to be made responsive to a single radiographic exposure. Radiation, differentially-absorbed by passage through an object to be studied, enters an exposure chamber having a foraminate film or mesh structure surrounded by a high pressure gas or radio-conductive liquid of a type which converts the impingent radiation into electrostatic charge. The chamber is bounded by a pair of electrodes establishing electric fields therein to cause a charge image of the object to form upon an insulating layer contained upon the mesh structure. After exposure, the charge-image-bearing member is moved to a printing chamber and a charge image is deposited upon an insulative material sheet by ion flow techniques, for subsequent development by xerographic techniques. (Auth.)
Pin-on-disk apparatus for tribological studies of polymeric materials
DEFF Research Database (Denmark)
Ølholm Larsen, Thomas; Løgstrup Andersen, Tom; Thorning, Bent
2009-01-01
polymeric materials under dry-sliding conditions. The different main parts of the apparatus are described in a way which partly explains the choice of construction and partly makes it possible to produce a similar apparatus. Furthermore, a limited amount of tribological data is presented mainly to exemplify......The purpose of this paper is to describe the construction of a custom-built pin-on-disk (POD) apparatus based on a simple design and on important guidelines. The POD apparatus is built as a part of the main author's PhD project. The apparatus is built at a low cost and is suited for testing...... weave. The data presented in this paper are limited since the main objective is to describe the construction of a POD apparatus. The paper is intended to be a source of inspiration for industrial or academic laboratories who want to establish their own tailor-suited tribological test-equipment, instead...
Apparatuses, Systems and Methods for Cleaning Photovoltaic Devices
Eitelhuber, Georg
2013-02-14
Embodiments of solar panel cleaning apparatuses, solar panel cleaning systems, and solar panel cleaning methods are disclosed. In certain embodiments, the disclosed solar panel cleaning apparatuses, systems and methods do may not require any water or other cleaning liquids in the whole cleaning process, which makes them prominent well suited in for water-deficit environments such as deserts. In one embodiment, the solar panel cleaning apparatus comprises one or more rotatable brushes each having a rotational axis and a drive configured to move each of the one or more rotatable brushes in a direction that is not perpendicular to the rotational axis. The solar panel cleaning apparatus is may be configured such that the angle of the rotational axis of at least one of the one or more rotatable brushes is adjustable relative to the direction of travel.
Thermal Acoustic Fatigue Apparatus
Federal Laboratory Consortium — The Thermal Acoustic Fatigue Apparatus (TAFA) is a progressive wave tube test facility that is used to test structures for dynamic response and sonic fatigue due to...
International Nuclear Information System (INIS)
1980-01-01
Apparatus is described for loading a predetermined amount of nuclear fuel pellets into nuclear fuel elements and particularly for the automatic loading of fuel pellets from within a sealed compartment. (author)
Radiographic scanner apparatus
International Nuclear Information System (INIS)
Wake, R.H.
1980-01-01
The preferred embodiment of this invention includes a hardware system, or processing means, which operates faster than software. Moreover the computer needed is less expensive and smaller. Radiographic scanner apparatus is described for measuring the intensity of radiation after passage through a planar region and for reconstructing a representation of the attenuation of radiation by the medium. There is a source which can be rotated, and detectors, the output from which forms a data line. The detectors are disposed opposite the planar region from the source to produce a succession of data lines corresponding to the succession of angular orientations of the source. There is a convolver means for convolving each of these data lines, with a filter function, and a means of processing the convolved data lines to create the representation of the radiation attenuation in the planar region. There is also apparatus to generate a succession of data lines indicating radiation attenuation along a determinable path with convolver means. (U.K.)
International Nuclear Information System (INIS)
Imada, Takahiko; Sato, Hideo.
1975-01-01
Object: To provide a centripetal device, which has an initial spring force greater than a frictional force in an oscillating direction of a telescope mast, on a mast fixing device mounted on a body of fuel exchanging apparatus so that the telescope mast may be secured quickly returning to a predetermined initial position. Structure: When the body of fuel exchanging apparatus is stopped at a predetermined position, a tension spring, which has an initial spring force greater than a frictional force in an oscillating direction of the telescope mast, causes a lug to be forced by means of a push rod to position a sliding base plate to its original position. At the same time, a device of similar structure causes an operating arm to be positioned to the original position, and a lock pin urged by a cylinder is inserted into a through hole in the sliding base plate and operating arm so that the telescope mast may be fixed and retained. (Hanada, M.)
Model of Coupled Drives Apparatus – Static and Dynamic Characteristics
Directory of Open Access Journals (Sweden)
Chalupa Petr
2016-01-01
Full Text Available The paper presents an initial part of a modelling the Coupled Drives Apparatus CE108 developed by TecQuipment Ltd. The final model should be used in the process of control design for the apparatus. The model derived by the developers of the apparatus using first-principle modelling is used as a starting point for comparison of its properties with measured characteristics. The static and dynamic characteristics of the real-time apparatus are presented and discussed. Special attention is paid to principal differences between the model and the real-time apparatus. Real-time measurements are obtained using MATLAB / Simulink environment in connection with a Real-time Toolbox. Evaluation of the experiments is also performed in the MATLAB environment
Device for discharging drain in a control rod driving apparatus
International Nuclear Information System (INIS)
Ikeda, Tadasu; Ikuta, Takuzo; Yoshida, Tomiji; Tsukahara, Katsumi.
1975-01-01
Object: To efficiently and safely collect and discharge drain by a simple construction in which a drain cover and a drain tank in a control rod driving apparatus are integrally formed, and an overhauling wrench of said apparatus and a drain hose are mounted on the drain tank. Structure: When a mounting bolt is untightened by a torque wrench so as to be removed from a flange surface of the control rod driving apparatus in a nuclear reactor, axial movement of said apparatus is absorbed by a spring so that drain containing a radioactive material is discharged into a drain tank through the flange surface of said apparatus and is then guided into a collecting tank through a drain hose. (Kamimura, M.)
Testing of defects in Si semiconductor apparatus by using single-photon detection
International Nuclear Information System (INIS)
Zhongliang, Pan; Ling, Chen; Guangju, Chen
2013-01-01
The failure analysis of semiconductor apparatus is very needed for ensuring product quality, which can find several types of defects in the semiconductor apparatus. A new testing method for the defects in Si semiconductor apparatus is presented in this paper, the method makes use of photon emissions to find out the failure positions or failure components by taking advantage of the infrared photo emission characteristics of semiconductor apparatus. These emitted photons carry the information of the apparatus structure. If there are defects in the apparatus, these photons can help in understanding the apparatus properties and detecting the defects. An algorithm for the generation of circuit input vectors are presented in this paper to enhance the strength of the emitted photons for the given components in the semiconductor apparatus. The multiple-valued logic, the static timing analysis and path sensitizations, are used in the algorithm. A lot of experimental results for the Si semiconductor apparatus show that many types of defects such as contact spiking and latchup failure etc., can be detected accurately by the method proposed in this paper
Method and apparatus for dismantling mechanical anchors
Energy Technology Data Exchange (ETDEWEB)
Dubovskiy, Yu P; Chendev, F S; Gritsayuk, B I; Gubin, N I; Osipov, S P
1982-01-01
This apparatus is designed to reduce the amount of labor required to dismantle mechanical anchors while at the same time lowering expenditures for lumber. Longwall beams and timber skips are used to support the cap and any fractured rock faces. The apparatus itself has grooves, vertical guides, and a drive system to position the longwall beams.
Apparatus For Eddy-Current Inspection Of Bolts
Amos, Jay M.
1994-01-01
Eddy-current apparatus for inspection of bolts, studs, and other threaded fasteners detects flaws in threads, shanks, and head fillets. With help of apparatus, technician quickly inspects fasteners of various dimensions. Accommodates fasteners with diameters from 0.190 in. to 1 in. and with lengths up to 5 in. Basic design modified to accommodate fasteners of other sizes.
Applicability of two automated disintegration apparatuses for rapidly disintegrating (mini)tablets.
Sieber, Daniel; Lazzari, Alessia; Quodbach, Julian; Pein, Miriam
2017-03-01
Orally disintegrating (mini)tablets (OD(M)Ts) are of interest in the field of pharmaceutics. Their orodispersible character is defined by the disintegration time, which is measured with a basket apparatus according to the European Pharmacopoeia. This method, however, lacks applicability for ODTs and especially ODMTs. New disintegration apparatuses have been described in literature, but a qualification to assess the applicability has not been described. A qualification procedure for two automated disintegration apparatuses, OD-mate and Hermes apparatus, is introduced. Aspects of the operational qualification as well as precision and accuracy regarding a performance qualification were evaluated for both apparatuses analog to the ICH guideline Q2. While the OQ study is performed separately for each apparatus, accuracy and precision were performed following the same protocol for both testers. Small RSDs (16.9% OD-mate; 15.2% Hermes compared to 32.3% for the pharmacopeial method) were found despite very fast disintegration times (1.5 s for both apparatuses). By comparing these RSDs to practical examples, the authors propose threshold values for repeatability depending on the mean disintegration time. Obtained results from the qualification were used to assess the applicability of both apparatuses.
A prototype splitter apparatus for dividing large catches of small fish
Stapanian, Martin A.; Edwards, William H.
2012-01-01
Due to financial and time constraints, it is often necessary in fisheries studies to divide large samples of fish and estimate total catch from the subsample. The subsampling procedure may involve potential human biases or may be difficult to perform in rough conditions. We present a prototype gravity-fed splitter apparatus for dividing large samples of small fish (30–100 mm TL). The apparatus features a tapered hopper with a sliding and removable shutter. The apparatus provides a comparatively stable platform for objectively obtaining subsamples, and it can be modified to accommodate different sizes of fish and different sample volumes. The apparatus is easy to build, inexpensive, and convenient to use in the field. To illustrate the performance of the apparatus, we divided three samples (total N = 2,000 fish) composed of four fish species. Our results indicated no significant bias in estimating either the number or proportion of each species from the subsample. Use of this apparatus or a similar apparatus can help to standardize subsampling procedures in large surveys of fish. The apparatus could be used for other applications that require dividing a large amount of material into one or more smaller subsamples.
Tomographic scanning apparatus
International Nuclear Information System (INIS)
1981-01-01
Details are given of a tomographic scanning apparatus, with particular reference to the means of adjusting the apparent gain of the signal processing means for receiving output signals from the detectors, to compensate for drift in the gain characteristics, including means for passing a reference signal. (U.K.)
LENUS (Irish Health Repository)
Strik, Caroline M
2010-05-24
Abstract Background High fat diets have long been associated with weight gain and obesity, and the weak satiety response elicited in response to dietary lipids is likely to play a role. Suppression of appetite and food intake has consistently been shown to be diminished with high fat relative to either high protein or carbohydrate meals. There is however some evidence that the satiating capacity of lipids may be modulated when physicochemical properties are altered, but studies investigating the effect of lipid saturation on appetite have generated inconsistent findings. This study investigated the effects of changes in fatty acid saturation on post-ingestive satiety and energy intake. Methods High-fat (HF) test breakfasts (2.0 MJ) containing 26 g lipid were given to 18 healthy, lean men in a 3 treatment randomised cross-over design, each treatment separated by a washout of at least 3 days. The breakfasts were high in saturated (SFA, 65% of total fat), polyunsaturated (PUFA, 76%) or monounsaturated (MUFA, 76%) fatty acids, and comprised 2 savoury muffins. Participants rated appetite sensations using visual analogue scales (VAS) to assess palatability immediately following the meals, and hunger and fullness prior to the HF breakfast and throughout the day. Energy intake was measured by covert weighing of a lunch meal which was served 3.5 h after the breakfast, and from which the participants ate ad libitum. Results There was no difference in VAS ratings of pleasantness, visual appearance, smell, taste, aftertaste and overall palatability between the 3 high-fat test breakfasts. However, there was also no differential effect of the 3 treatments on ratings of hunger, fullness, satisfaction or prospective food consumption during the 3.5 h following the breakfast meal and over the full 6 h experiment. Energy and macronutrient intake at lunch also did not differ between treatments (mean, sem; SFA: 5275.9 ± 286.5 kJ; PUFA: 5227.7 ± 403.9 kJ; MUFA: 5215.6 ± 329.5 kJ; P
Gray, C.F.; Thompson, R.H.
1958-09-23
An apparatus is described for casting small quantities of uranlum. It consists of a crucible having a hole in the bottom with a mold positioned below. A vertical rcd passes through the hole in the crucible and has at its upper end a piercing head adapted to break the oxide skin encasing a molten uranium body. An air tight cylinder surrounds the crucible and mold, and is arranged to be evacuated.
Directory of Open Access Journals (Sweden)
Darwanis Darwanis
2016-04-01
Full Text Available This research aims to: 1. Examine the influence of professionalism, competence, knowledge of financial management and intensity guidance apparatus Inspectorate together to the quality of the financial statements of Regions; 2. Examine the effect of professionalism partially on the quality of the financial statements of Regions; 3. Test the effect of partial competencies to the quality of the financial statements of Regions; 4. Examine the effect of knowledge of financial management partially on the quality of the financial statements of Regions; 5. The authorities test the effects of intensity guidance apparatus partially on the quality of the financial statements of Regions. The object of this research is the Government Internal Supervisory Apparatus (APIP working in the Inspectorate districts/cities in Aceh amounted to 23 people who perform inspection tasks. The source of data in this study uses primary data which is the result of the acquisition of questionnaires from survey respondent, while research data collection techniques are done with documentation techniques. The analytical method used is Multiple Linear Regression Analysis. The results showed that: 1. Professionalism, competence, knowledge of financial management and intensity guidance apparatus jointly affect the quality of financial reporting area. 2. Professionalism partially affects the quality of financial reporting area. 3. Competence partially affects the quality of financial reporting area. 4. Knowledge of financial management partially affects the quality of financial reporting area. 5. The intensity guidance apparatus partially affects the quality of financial reporting area.
APPARATUS FOR THE PRODUCTION OF LITHIUM METAL
Baker, P.S.; Duncan, F.R.; Greene, H.B.
1961-08-22
Methods and apparatus for the production of high-purity lithium from lithium halides are described. The apparatus is provided for continuously contacting a molten lithium halide with molten barium, thereby forming lithium metal and a barium halide, establishing separate layers of these reaction products and unreacted barium and lithium halide, and continuously withdrawing lithium and barium halide from the reaction zone. (AEC)
Joo, Peter H; Gao, Jinlong; Li, Zhongshan; Aldén, Marcus
2015-03-01
The design and features of a high pressure chamber and burner that is suitable for combustion experiments at elevated pressures are presented. The high pressure combustion apparatus utilizes a high pressure burner that is comprised of a chamber burner module and an easily accessible interchangeable burner module to add to its flexibility. The burner is well suited to study both premixed and non-premixed flames. The optical access to the chamber is provided through four viewports for direct visual observations and optical-based diagnostic techniques. Auxiliary features include numerous access ports and electrical connections and as a result, the combustion apparatus is also suitable to work with plasmas and liquid fuels. Images of methane flames at elevated pressures up to 25 atm and preliminary results of optical-based measurements demonstrate the suitability of the high pressure experimental apparatus for combustion experiments.
Apparatus to simulate nuclear heating in advanced fuels
International Nuclear Information System (INIS)
Wrona, B.J.; Galvin, T.M.; Johanson, E.
1976-10-01
A direct-electrical-heating apparatus has been built to simulate in-reactor temperature gradients and heating conditions in both the mixed nitrides and carbides of uranium and plutonium. The apparatus has the capability for the investigation and direct observation of fuel-behavior phenomena that should significantly enlarge the data base on mixed carbides and nitrides at temperatures near and above their melting points. In addition to heating UC, results of prooftests showed that the apparatus has the capability to heat graphite, 30 vol % ZrC in graphite, B 4 C control-rod pellets, and stainless steel
Lessons learned from nanoscale specimens tested by MEMS-based apparatus
Elhebeary, Mohamed; Saif, M. Taher A.
2017-06-01
The last two decades were marked by the innovative synthesis of nanomaterials and devices. The success of these devices hinges on the mechanical properties of nanomaterials and an understanding of their deformation and failure mechanisms. Many novel testing techniques have been developed to test materials at small scale. This paper reviews the state-of-the-art microelectromechanical systems (MEMS) apparatus developed to characterize materials at nanoscale, and the key insights gained on structure-property relations of materials through these characterizations. Finally, new applications of MEMS in testing living materials, such as tissues and cells, for disease diagnosis and prognosis are discussed.
Lessons learned from nanoscale specimens tested by MEMS-based apparatus
International Nuclear Information System (INIS)
Elhebeary, Mohamed; Saif, M Taher A
2017-01-01
The last two decades were marked by the innovative synthesis of nanomaterials and devices. The success of these devices hinges on the mechanical properties of nanomaterials and an understanding of their deformation and failure mechanisms. Many novel testing techniques have been developed to test materials at small scale. This paper reviews the state-of-the-art microelectromechanical systems (MEMS) apparatus developed to characterize materials at nanoscale, and the key insights gained on structure-property relations of materials through these characterizations. Finally, new applications of MEMS in testing living materials, such as tissues and cells, for disease diagnosis and prognosis are discussed. (topical review)
Directory of Open Access Journals (Sweden)
Joanna Wojtasik-Bakalarz
2017-03-01
Full Text Available Introduction : Fifty percent of cases of peripheral artery disease are caused by chronic total occlusion (CTO of the superficial femoral artery (SFA. Ten–fifteen percent of percutaneous SFA recanalization procedures are unsuccessful. In those cases the retrograde technique can increase the success rate of the procedure, but the long-term follow-up of such procedures is still unknown. Aim : To assess the efficacy and clinical outcomes during long-term follow-up after retrograde recanalization of the SFA. Material and methods: We included patients after at least one unsuccessful percutaneous antegrade recanalization of the SFA. Patients were evaluated for the procedural and clinical follow-up of mean time 13.9 months. Results: The study included 17 patients (7 females, 10 males who underwent percutaneous retrograde recanalization of the SFA from June 2011 to June 2015. The mean age of patients was 63 ±7 years. Retrograde puncture of the distal SFA was successful in all cases. A retrograde procedure was performed immediately after antegrade failure in 4 (23.5% patients and after a previously failed attempt in 13 (76.5% patients. The procedure was successful in 15 (88.2% patients, and unsuccessful in 2 (11.8% patients. Periprocedural complications included 1 peripheral distal embolization (successfully treated with aspiration thrombectomy, 1 bleeding event from the puncture site and 7 puncture site hematomas. During follow-up the all-cause mortality rate was 5.8% (1 patient, non-cardiac death. The primary patency rate at 12 months was 88.2% and secondary patency 100%. Conclusions : The retrograde SFA puncture seems to be a safe and successful technique for CTO recanalization and is associated with a low rate of perioperative and long-term follow-up complications.
Apparatus for the measurement of density-thickness by use of radiation
International Nuclear Information System (INIS)
Buchnea, A.
1983-01-01
The invention is used in on-line apparatus for continuously monitoring a property of a moving length of materials in which a source of radiation and a detector are mounted in spaced relationship at an on-line location at which the moving length is permitted to pass between the source and the detector. The invention involves an apparatus for calibrating the monitoring apparatus without moving the monitoring apparatus from the on-line location
Apparatus for control of mercury
Downs, William; Bailey, Ralph T.
2001-01-01
A method and apparatus for reducing mercury in industrial gases such as the flue gas produced by the combustion of fossil fuels such as coal adds hydrogen sulfide to the flue gas in or just before a scrubber of the industrial process which contains the wet scrubber. The method and apparatus of the present invention is applicable to installations employing either wet or dry scrubber flue gas desulfurization systems. The present invention uses kraft green liquor as a source for hydrogen sulfide and/or the injection of mineral acids into the green liquor to release vaporous hydrogen sulfide in order to form mercury sulfide solids.
Uranium dioxide calcining apparatus and method
International Nuclear Information System (INIS)
Cole, E.A.; Peterson, R.S.
1978-01-01
This invention relates to an improved continuous calcining apparatus for consistently and controllably producing from calcinable reactive solid compounds of uranium, such as ammonium diuranate, uranium dioxide (UO 2 ) having an oxygen to uranium ratio of less than 2.2. The apparatus comprises means at the outlet end of a calciner kiln for receiving hot UO 2 , means for cooling the UO 2 to a temperature of below 100 0 C and conveying the cooled UO 2 to storage or to subsequent UO 2 processing apparatus where it finally comes into contact with air, the means for receiving, cooling and conveying being sealed to the outlet end of the calciner and being maintained full of UO 2 and so operable as to exclude atmospheric oxygen from coming into contact with any UO 2 which is at elevated temperatures where it would readily oxidize, without the use of extra hydrogen gas in said means
Nuclear magnetic resonance method and apparatus
International Nuclear Information System (INIS)
Burl, M.; Young, I.R.
1984-01-01
A method and apparatus for determining the rate of flow of a liquid in a selected region of a body by nuclear magnetic resonance techniques are described. The method includes a sequence of applying a first magnetic pulse effective to excite nuclear magnetic resonance of a chosen nucleus within the liquid preferentially in a slice of the body which includes the selected region. A period of time (tsub(D)) is waited and then a second magnetic pulse is applied which is effective to excite nuclear magnetic resonance of the nuclei preferentially in the slice, and the free induction decay signal is measured. The whole sequence is repeated for different values of the period of time (tsub(D)). The variation in the value of the measured signal with tsub(D) is then related to the rate of flow of the liquid through the slice. (author)
Superconducting magnetic energy storage apparatus structural support system
Withers, Gregory J.; Meier, Stephen W.; Walter, Robert J.; Child, Michael D.; DeGraaf, Douglas W.
1992-01-01
A superconducting magnetic energy storage apparatus comprising a cylindrical superconducting coil; a cylindrical coil containment vessel enclosing the coil and adapted to hold a liquid, such as liquefied helium; and a cylindrical vacuum vessel enclosing the coil containment vessel and located in a restraining structure having inner and outer circumferential walls and a floor; the apparatus being provided with horizontal compression members between (1) the coil and the coil containment vessel and (2) between the coil containment vessel and the vacuum vessel, compression bearing members between the vacuum vessel and the restraining structure inner and outer walls, vertical support members (1) between the coil bottom and the coil containment vessel bottom and (2) between the coil containment vessel bottom and the vacuum vessel bottom, and external supports between the vacuum vessel bottom and the restraining structure floor, whereby the loads developed by thermal and magnetic energy changes in the apparatus can be accommodated and the structural integrity of the apparatus be maintained.
Pulsed wire discharge apparatus for mass production of copper nanopowders.
Suematsu, H; Nishimura, S; Murai, K; Hayashi, Y; Suzuki, T; Nakayama, T; Jiang, W; Yamazaki, A; Seki, K; Niihara, K
2007-05-01
A pulsed wire discharge (PWD) apparatus for the mass production of nanopowders has been developed. The apparatus has a continuous wire feeder, which is operated in synchronization with a discharging circuit. The apparatus is designed for operation at a maximum repetition rate of 1.4 Hz at a stored energy of 160 J. In the present study, Cu nanopowder was synthesized using the PWD apparatus and the performance of the apparatus was examined. Cu nanopowder of 2.0 g quantity was prepared in N(2) gas at 100 kPa for 90 s. The particle size distribution of the Cu nanopowder was analyzed by transmission electron microscopy and the mean surface diameter was determined to be 65 nm. The ratio of the production mass of the powder to input energy was 362 g/kW h.
Detection of corrosion by a radiometric technique
International Nuclear Information System (INIS)
Charlton, J.S.; Ross, J.F.
1975-01-01
A method is described for the detection and measurement of corrosion in metal tube bundles using a radioisotope technique. The method is stated to be accurate and quick, and dismantling is unnecessary. A radioactive source is inserted into one of the tubes of the bundle and radiation detectors are inserted into the remainder of the tubes, which may be up to six in number with the apparatus described. The radiation absorption by the walls of each pair of tubes is compared with a standard measurement representing a known thickness of the material of the tubes. Simultaneous measurements may be made. Suitable apparatus is described in detail. (U.K.)
Apparatus, System, And Method For Roadway Monitoring
Claudel, Christian G.
2015-06-02
An apparatus, system, and method for monitoring traffic and roadway water conditions. Traffic flow and roadway flooding is monitored concurrently through a wireless sensor network. The apparatus and system comprises ultrasound rangefinders monitoring traffic flow, flood water conditions, or both. Routing information may be calculated from the traffic conditions, such that routes are calculated to avoid roadways that are impassable or are slow due to traffic conditions.
Apparatus, System, And Method For Roadway Monitoring
Claudel, Christian G.
2015-01-01
An apparatus, system, and method for monitoring traffic and roadway water conditions. Traffic flow and roadway flooding is monitored concurrently through a wireless sensor network. The apparatus and system comprises ultrasound rangefinders monitoring traffic flow, flood water conditions, or both. Routing information may be calculated from the traffic conditions, such that routes are calculated to avoid roadways that are impassable or are slow due to traffic conditions.
Grinding assembly, grinding apparatus, weld joint defect repair system, and methods
Larsen, Eric D.; Watkins, Arthur D.; Bitsoi, Rodney J.; Pace, David P.
2005-09-27
A grinding assembly for grinding a weld joint of a workpiece includes a grinder apparatus, a grinder apparatus includes a grinding wheel configured to grind the weld joint, a member configured to receive the grinding wheel, the member being configured to be removably attached to the grinder apparatus, and a sensor assembly configured to detect a contact between the grinding wheel and the workpiece. The grinding assembly also includes a processing circuitry in communication with the grinder apparatus and configured to control operations of the grinder apparatus, the processing circuitry configured to receive weld defect information of the weld joint from an inspection assembly to create a contour grinding profile to grind the weld joint in a predetermined shape based on the received weld defect information, and a manipulator having an end configured to carry the grinder apparatus, the manipulator further configured to operate in multiple dimensions.
System, methods and apparatus for program optimization for multi-threaded processor architectures
Bastoul, Cedric; Lethin, Richard A; Leung, Allen K; Meister, Benoit J; Szilagyi, Peter; Vasilache, Nicolas T; Wohlford, David E
2015-01-06
Methods, apparatus and computer software product for source code optimization are provided. In an exemplary embodiment, a first custom computing apparatus is used to optimize the execution of source code on a second computing apparatus. In this embodiment, the first custom computing apparatus contains a memory, a storage medium and at least one processor with at least one multi-stage execution unit. The second computing apparatus contains at least two multi-stage execution units that allow for parallel execution of tasks. The first custom computing apparatus optimizes the code for parallelism, locality of operations and contiguity of memory accesses on the second computing apparatus. This Abstract is provided for the sole purpose of complying with the Abstract requirement rules. This Abstract is submitted with the explicit understanding that it will not be used to interpret or to limit the scope or the meaning of the claims.
Article separation apparatus and method for unit operations
Pardini, Allan F.; Gervais, Kevin L.; Mathews, Royce A.; Hockey, Ronald L.
2010-06-22
An apparatus and method are disclosed for separating articles from a group of articles. The apparatus includes a container for containing one or more articles coupled to a suitable fluidizer for suspending articles within the container and transporting articles to an induction tube. A portal in the induction tube introduces articles singly into the induction tube. A vacuum pulls articles through the induction tube separating the articles from the group of articles in the container. The apparatus and method can be combined with one or more unit operations or modules, e.g., for inspecting articles, assessing quality of articles, or ascertaining material properties and/or parameters of articles, including layers thereof.
An apparatus for preparing isotopically pure He4
International Nuclear Information System (INIS)
McClintock, P.V.E.
1978-01-01
A cryostat has been constructed for extracting pure He 4 from He II of natural isotopic composition by means of a heat flush technique. It is shown that the method is in principle capable of yielding He 4 which is entirely devoid of He 3 isotopic impurities. A secondary heat flush, operated in conjunction with a conical heat exchanger of novel design, was used to place an experimental lower bound of 2 x 10 15 on the He 4 /He 3 ratio of the product, a standard sufficient for all present or projected applications requiring isotopically pure He 4 . The apparatus produces 2 000 1 (at standard temperature and pressure) of He 4 per thermal cycle. The design of future purifiers is discussed. (author)
Phase change thermal control materials, method and apparatus
Buckley, Theresa M. (Inventor)
2001-01-01
An apparatus and method for metabolic cooling and insulation of a user in a cold environment. In its preferred embodiment the apparatus is a highly flexible composite material having a flexible matrix containing a phase change thermal storage material. The apparatus can be made to heat or cool the body or to act as a thermal buffer to protect the wearer from changing environmental conditions. The apparatus may also include an external thermal insulation layer and/or an internal thermal control layer to regulate the rate of heat exchange between the composite and the skin of the wearer. Other embodiments of the apparatus also provide 1) a path for evaporation or direct absorption of perspiration from the skin of the wearer for improved comfort and thermal control, 2) heat conductive pathways within the material for thermal equalization, 3) surface treatments for improved absorption or rejection of heat by the material, and 4) means for quickly regenerating the thermal storage capacity for reuse of the material. Applications of the composite materials are also described which take advantage of the composite's thermal characteristics. The examples described include a diver's wet suit, ski boot liners, thermal socks, gloves and a face mask for cold weather activities, and a metabolic heating or cooling blanket useful for treating hypothermia or fever patients in a medical setting and therapeutic heating or cooling orthopedic joint supports.
Continuously rotating cat scanning apparatus and method
International Nuclear Information System (INIS)
Bax, R.F.
1980-01-01
A tomographic scanner with a continuously rotating source of radiation is energized by converting inertial mechanical energy to electrical energy. The mechanical-to-electrical conversion apparatus is mounted with the x-ray source to be energized on a rotating flywheel. The inertial mechanical energy stored in the rotating conversion apparatus, flywheel and x-ray source is utilized for generating electrical energy used, in turn, to energize the x-ray source
Apparatus for controlling nuclear core debris
Jones, Robert D.
1978-01-01
Nuclear reactor apparatus for containing, cooling, and dispersing reactor debris assumed to flow from the core area in the unlikely event of an accident causing core meltdown. The apparatus includes a plurality of horizontally disposed vertically spaced plates, having depressions to contain debris in controlled amounts, and a plurality of holes therein which provide natural circulation cooling and a path for debris to continue flowing downward to the plate beneath. The uppermost plates may also include generally vertical sections which form annular-like flow areas which assist the natural circulation cooling.
Apparatus for controlling nuclear core debris
International Nuclear Information System (INIS)
Jones, R.D.
1978-01-01
Disclosed is an apparatus for containing, cooling, and dispersing reactor debris assumed to flow from the core area in the unlikely event of an accident causing core meltdown. The apparatus includes a plurality of horizontally disposed vertically spaced plates, having depressions to contain debris in controlled amounts, and a plurality of holes therein which provide natural circulation cooling and a path for debris to continue flowing downward to the plate beneath. The uppermost plates may also include generally vertical sections which form annular-like flow areas which assist the natural circulation cooling
Programmers for diagnostic x-ray apparatus
International Nuclear Information System (INIS)
1981-01-01
Novel apparatus is described for providing a pre-programmed selection of various parameters in X-ray radiography. The equipment consists of push-buttons which prompt the radiographer to make decisions such as thickness of patient, part of the anatomy to be X-rayed etc. From these data the apparatus selects the appropriate parameters such as H.T. voltage, current, product of current and irradiation time etc. The values of these parameters are displayed to the radiographer and facilities are provided to override the programmed parameters at the radiographer's discretion. (U.K.)
International Nuclear Information System (INIS)
Redmayne, I.G.B.
1985-01-01
Apparatus for the inspection of pipe welds comprises a radiation source for transmitting radiation, say as X-rays, through a pipe weld and a detector in a box arranged diametrically opposite the source, with respect to the pipe, for detecting the transmitted radiation and providing electrical signals which are processed to produce an image of the weld. The source and detector are mounted on a frame which is rotatable about an inner frame clamped to the pipe. (author)
2010-01-01
The mathematical model of heat transfer in whole-body hyperthermia, developed earlier by the author, has been refined using the mathematical apparatus of the circuit theory. The model can be used to calculate the temperature of each organ, which can increase the efficacy and safety of the immersion-convection technique of whole-body hyperthermia.
Manohar, Srirang; van Leeuwen, A.G.J.M.
2010-01-01
A thermoacoustic imaging apparatus comprises an electromagnetic radiation source configured to irradiate a sample area and an acoustic signal detection probe arrangement for detecting acoustic signals. A radiation responsive acoustic signal generator is added outside the sample area. The detection
Manohar, Srirang; van Leeuwen, A.G.J.M.
2008-01-01
A thermoacoustic imaging apparatus comprises an electromagnetic radiation source configured to irradiate a sample area and an acoustic signal detection probe arrangement for detecting acoustic signals. A radiation responsive acoustic signal generator is added outside the sample area. The detection
Nuclear fuel pellet loading apparatus
International Nuclear Information System (INIS)
Gerkey, K.S.
1979-01-01
An automatic apparatus for loading a predetermined amount of nuclear fuel pellets into a nuclear fuel element to be used in a nuclear reactor is described. The apparatus consists of a vibratory bed capable of supporting corrugated trays containing rows of nuclear fuel pellets and arranged in alignment with the open ends of several nuclear fuel elements. A sweep mechanism is arranged above the trays and serves to sweep the rows of fuel pellets onto the vibratory bed and into the fuel element. A length detecting system, in conjunction with a pellet stopping mechanism, is also provided to assure that a predetermined amount of nuclear fuel pellets are loaded into each fuel element
Development of apparatus for surveying uranium surface contamination quantity
International Nuclear Information System (INIS)
Wang Qingheng; Han Jingquan
1994-11-01
An apparatus for measuring uranium contamination of the surface of reactor plate component is described. The searching unit of the apparatus is a large surface multi-wire proportional counter. The cathode of the counter is made of stainless steel with low radioactive background, the window is made of film which is plated with aluminum about 6 μm; and the anode is mad by gild tungsten wire of 0.025 mm diameter. The sensitive area of the counter is 1113 mm x 100 mm. It has been shown that the intrinsic radioactive background of the apparatus is 0.002 cpm/cm 2 (2 count/min). The detecting efficiency is 67% for enriched uranium source (2π solid angle). The stability is 0.84% within 24 hour (including detector, high voltage power supply, amplifier, discriminator, computer, type and display system). The lower detection limit of the apparatus is 4.6 x 10 -10 g/cm 2 (for 20% 235 U, 0.13% 234 U, 79.64% 238 U). The apparatus can present timing by a computer controlling, and it also has the following functions: displaying, automatic alarming, classifying and typing the results. (2 tabs., 7 figs.)
Access to the Superficial Femoral Artery in the Presence of a 'Hostile Groin': A Prospective Study
International Nuclear Information System (INIS)
Marcus, Adrian J.; Lotzof, Kevin; Howard, Adam
2007-01-01
Purpose. Lower limb angioplasty is commonly performed via antegrade common femoral artery (CFA) puncture, followed by selective superficial femoral artery (SFA) catheterization. Arterial access can be complicated by a 'hostile groin' (scarring, obesity, or previous failed CFA puncture). We prospectively investigated color duplex ultrasound (CDU)-guided SFA access for radiological interventions. Methods. Antegrade CDU-guided CFA and SFA puncture were compared in 30 patients requiring intervention for severe leg ischemia who had hostile groins. Demographics, screen time, radiation dose, intervention, and complications were prospectively recorded. Results. Treatment in 30 patients involved 44 angioplasties (40 transluminal, 4 subintimal) and 2 diagnostic angiograms. Fifteen of these patients had CDU-guided CFA punctures; in 8 of these patients CDU-guided CFA puncture 'failed' (i.e., there was failure to pass a guidewire or catheter into the CFA or SFA), necessitating immediate direct CDU-guided SFA puncture. Overall, the mean screen time and radiation dosage, via direct CDU-guided SFA puncture in 30 patients, was 4.8 min and 464 Gy cm 2 respectively. With CDU-guided CFA puncture, mean screen time (10 min), radiation dose (2023 Gy cm 2 ), and complications (13%) were greater when compared with the SFA puncture results overall and in the same patients at subsequent similar procedures (2.7 min, 379 Gy cm 2 (p < 0.05), no complications in this subgroup). Five complications occurred: 2 each at CFA and SFA entry sites, and 1 angioplasty embolus. Conclusions. The CDU-guided SFA puncture technique was both more effective than CDU-guided CFA access in patients with scarred groins, obesity, or failed CFA punctures and safer, with reduced screen times, radiation doses, and complications
International Nuclear Information System (INIS)
Marshall, J.H. III.
1979-01-01
The active reduction of the number of analyzed events with pulse amplitudes which pileup has distorted improves measurement accuracy and response time in an apparatus for neutron-capture-based on-line elemental analysis of bulk substances. Within the apparatus, the analyzed bulk substance is exposed to neutrons, and neutron capture generates prompt gamma rays therefrom. A detector interacts with some of these gamma rays to produce electrical signals used to measure their energy spectrum by pulse-height analysis. Circuits associated with this pulse-height analysis also detect the pileup of the signals of two or more independent gamma rays using one or more of several techniques. These techniques include multiple outputs from a special amplifier-discriminator system, which has been optimized for low pulse-pair resolving time and may have adaptive thresholds, and the requirement that the relative amplitudes of the outputs of slow and fast amplifiers be consistent with a single event producing both outputs. Pulse-width measurements are also included in the pileup detection
Method and apparatus for analyzing ionizable materials
International Nuclear Information System (INIS)
Ehrlich, B.J.; Hall, R.C.; Thiede, P.W.
1979-01-01
An apparatus and method are described for analyzing a solution of ionizable compounds in a liquid. The solution is irradiated with electromagnetic radiation to ionize the compounds and the electrical conductivity of the solution is measured. The radiation may be X-rays, ultra-violet, infra-red or microwaves. The solution may be split into two streams, only one of which is irradiated, the other being used as a reference by comparing conductivities of the two streams. The liquid must be nonionizable and is preferably a polar solvent. The invention provides an analysis technique useful in liquid chromatography and in gas chromatography after dissolving the eluted gases in a suitable solvent. Electrical conductivity measurements performed on the irradiated eluent provide a quantitative indication of the ionizable materials existing within the eluent stream and a qualitative indication of the purity of the eluent stream. (author)
Apparatus and process for passivating an SRF cavity
Myneni, Ganapati Rao; Wallace, John P
2014-12-02
An apparatus and process for the production of a niobium cavity exhibiting high quality factors at high gradients is provided. The apparatus comprises a first chamber positioned within a second chamber, an RF generator and vacuum pumping systems. The process comprises placing the niobium cavity in a first chamber of the apparatus; thermally treating the cavity by high temperature in the first chamber while maintaining high vacuum in the first and second chambers; and applying a passivating thin film layer to a surface of the cavity in the presence of a gaseous mixture and an RF field. Further a niobium cavity exhibiting high quality factors at high gradients produced by the method of the invention is provided.
Measurement of scintillation decay curves by a single photon counting technique
International Nuclear Information System (INIS)
Noguchi, Tsutomu
1978-01-01
An improved apparatus suitable for the measurement of spectroscopic scintillation decay curves has been developed by combination of a single photon counting technique and a delayed coincidence method. The time resolution of the apparatus is improved up to 1.16 nsec (FWHM), which is obtained from the resolution function of the system for very weak Cherenkov light flashes. Systematic measurement of scintillation decay curves is made for liquid and crystal scintillators including PPO-toluene, PBD-xylene, PPO-POPOP-toluene, anthracene and stilbene. (auth.)
Pressure suppression apparatus of a nuclear power plant
International Nuclear Information System (INIS)
Mizumachi, W.; Funalashi, T.
1980-01-01
Pressure suppression apparatus for a nuclear reactor comprises a vessel surrounding a reactor pressure vessel and containing a water pool at the bottom of the vessel, and a steam exhaust pipe. The apparatus further comprises an exhaust chamber connected to the immersed portion of the exhaust pipe and provided with a number of discharge openings. (auth)
Roe, George Michael; Klebanoff, Leonard Elliott; Rea, Gerald W; Drake, Robert A; Johnson, Terry A; Wingert, Steven John; Damberger, Thomas A; Skradski, Thomas J; Radley, Christopher James; Oros, James M; Schuttinger, Paul G; Grupp, David J; Prey, Stephen Carl
2013-05-14
A mobile lighting apparatus includes a portable frame such as a moveable trailer or skid having a light tower thereon. The light tower is moveable from a stowed position to a deployed position. A hydrogen-powered fuel cell is located on the portable frame to provide electrical power to an array of the energy efficient lights located on the light tower.
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
In order to propose fundamental research and development of AC superconducting power apparatuses, the FY 1998 efforts were directed to studies on the effects of introducing superconducting apparatuses, making proposals of development programs, literature (including patent publications) surveys on trends of research and development at home and abroad, and making proposals for technological breakthroughs. Results of the studies for evaluating economic efficiency of these apparatuses and the effects of their introduction indicate that the promising apparatuses for eventual commercialization include superconducting cables, current limiters, field power generators, transformers and flywheels. The superconducting cables are expected to greatly reduce losses and hence CO2 emissions. The superconducting current limiters are promising means to control short-circuit current increase in the trunk power systems in which they are used. The superconducting transformers are expected to reduce losses and hence CO2 emissions. The project of fundamental research and development of AC superconducting power apparatuses has proposed the fundamental technological research themes aimed at development of the elementary techniques prerequisite for realizing these 3 types of apparatuses and reflection of the required apparatus specifications in development of the cable materials. (NEDO)
46 CFR 160.010-5 - Buoyant apparatus with plastic foam buoyancy.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Buoyant apparatus with plastic foam buoyancy. 160.010-5... Vessels § 160.010-5 Buoyant apparatus with plastic foam buoyancy. (a) Buoyant apparatus with plastic foam buoyancy must have a plastic foam body with an external protective covering. The body may be reinforced as...
Past and present of measuring apparatus for nuclear medicine
International Nuclear Information System (INIS)
Murayama, Hideo
2013-01-01
The history of advancement of measuring apparatus for nuclear medicine is looked back. It is presented that Japanese contribution to these advancement has been in no small quantities. The future view carrying the measuring apparatus for nuclear medicine is also described. (M.H.)
46 CFR 160.010-6 - Capacity of buoyant apparatus.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Capacity of buoyant apparatus. 160.010-6 Section 160.010-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND... apparatus is not considered in determining the capacity. (b) [Reserved] ...
Apparatus for handling control rod drives
International Nuclear Information System (INIS)
Akimoto, A.; Watanabe, M.; Yoshida, T.; Sugaya, Z.; Saito, T.; Ishii, Y.
1979-01-01
An apparatus for handling control rod drives (CRD's) attached by detachable fixing means to housings mounted in a reactor pressure vessel and each coupled to one of control rods inserted in the reactor pressure vessel is described. The apparatus for handling the CRD's comprise cylindrical housing means, uncoupling means mounted in the housing means for uncoupling each of the control rods from the respective CRD, means mounted on the housing means for effecting attaching and detaching of the fixing means, means for supporting the housing means, and means for moving the support means longitudinally of the CRD
Energy Technology Data Exchange (ETDEWEB)
França, Michel de A.; Suita, Julio C.; Salgado, César M., E-mail: mchldante@gmail.com, E-mail: suita@ien.gov.br, E-mail: otero@ien.gov.br [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2017-07-01
This paper focus on developing a counting system for the Wearing Apparatus, which is a device previously built to generate measurable wear on a given surface (Main Source) and to carry the fillings from it to a filter (second source). The Thin Layer Activation is a technique used to produce activity on one of the Wearing Apparatus' piece, this activity is proportional to the amount of material worn, or scrapped, from the piece's surface. Thus, by measuring the activity on those two points it is possible to measure the produced wear. The methodology used in this work is based on simulations through MCNP-X Code to nd the best specifications for shielding, solid angles, detectors dimensions and collimation for the Counting System. By simulating several scenarios, each one different from the other, and analyzing the results in the form of Counts Per Second, the ideal counting system's specifications and geometry to measure the activity in the Main Source and the Filter (second source) is chosen. After that, a set of previously activated stainless steel foils were used to reproduce the real experiments' conditions, this real experiment consists of using TLA and the Wearing Apparatus, the results demonstrate that the counting system and methodology are adequate for such experiments. (author)
Data mining and visualization techniques
Wong, Pak Chung [Richland, WA; Whitney, Paul [Richland, WA; Thomas, Jim [Richland, WA
2004-03-23
Disclosed are association rule identification and visualization methods, systems, and apparatus. An association rule in data mining is an implication of the form X.fwdarw.Y where X is a set of antecedent items and Y is the consequent item. A unique visualization technique that provides multiple antecedent, consequent, confidence, and support information is disclosed to facilitate better presentation of large quantities of complex association rules.
Proton imaging apparatus for proton therapy application
International Nuclear Information System (INIS)
Sipala, V.; Lo Presti, D.; Brianzi, M.; Civinini, C.; Bruzzi, M.; Scaringella, M.; Talamonti, C.; Bucciolini, M.; Cirrone, G.A.P.; Cuttone, G.; Randazzo, N.; Stancampiano, C.; Tesi, M.
2011-01-01
Radiotherapy with protons, due to the physical properties of these particles, offers several advantages for cancer therapy as compared to the traditional radiotherapy and photons. In the clinical use of proton beams, a p CT (Proton Computer Tomography) apparatus can contribute to improve the accuracy of the patient positioning and dose distribution calculation. In this paper a p CT apparatus built by the Prima (Proton Imaging) Italian Collaboration will be presented and the preliminary results will be discussed.
THE APPARATUS FOR ALIGNMENT OF THE PHOTOMETRIC LAMP FILAMENT
Directory of Open Access Journals (Sweden)
V. A. Dlugunovich
2015-01-01
Full Text Available During photometric measurements involving the use of photometric lamps it is necessary that the filament of lamp takes a strictly predetermined position with respect to the photodetector and the optical axis of the photometric setup. The errors in positioning of alignment filament with respect to the optical axis of the measuring system lead to increase the uncertainty of measurement of the photometric characteristics of the light sources. A typical method for alignment of filament of photometric lamps is based on the use a diopter tubes (telescopes. Using this method, the mounting of filament to the required position is carried out by successive approximations, which requires special concentration and a lot of time. The aim of this work is to develop an apparatus for alignment which allows simultaneous alignment of the filament of lamps in two mutually perpendicular planes. The method and apparatus for alignment of the photometric lamp filament during measurements of the photometric characteristics of light sources based on two digital video cameras is described in this paper. The apparatus allows to simultaneously displaying the image of lamps filament on the computer screen in two mutually perpendicular planes. The apparatus eliminates a large number of functional units requiring elementwise alignment and reduces the time required to carry out the alignment. The apparatus also provides the imaging of lamps filament with opaque coated on the bulb. The apparatus is used at the National standard of light intensity and illuminance units of the Republic of Belarus.
[Design and application of a cake-shaping apparatus for drug-separated moxibustion].
Zhu, Ai-Jun; Lu, Xiao-Dong
2008-08-01
Acupuncturist makes herbal cakes with traditional manual way, with such disadvantages as slow in making, varying in thickness and size of the cake. When the patients are treated with medical cake-separated moxibustion, they will be unevenly affected by the heat and the patient easily suffers from burning. These hinder clinically wide application of cake-separated moxibustion. With practice of many years, the authors design and make a kind of manual cake-shaping apparatus which can rapidly and conveniently make uniform medical cake, with simple technique, ingenious structure and normal material.
International Nuclear Information System (INIS)
Holmes, R.J.; Wylie, A.W.; McCracken, K.G.
1975-01-01
Techniques and apparatus for measuring the concentration of water and specific components in materials are described. The techniques involve irradiating the material with neutrons and monitoring the neutron flux in the vicinity of the irradiated material and the gamma radiation from excited nuclei of the specific component. Examples of the use of the invention include on-stream monitoring of ores carried by conveyor belts and borehole logging using a probe which carries a neutron source, and neutron and gamma radiation detectors. (U.S.)
Apparatus for the ammonium recovery from liquid animal manure
Starmans, D.A.J.; Timmerman, M.
2013-01-01
Nitrogen present in animal manure can be a limiting factor when considering manure application rates onto arable land. EU-regulations triggered the development of a new ammonia exchange apparatus for the recovery of ammonia. The described apparatus has a liquid to liquid ammonia mass transfer
49 CFR 234.211 - Security of warning system apparatus.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Security of warning system apparatus. 234.211... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.211 Security of warning system apparatus...
Apparatus and method for the electrolysis of water
Greenbaum, Elias
2015-04-21
An apparatus for the electrolytic splitting of water into hydrogen and/or oxygen, the apparatus comprising: (i) at least one lithographically-patternable substrate having a surface; (ii) a plurality of microscaled catalytic electrodes embedded in said surface; (iii) at least one counter electrode in proximity to but not on said surface; (iv) means for collecting evolved hydrogen and/or oxygen gas; (v) electrical powering means for applying a voltage across said plurality of microscaled catalytic electrodes and said at least one counter electrode; and (vi) a container for holding an aqueous electrolyte and housing said plurality of microscaled catalytic electrodes and said at least one counter electrode. Electrolytic processes using the above electrolytic apparatus or functional mimics thereof are also described.
International Nuclear Information System (INIS)
Bernstein, S.; Griswa, P.J.; Halter, P. Jr.; Kidd, H.J.
1980-01-01
Apparatus for x-ray cardiovascular examination and which can also be used for general purpose examination is described. An advantage of the system is that there is no mechanical connection between the image intensifier and source to interfere with the medical examiner or emergency procedures. (U.K.)
Portable apparatus for measurement of nuclear radiation
International Nuclear Information System (INIS)
Whitlock, G.D.
1975-01-01
The apparatus described is stated to be particularly applicable to the measurement of tritium contamination of a surface, although it may have other applications to the determination of radioactivity on surfaces. The mean range of a tritium β particle in air at normal atmospheric pressure is only 1.5 mm. and when monitoring such radiation with the apparatus it is necessary to exclude light. The apparatus comprises a plastic scintillator sheet located in the base of a housing, with a sealing ring mounted in the base so as to make a hermetic and light-tight seal between a support surface and the base of the housing. Photomultiplier means are optically coupled to the scintillator sheet to detect and amplify the scintillations, and a pump device is provided to reduce the air pressure in the vicinity of the sheet to below atmospheric pressure. The scintillator sheet and the photomultiplier means are movable as one unit within the housing, the unit being arranged to be acted upon by atmospheric pressure so as to move the unit into an operative position against a spring when the air pressure in the vicinity of the sheet is reduced to below atmospheric pressure. A shutter is provided to prevent exposure of the scintillator sheet to light when the apparatus is not in use. (U.K.)
Evaluated Plan Stress Of Weld In Pressure Tube Using X Ray Diffraction Technique
International Nuclear Information System (INIS)
Phan Trong Phuc; Nguyen Duc Thanh; Luu Anh Tuyen
2011-01-01
X ray diffraction is a fundamental technique measuring stress, this technique has determined crystal strain in materials, from that determined stress in materials. This paper presents study of evaluating plane stress of weld in pressure tube, using modern XRD apparatus: X Pert Pro. (author)
Nuclear magnetic resonance apparatus
International Nuclear Information System (INIS)
Lambert, R.
1991-01-01
In order to include the effect of a magnetic object in a subject under investigation, Nuclear Magnetic Resonance (NMR) apparatus is operable at more than one radio frequency (RF) frequency. The apparatus allows normal practice as far as obtaining an NMR response or image from a given nuclear species is concerned, but, in addition, interrogates the nuclear spin system at a frequency which is different from the resonance frequency normally used for the given nuclear species, as determined from the applied magnetic field. The magnetic field close to a magnetised or magnetisable object is modified and the given nuclear species gives a response at the different frequency. Thus detection of a signal at the frequency indicates the presence of the chosen nuclei close to the magnetised or magnetisable object. Applications include validation of an object detection or automatic shape inspection system in the presence of magnetic impurities, and the detection of magnetic particles which affect measurement of liquid flow in a pipe. (author)
Apparatus for gamma radiography
International Nuclear Information System (INIS)
1983-06-01
The aim of the present standard is to fix the rules for the construction of gamma radiography instrumentation without prejudice to the present regulations. These apparatus have to be fitted with only sealed sources conformable to the experimental standard M 61-002. The present standard agrees with the international standard ISO 3999 of 1977 dealing with the same subject. Nevertheless, it is different on the three main following points: it does not accept the same limits of absorbed dose rates in the air calculated on the external surface of projectors; it precribes tightness, bending, crushing and tensile tests for some components of the gamma radiography it prescribes tests of endurance and resistance to breaking for the locking systems of the gamma radiography apparatus. The present standard also specifies the following points: symbols and indications to put on projectors and on the source-holder; identification of the source contained in the projector; and, accompanying documents. The regulation references are given in annexe [fr
Improvements in measuring apparatus
International Nuclear Information System (INIS)
Casey, W.
1976-01-01
Measuring apparatus is described that is suitable for gauging the wall profiles of downwardly extending channels in nuclear reactors, but which is equally applicable to channels such as pipe bores and conduits in other types of plant. The apparatus comprises a probe carrying a measuring transducer giving an electrical output. The probe support may be moved stepwise along the channel along a track between end members. An electrical conductor is provided for transmitting the electrical output of the transducer to an indicator located remote from the probe. The probe support may consist of a cable attached at one end to a winding drum, and incorporating an electrical conductor connected to the transducer. Channel engaging means are provided on the probe that permits free upward movement of the probe when the latter is suspended by the cable and moves into gripping engagement with the channel wall when the tension in the cable is relaxed. (U.K.)
An overview of surgery-first approach: Recent advances in orthognathic surgery.
Sharma, Vipul Kumar; Yadav, Kirti; Tandon, Pradeep
2015-01-01
The disadvantages of having orthodontic interventions both before and after orthognathic surgery include a long treatment time of 7-47 months and temporary worsening of facial appearance. Nowadays, the concept of surgery-first, followed by orthodontic treatment is applied to orthognathic surgery cases in different orthodontic centers in the world. This concept and technique is called "surgery-first-orthognathic-approach" or "surgery-first approach" (SFA) rigid fixation (skeletal anchorage system) of the bony segments and regional acceleratory phenomenon were keys to broad implementation of the SFA. This article is intended to provide an overview of SFA including indications, general and specific guidelines, different protocol variations, success rate and potential problems.
A multifunctional microwave plasma reaction apparatus and its applications
International Nuclear Information System (INIS)
Wang Xizhang; Wu Qiang; Hu Zheng; Xu Hua; Miao Shui; Chen Yi
2000-01-01
A multifunctional apparatus for microwave plasma reaction has been set up, which can be used in the fields such as chemical synthesis, surface modification, and heterogeneous catalysis. The apparatus has laid an experimental foundation for new methods, new technologies, and new train of thoughts to be explored
21 CFR 862.2485 - Electrophoresis apparatus for clinical use.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Electrophoresis apparatus for clinical use. 862.2485 Section 862.2485 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... Instruments § 862.2485 Electrophoresis apparatus for clinical use. (a) Identification. An electrophoresis...
7 CFR 801.9 - Tolerances for test weight apparatuses.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Tolerances for test weight apparatuses. 801.9 Section 801.9 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS... PERFORMANCE REQUIREMENTS FOR GRAIN INSPECTION EQUIPMENT § 801.9 Tolerances for test weight apparatuses. The...
Apparatus for making molten silicon
Levin, Harry (Inventor)
1988-01-01
A reactor apparatus (10) adapted for continuously producing molten, solar grade purity elemental silicon by thermal reaction of a suitable precursor gas, such as silane (SiH.sub.4), is disclosed. The reactor apparatus (10) includes an elongated reactor body (32) having graphite or carbon walls which are heated to a temperature exceeding the melting temperature of silicon. The precursor gas enters the reactor body (32) through an efficiently cooled inlet tube assembly (22) and a relatively thin carbon or graphite septum (44). The septum (44), being in contact on one side with the cooled inlet (22) and the heated interior of the reactor (32) on the other side, provides a sharp temperature gradient for the precursor gas entering the reactor (32) and renders the operation of the inlet tube assembly (22) substantially free of clogging. The precursor gas flows in the reactor (32) in a substantially smooth, substantially axial manner. Liquid silicon formed in the initial stages of the thermal reaction reacts with the graphite or carbon walls to provide a silicon carbide coating on the walls. The silicon carbide coated reactor is highly adapted for prolonged use for production of highly pure solar grade silicon. Liquid silicon (20) produced in the reactor apparatus (10) may be used directly in a Czochralski or other crystal shaping equipment.
Slit aperture technique for mammography
International Nuclear Information System (INIS)
Friedrich, M.
1984-01-01
Following a discussion of various principles used in the elimination of scatter, the prototype of a simple slit aperture mammography apparatus is described (modified Mammomat, Siemens). The main advantage of this technique compared with grid mammography is a halving of the radiation dose for identical image quality, using an identical film system. The technical requirements (heavy duty tube, new generator) are, however, considerable. If the film-screen systems currently in use are to remain the common systems for the future, then the development of a multi-lamellar slit diaphragm technique carries much promise for mammography. (orig.) [de
INFLATE: INFlate Landing Apparatus Technology
Koryanov, V. V. K.; Da-Poian, V. D. P.
2018-02-01
Our project, named INFLATE (INFlatable Landing Apparatus Technology), aims at reducing space landing risks and constraints and so optimizing space missions (reducing cost, mass, and risk and in the same time improving performance).
Purification by using the zone melting technique; Purification par la technique de la zone fondue
Energy Technology Data Exchange (ETDEWEB)
Clerc, Michel
1962-06-22
The zone melting technique has first been used in metallurgy, and has been developed for the preparation of silicon and germanium for semiconductors, and then for the preparation of organic bodies of high purity. In this research thesis, the author first presents the principle of this technique, and then discusses the influence of agitation in liquid phase, and the influence of the number of passages over the zone. He discusses issues related to matter transport, and some technical details which intervene in the design of an apparatus for purification by zone melting. He finally presents examples.
J.J. Glerum (Jacobus); R. van Mastrigt (Ron)
1990-01-01
textabstractA method is described for attaching isolated single smooth muscle cells to an apparatus designed for measuring the longitudinal forces developed passively and actively by the cell upon straining, electrical or pharmacological stimulation. Primary attachment of the cell is based on its
Apparatus for enrichment of uranium by double photoionization
International Nuclear Information System (INIS)
Laude, J.P.
1983-11-01
The present invention concerns enrichment of uranium by double photoionization. The use of a beam from a dye laser for excitation of gaseous uranium is known and the present invention concerns an apparatus of this type. The purpose of the invention is essentially to produce an apparatus having high energy efficiency. This is achieved according to the invention by using a continuous wave laser
Apparatus for controlling molten core debris
International Nuclear Information System (INIS)
Golden, M.P.; Tilbrook, R.W.; Heylmun, N.F.
1972-01-01
Disclosed is an apparatus for containing, cooling, diluting, dispersing and maintaining subcritical the molten core debris assumed to melt through the bottom of a nuclear reactor pressure vessel in the unlikely event of a core meltdown. The apparatus is basically a sacrificial bed system which includes an inverted conical funnel, a core debris receptacle including a spherical dome, a spherically layered bed of primarily magnesia bricks, a cooling system of zig-zag piping in graphite blocks about and below the bed and a cylindrical liner surrounding the graphite blocks including a steel shell surrounded by firebrick. Tantalum absorber rods are used in the receptacle and bed. 9 claims, 22 figures
Method and apparatus for combinatorial chemistry
Foote, Robert S [Oak Ridge, TN
2012-06-05
A method and apparatus are provided for performing light-directed reactions in spatially addressable channels within a plurality of channels. One aspect of the invention employs photoactivatable reagents in solutions disposed into spatially addressable flow streams to control the parallel synthesis of molecules immobilized within the channels. The reagents may be photoactivated within a subset of channels at the site of immobilized substrate molecules or at a light-addressable site upstream from the substrate molecules. The method and apparatus of the invention find particularly utility in the synthesis of biopolymer arrays, e.g., oligonucleotides, peptides and carbohydrates, and in the combinatorial synthesis of small molecule arrays for drug discovery.
Apparatus Producing an Even Distribution of Strain into Carries
Hrabovský, Leopold
2017-10-01
In many high-rise residential buildings or multi-storey warehouses, machinery, so called lifts, is used for the vertical transportation of people or weights between two or more altitudinally distant places. Carriers used for lifts are steel ropes or sprocket chains, on which a cage or a counterbalance is hinged. Apparatus of all carriers, attached to the hinge of the cage or counterbalance, should be even. This can be made only by hammer hinge. Fixed or springe hinge cannot be a perfect equalizing apparatus. This article describes an apparatus, which allows an even distribution of the strain into lift carriers, which use springe hinge of carrier ropes.
Radiographic film cassette unloading apparatus
International Nuclear Information System (INIS)
Stievenart, E.F.; Plessers, H.S.; Neujens, G.J.
1980-01-01
Apparatus for unloading cassettes, containing exposed radiographic films, has means for unfastening the cassettes, an inclined pathway for gravity feeding and rotating feed members (rollers or belts) to propel the films into the processor. (UK)
Positioning and locking apparatus
Hayward, M.L.; Harper, W.H.
1985-06-19
A positioning and locking apparatus including a fixture having a rotatable torque ring provided with a plurality of cam segments for automatically guiding a container into a desired location within the fixture. Rotation of the ring turns the container into a final position in pressure sealing relation against a hatch member.
Directory of Open Access Journals (Sweden)
Catur Wibowo Budi Santoso
2016-05-01
Full Text Available In relation to the existence of State Civil Apparatus, at least there are two issues that must be observed in the implementation of Regional elections, namely the issues of participation and neutrality of State Civil Apparatus. The phenomenon that occurs during this time is the involvement of the State Civil Apparatus in attendance is still minimum (low. Moreover, it is believed that there are many Civil Apparatus State who is not neutral in the organization of Regional Elections. In this regard, this study aims to analyze the participation and neutrality of State Civil Apparatus. The method utilized in this study is qualitative. The result of the study shows that in general the participation of State Civil Apparatus in Surabaya is adequately good, but the neutrality of State Civil Apparatus has not implemented well enough. There are at least three (3 main factors influencing the participation of Civil State Apparatus, namely the factors of leadership exemplary, commitment to employees, and employee development. As for the neutrality of the State Civil Apparatus, among others, is influenced by the factors of the ambition of employee, primordialism, and working environment of employees.
Apparatus as Milestones in the History of Comparative Psychology
Washburn, David A.; Rumbaugh, Duane M.; Putney, R. Thompson
1994-01-01
Significant apparatus developments from the history of comparative psychology are reviewed, including the contemporary trend toward computer use in research with nonhuman animals. It is argued that milestone apparatus served not only to open new lines of inquiry but also to shape or delimit the nature of the answers that were obtained.
A Flexible Online Apparatus for Projectile Launch Experiments
Directory of Open Access Journals (Sweden)
Carlos Manuel Paiva
2013-01-01
Full Text Available In order to provide a more flexible learning environment in physics, the developed projectile launch apparatus enables students to determine the acceleration of gravity and the dependence of a set of parameters in the projectile movement. This apparatus is remotely operated and accessed via web, by first scheduling an access time slot. This machine has a number of configuration parameters that support different learning scenarios with different complexities.
Self contained compressed air breathing apparatus to facilitate personnel decontamination
International Nuclear Information System (INIS)
McDonald, C.W.
1963-11-01
This report describes the modification of a Self Contained Compressed Air Breathing Apparatus to provide extended respiratory protection to grossly contaminated personnel during a decontamination period which may exceed the duration of the Breathing Apparatus air supply. (author)
Self contained compressed air breathing apparatus to facilitate personnel decontamination
Energy Technology Data Exchange (ETDEWEB)
McDonald, C W [Radiological and Safety Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)
1963-11-15
This report describes the modification of a Self Contained Compressed Air Breathing Apparatus to provide extended respiratory protection to grossly contaminated personnel during a decontamination period which may exceed the duration of the Breathing Apparatus air supply. (author)
THE DEVELOPMENT OF REGIONAL EXPANSION APPARATUS RESOURCE PLACEMENT IN INDONESIA
Directory of Open Access Journals (Sweden)
Suraji
2018-02-01
Full Text Available This study aimed to describe, analyze and deeply assess the implementation of regional apparatus resource development into new areas of regional expansion in Indonesia. The research was conducted by using qualitative approach, specifically, case study by analyzing descriptive data in the form of interviews, as well as analyzing valid data documentation to support the research problem. This research was conducted in the new area of Pangandaran Regency of West Java, Indonesia. The results of the research could map that there were still very few development programs of regional and apparatus expansion and it had not become the priority program after the expansion; the target of improving the quality of the apparatus resource appeared not to be the main measure, but rather, the main measure was the structuring of the apparatus and the issue of the regional office infrastructure; the instruments used in the development and training process were also less supportive, it caused many stagnant employees did not understand about new issues in the dynamics of work; apparatus development through training activities and scientific forums (seminars, scientific discussions, workshops and improvements was obstructed due to budget constraints.
Thermal treatment of starch slurry in Couette-Taylor flow apparatus
Directory of Open Access Journals (Sweden)
Hubacz Robert
2017-09-01
Full Text Available In this paper, thermal processing of starch slurry in a Couette-Taylor flow (CTF apparatus was investigated. Gelatinized starch dispersion, after treatment in the CTF apparatus, was characterized using such parameters like starch granule diameters (or average diameter, starch granule swelling degree (quantifying the amount of water absorbed by starch granules and concentration of dissolved starch. These parameters were affected mostly by the process temperature, although the impact of the axial flow or rotor rotation on them was also observed. Moreover, the analysis of results showed a relatively good correlation between these parameters, as well as, between those parameter and apparent viscosity of gelatinized starch dispersion. Meanwhile, the increase in the value of the apparent viscosity and in shear-tinning behaviour of dispersion was associated with the progress of starch processing in the CTF apparatus. Finally, the CTF apparatuses of different geometries were compared using numerical simulation of the process. The results of the simulation indicated that the apparatus scaling-up without increasing the width of the gap between cylinders results in higher mechanical energy consumption per unit of processed starch slurry.
UJI KONDUKTIVITAS TERMAL PADA DAUN BAYAM DENGAN MENGGUNAKAN THERMAL CONDUCTIVITY APPARATUS
Firmansyah, Firmansyah; Syafutra, Heriyanto; Sidikrubadi, Sidikrubadi; Irzaman, Irzaman
2017-01-01
Abstract Has successfully tested thermal conductivity on spinach leaves by using Thermal Conductivity Apparatus. Thermal conductivity Apparatus assisted with Steam generator, Caliper, Micrometer, and iron. The thermal conductivity value of spinach leaves is 0.5208 watts / (m.K). This thermal conductivity test on foliage, fruits using Thermal Conductivity Apparatus are very easy to do in Basic Physics Laboratory by physics study program students in Indonesia. Keywords: Thermal Conductivi...
An Under-the-Table Leg-Movement Apparatus and Changes in Energy Expenditure
Directory of Open Access Journals (Sweden)
Gabriel A. Koepp
2017-05-01
Full Text Available Introduction: Deskwork contributes substantially to sedentariness. Here, we evaluated an under-the-table apparatus that was designed to promote leg movement (fidgeting while seated. Our hypothesis was that the under-the-table apparatus would increase energy expenditure.Methods: We measured energy expenditure and heart rate in 26 people while they sat and worked using a standard chair, walked on a treadmill, and sat and worked using an under-the-desk apparatus that encouraged leg movement.Results: Energy expenditure increased significantly while using the under-the-table apparatus when compared to the standard office chair (standard chair, 81 ± 18 kcal/h; under-the-table apparatus, 96 ± 23 kcal/h (P < 0.001; representing an 18 ± 16% increase. The changes in energy expenditure were not as great as walking (1 mph, 168 ± 46 kcal/h, P < 0.001; 2 mph, 205 ± 51 kcal/, P < 0.001, representing 107 ± 37% and 155 ± 48% increases over baseline, respectively.Conclusions: An under-the-table apparatus that promotes leg movement can increase energy expenditure by approximately 20%. Dynamic sitting is promoted by this apparatus and may be among a lexicon of options to help people move more while seated at work.
International Nuclear Information System (INIS)
Berard, E.J.-J.
1975-01-01
We proposed to follow changes in the bone mineral content of medullary damage cases by measuring the attenuation of a monoenergetic gamma ray according to the Cameron and Sorenson technique. Apart from their high cost, existing instruments are not designed for this bedside observation of patients. Our aim was therefore to design and develop an easily portable, inexpensive apparatus. The γ radiation is supplied by a sealed 125 I source fitted with a narrow collimator. The battery-operated scintillation detector is that used to detect post-operative phlebites after injection of radio-fibrinogen. The source-detector unit can move to allow a transverse bone mineral content measurement. Data from the detector are processed electronically and the results given: - either graphically on a tracing board which gives an area proportional to the bone mineral content, - or numerically by means of an integrator computing this area and supplying the linear bone density directly. Experiments carried out in vivo showed the apparatus to be sensitive and the measurements reproducible, the results obtained being comparable with those of other authors. Using pieces of embalmed bone moreover an excellent correlation was observed between the bone mineral content obtained after incineration and the results displayed by our apparatus, which can therefore be calibrated [fr
2000-01-01
The invention relates to an X-ray apparatus which includes an adjustable X-ray filter. In order to adjust an intensity profile of the X-ray beam, an X-ray absorbing liquid is transported to filter elements of the X-ray filter. Such transport is susceptible to gravitational forces which lead to an
Apparatus for extracting and sequestering carbon dioxide
Rau, Gregory H [Castro Valley, CA; Caldeira, Kenneth G [Livermore, CA
2010-02-02
An apparatus and method associated therewith to extract and sequester carbon dioxide (CO.sub.2) from a stream or volume of gas wherein said apparatus hydrates CO.sub.2 and reacts the resulting carbonic acid with carbonate. Suitable carbonates include, but are not limited to, carbonates of alkali metals and alkaline earth metals, preferably carbonates of calcium and magnesium. Waste products are metal cations and bicarbonate in solution or dehydrated metal salts, which when disposed of in a large body of water provide an effective way of sequestering CO.sub.2 from a gaseous environment.
Realtime radiation exposure monitor and control apparatus
International Nuclear Information System (INIS)
Cowart, R.W.
1981-01-01
This patent application relates to an apparatus and methods used to obtain image information from modulation of a uniform flux. An exposure measuring apparatus is disclosed which comprises a multilayered detector structure having an external circuit connected to a transparent insulating layer and to a conductive plate a radiation source adapted to irradiate the detector structure with radiation capable of producing electron-hole pairs in a photoconductive layer of the detector wherein the flow of current within the external circuit is measured when the detector is irradiated by the radiation source. (author)
Apparatus and process for controlling fluidized beds
Rehmat, Amirali G.; Patel, Jitendra G.
1985-10-01
An apparatus and process for control and maintenance of fluidized beds under non-steady state conditions. An ash removal conduit is provided for removing solid particulates from a fluidized bed separate from an ash discharge conduit in the lower portion of the grate supporting such a bed. The apparatus and process of this invention is particularly suitable for use in ash agglomerating fluidized beds and provides control of the fluidized bed before ash agglomeration is initiated and during upset conditions resulting in stable, sinter-free fluidized bed maintenance.
Development of channel inspection and gauging apparatus for 235 MWe PHWRs
International Nuclear Information System (INIS)
Parulkar, S.K.; Taneja, R.; Taliyan, S.S.; Singh, Manjit; Govindarajan, G.
1992-01-01
Channel inspection and gauging apparatus is being developed to enable in-service channel inspection and gauging. Phase I apparatus to measure annular gap between pressure tube and calandria tube in a dry channel has been developed. The apparatus consists of a gauging head and a drive mechanism. The gauging head utilities an eddy current probe to measure the annular gap between pressure tube and calandria tube and an ultrasonic sensor to measure the wall thickness of the pressure tube. The output signal of the eddy current probe needs to be corrected for the effect of pressure tube wall thickness variation. This paper gives the details of the above apparatus. The results of calibration tests at mock-up station are presented. The paper outlines the program for the phase-wise development of Channel Inspection and Gauging Apparatus for use in heavy water filled channels without their isolation from PHT and draining. The final apparatus will have the facilities for ultrasonic flaw detection, ultrasonic gauging to measure pressure tube diameter and wall thickness, an inclinometer to measure slope and sag of pressure tube and eddy current probe for the measurement of annular gap between pressure tube and calandria tube. (author). 6 figs
Apparatus for the laser ablative synthesis of carbon nanotubes
Smith, Michael W.; Jordan, Kevin
2010-02-16
An RF-induction heated side-pumped synthesis chamber for the production of carbon nanotubes. Such an apparatus, while capable of producing large volumes of carbon nanotubes, concurrently provides a simplified apparatus that allows for greatly reduced heat up and cool down times and flexible flowpaths that can be readily modified for production efficiency optimization.
Tandem mirror plasma confinement apparatus
Fowler, T. Kenneth
1978-11-14
Apparatus and method for confining a plasma in a center mirror cell by use of two end mirror cells as positively charged end stoppers to minimize leakage of positive particles from the ends of the center mirror cell.
PNO-apparatus and its test use for neutron interferometry
International Nuclear Information System (INIS)
Tomimitsu, Hiroshi; Aizawa, Kazuya; Hasegawa, Yuji; Kikuta, Seishi.
1993-01-01
Special apparatus 'PNO' of multiutility in the so-called precise neutron optics, such as double or triple crystal diffractometry, interferometry, etc., including neutron diffraction topography, was settled at 3G beam hole in the JRR-3M. In the symposium, several applications of the PNO apparatus are presented as 1) very small angle neutron scattering tool with double crystal arrangement, 2) the characterization of the quality of artificial multilayer lattices made of Ti-Ni by a triple crystal arrangement, 3) the characterization of Ni-base superalloy single crystals by the diffraction topography, which are presented in individual sessions. Preliminary test of the neutron interferometry was also tried with the PNO apparatus. Usual monolithic Si LLL- type interferometer was used with an Al phase shifter in the neutron beam paths. The periodicity of the measured intensity curve was well corresponded to the expected one. The best contrast of the intensity curve was measured as high as 43%. The utility of the PNO-apparatus for neutron interferometry was, thus, approved. (author)
Variable frequency microwave heating apparatus
Energy Technology Data Exchange (ETDEWEB)
Bible, D.W.; Lauf, R.J.; Johnson, A.C.; Thigpen, L.T.
1999-10-05
A variable frequency microwave heating apparatus (10) designed to allow modulation of the frequency of the microwaves introduced into a multi-mode microwave cavity (34) for testing or other selected applications. The variable frequency microwave heating apparatus (10) includes a microwave signal generator (12) and a high-power microwave amplifier (20) or a high-power microwave oscillator (14). A power supply (22) is provided for operation of the high-power microwave oscillator (14) or microwave amplifier (20). A directional coupler (24) is provided for detecting the direction and amplitude of signals incident upon and reflected from the microwave cavity (34). A first power meter (30) is provided for measuring the power delivered to the microwave furnace (32). A second power meter (26) detects the magnitude of reflected power. Reflected power is dissipated in the reflected power load (28).
A steam separator-superheater apparatus
International Nuclear Information System (INIS)
Androw, Jean; Bessouat, Roger; Peyrelongue, J.-P.
1973-01-01
Description is given of a separator-superheater apparatus comprising an outer enclosure containing a separating-unit and a steam superheating unit according to the main patent. The present addition relates to an improvement in that apparatus, characterized in that the separating unit and the superheating unit, mounted in two distinct portions of the outer enclosure, are divided into the same number of sub-units of each unit being identical and operating in parallel, and in that to each separator sub-unit is associated a superheater sub-unit, said sub-units being mounted in series and located in one in the other of the enclosure two portions, respectively. This can be applied to the treatment of the exhaust steam of a turbine high pressure body, prior to re-injecting said steam into the low pressure body [fr
Bellaw, Jennifer L; Nielsen, Martin K
2015-06-30
Traditional methods of diagnosing equine Strongylinae infections require culturing feces, sedimenting the culture media in Baermann apparatuses, collecting the sediment, and morphologically identifying recovered third stage larvae. However, this method is plagued by low negative predictive values. This study evaluated sedimentation time within the Baermann apparatus by comparing larval recovery from the traditionally collected sediment, "sediment 1", and from the usually discarded remaining fluid contents, "sediment 2", of the Baermann apparatus after 12, 24, and 48 h. A grand total of 147,482 larvae were recovered and examined. Sedimentation time did not significantly influence total larval recovery. At all three durations, significantly more Cyathostominae and Strongylus vulgaris larvae were covered from sediment 1 than from sediment 2. However, less than 60% of all recovered Strongylus edentatus were recovered from sediment 1. As 95% of S. vulgaris larvae were always recovered from sediment 1, the need for collection and examination of the remaining fluid contents of the Baermann apparatus is obviated when performing coprocultures for diagnosis of S. vulgaris infections, and sedimentation for 12h is adequate. Approximately 70% of Cyathostominae were recovered in sediment 1 at all durations, suggesting that 12h of sedimentation is adequate, although there is a need for future research to evaluate the risk of selection bias at differing sedimentation times among individual cyathostomin species. In contrast to S. vulgaris, collecting and examining the entire contents of the Baermann apparatus may be necessary when an increased diagnostic sensitivity and negative predictive value is desired in diagnosing S. edentatus infections as only 38-61% of larvae were recovered from sediment 1 portion of the Baermann apparatus. This information will allow researchers and practitioners to make more informed decisions in choosing appropriate larval recovery techniques, balancing
Rescue apparatus for a high working oil derrick
Energy Technology Data Exchange (ETDEWEB)
Prokopov, O.P.; Yagudin, S.Z.
1980-05-18
In order to improve reliability of the rescue apparatus a device for lowering a basket is made in the form of a collapsible forked support installed in the vertical plane inclined away from the tower. Its lower ends are attached by hinges to the base of the derrick. The upper end is connected to the derrick by means of a fastener. The apparatus has brakes with shock straps for receiving forked support.
Simple and Low-Cost Exposed -Layer Grain Drying Apparatus ...
African Journals Online (AJOL)
Thin-layer drying apparatus was developed from standard “off-the- shelf” equipment: a fan convection laboratory oven and a weighing scale. Using this apparatus the thin-layer drying data for wheat under constant conditions were obtained for a range of drying air temperature from 30°C to 150°C and the initial moisture ...
International Nuclear Information System (INIS)
Shibata, Hiromi; Iwai, Takeo; Narui, Makoto; Omata, Takao
1996-01-01
In the hyper irradiation research facility at the Atomic Research Center, the University of Tokyo, following apparatuses were newly installed for accelerator relating apparatus on 1995 fiscal year; 1) Hyper ion microbeam analysis apparatus, 2) Fourier conversion infrared microscopy, 3) Pico second two-dimensional fluorescence measuring apparatus, 4) Femto second wave-length reversible pulse laser radiation apparatus, and others. In addition to double irradiation, pulse beam irradiation experiment and so forth characteristic in conventional hyper irradiation research apparatus, upgrading of material irradiation experiments using these new apparatuses are intended. (G.K.)
Energy Technology Data Exchange (ETDEWEB)
Shibata, Hiromi; Iwai, Takeo; Narui, Makoto; Omata, Takao [Tokyo Univ. (Japan). Research Center for Nuclear Science and Technology
1996-12-01
In the hyper irradiation research facility at the Atomic Research Center, the University of Tokyo, following apparatuses were newly installed for accelerator relating apparatus on 1995 fiscal year; (1) Hyper ion microbeam analysis apparatus, (2) Fourier conversion infrared microscopy, (3) Pico second two-dimensional fluorescence measuring apparatus, (4) Femto second wave-length reversible pulse laser radiation apparatus, and others. In addition to double irradiation, pulse beam irradiation experiment and so forth characteristic in conventional hyper irradiation research apparatus, upgrading of material irradiation experiments using these new apparatuses are intended. (G.K.)
Polarization Imaging Apparatus with Auto-Calibration
Zou, Yingyin Kevin (Inventor); Zhao, Hongzhi (Inventor); Chen, Qiushui (Inventor)
2013-01-01
A polarization imaging apparatus measures the Stokes image of a sample. The apparatus consists of an optical lens set, a first variable phase retarder (VPR) with its optical axis aligned 22.5 deg, a second variable phase retarder with its optical axis aligned 45 deg, a linear polarizer, a imaging sensor for sensing the intensity images of the sample, a controller and a computer. Two variable phase retarders were controlled independently by a computer through a controller unit which generates a sequential of voltages to control the phase retardations of the first and second variable phase retarders. A auto-calibration procedure was incorporated into the polarization imaging apparatus to correct the misalignment of first and second VPRs, as well as the half-wave voltage of the VPRs. A set of four intensity images, I(sub 0), I(sub 1), I(sub 2) and I(sub 3) of the sample were captured by imaging sensor when the phase retardations of VPRs were set at (0,0), (pi,0), (pi,pi) and (pi/2,pi), respectively. Then four Stokes components of a Stokes image, S(sub 0), S(sub 1), S(sub 2) and S(sub 3) were calculated using the four intensity images.
Tandem mirror plasma confinement apparatus
International Nuclear Information System (INIS)
Fowler, T.K.
1978-01-01
Apparatus and method are described for confining a plasma in a center mirror cell by use of two end mirror cells as positively charged end stoppers to minimize leakage of positive particles from the ends of the center mirror cell
Automatic emissive probe apparatus for accurate plasma and vacuum space potential measurements
Jianquan, LI; Wenqi, LU; Jun, XU; Fei, GAO; Younian, WANG
2018-02-01
We have developed an automatic emissive probe apparatus based on the improved inflection point method of the emissive probe for accurate measurements of both plasma potential and vacuum space potential. The apparatus consists of a computer controlled data acquisition card, a working circuit composed by a biasing unit and a heating unit, as well as an emissive probe. With the set parameters of the probe scanning bias, the probe heating current and the fitting range, the apparatus can automatically execute the improved inflection point method and give the measured result. The validity of the automatic emissive probe apparatus is demonstrated in a test measurement of vacuum potential distribution between two parallel plates, showing an excellent accuracy of 0.1 V. Plasma potential was also measured, exhibiting high efficiency and convenient use of the apparatus for space potential measurements.
Energy Technology Data Exchange (ETDEWEB)
Mahoney, J M; Gutkin, M V; Tarnovsky, V; Becker, K [Department of Physics and Engineering Physics, Stevens Institute of Technology, Hoboken, NJ 07030 (United States)], E-mail: kbecker@poly.edu
2008-05-15
The fast-neutral-beam technique is a versatile approach to the determination of absolute cross sections for electron-impact ionization of atoms, stable molecules as well as free radicals and metastable species. A fast neutral beam of the species under study is prepared by charge-transfer neutralization of a mass-selected ion beam and the species are subsequently ionized by an electron beam. Mass- and energy-dispersive selection separates singly from multiply charged ions and parent from fragment ions and allows the determination of partial ionization cross sections. Here we describe some major improvements that were made recently to the fast-beam apparatus that has been used extensively for ionization cross section measurements for the past 15 years in our group. Experiments using well-established ionization cross sections in conjunction with extensive ion trajectory simulations were carried out to test the satisfactory performance of the modified fast-neutral-beam apparatus. We also report absolute partial cross sections for the formation of various singly charged positive ions produced by electron impact on SiCl{sub 3} for impact energies from threshold to 200 eV in the modified fast-beam apparatus.
Apparatus for decomposing shale
Energy Technology Data Exchange (ETDEWEB)
Gislain, M
1865-06-20
The apparatus is designed to fulfill the three following conditions: (1) complete extraction of the mineral oil, by avoiding partial decomposition; (2) purification of the said oil from products formed in the decomposition of the shale; (3) breaking down of the said oil into more products of different density. The separation of the heavy and bituminous products is claimed.
Energy Technology Data Exchange (ETDEWEB)
Trellue, Holly Renee [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Fugate, Michael Lynn [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Tobin, Stephen Joesph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2015-03-19
The Next Generation Safeguards Initiative (NGSI), Office of Nonproliferation and Arms Control (NPAC), National Nuclear Security Administration (NNSA) of the U.S. Department of Energy (DOE) has sponsored a multi-laboratory, university, international partner collaboration to (1) detect replaced or missing pins from spent fuel assemblies (SFA) to confirm item integrity and deter diversion, (2) determine plutonium mass and related plutonium and uranium fissile mass parameters in SFAs, and (3) verify initial enrichment (IE), burnup (BU), and cooling time (CT) of facility declaration for SFAs. A wide variety of nondestructive assay (NDA) techniques were researched to achieve these goals [Veal, 2010 and Humphrey, 2012]. In addition, the project includes two related activities with facility-specific benefits: (1) determination of heat content and (2) determination of reactivity (multiplication). In this research, a subset of 11 integrated NDA techniques was researched using data mining solutions at Los Alamos National Laboratory (LANL) for their ability to achieve the above goals.
Handling apparatus for a nuclear reactor fuel assembly
International Nuclear Information System (INIS)
Shallenberger, J.M.; Hornak, L.P.; Desmarchais, W.E.
1978-01-01
An apparatus is disclosed for handling radioactive fuel assembly during transfer operations. The radioactive fuel assembly is drawn up into a shielding sleeve which substantially reduces the level of radioactivity immediately surrounding the sleeve thereby permitting direct access by operating personnel. The lifting assembly which draws the fuel assembly up within the shielding sleeve is mounted to and forms an integral part of the handling apparatus. The shielding sleeve accompanies the fuel assembly during all of the transfer operations
Apparatus for treating carcinoma of the uterine cervix
International Nuclear Information System (INIS)
Kumar, P.P.
1984-01-01
Disclosed is an apparatus for treating carcinoma of the uterine cervix by judiciously applying radioactive material immediately adjacent the uterine cervix for an extended period of time empirically determined by the radiologist. The novel apparatus comprises three radioactively chargeable components including a central tubular tandem vaginally insertable longitudinally into the uterine cervix and two non-lineal tubular ovoidal assemblies longitudinally locatable at the cervix and positioned laterally between the respective vaginal walls and the uterine cervix. The ovoidal assemblies are conveniently removably and pivotably connected to the central tandem component externally of the vaginal along the sagittal plane through a novel adapter member whereby the radioactively chargeable ovoidal assemblies tend to remain within a laterally extending plane located substantially midway the transversely separated vasicovaginal and rectovaginal septa, even though the patient periodically shifts her reclining posture during the extended treatment by said vaginally protruding apparatus
A FILTRATION METHOD AND APPARATUS
DEFF Research Database (Denmark)
2003-01-01
The present invention concerns a method and an apparatus for separating dry matter from liquid, comprising providing an enclosed separation environment capable of being pressure regulated, and in said enclosed separation environment contacting at least one filter with a suspension accumulating dr...
Nuclear fuel rod loading apparatus
International Nuclear Information System (INIS)
King, H.B.
1981-01-01
A nuclear fuel loading apparatus, incorporating a microprocessor control unit, is described which automatically loads nuclear fuel pellets into dual fuel rods with a minimum of manual involvement and in a manner and sequence to ensure quality control and accuracy. (U.K.)
Apparatuses and methods for generating electric fields
Scott, Jill R; McJunkin, Timothy R; Tremblay, Paul L
2013-08-06
Apparatuses and methods relating to generating an electric field are disclosed. An electric field generator may include a semiconductive material configured in a physical shape substantially different from a shape of an electric field to be generated thereby. The electric field is generated when a voltage drop exists across the semiconductive material. A method for generating an electric field may include applying a voltage to a shaped semiconductive material to generate a complex, substantially nonlinear electric field. The shape of the complex, substantially nonlinear electric field may be configured for directing charged particles to a desired location. Other apparatuses and methods are disclosed.
Methods and apparatus for controlling rotary machines
Bagepalli, Bharat Sampathkumaran [Niskayuna, NY; Jansen, Patrick Lee [Scotia, NY; Barnes, Gary R [Delanson, NY; Fric, Thomas Frank [Greer, SC; Lyons, James Patrick Francis [Niskayuna, NY; Pierce, Kirk Gee [Simpsonville, SC; Holley, William Edwin [Greer, SC; Barbu, Corneliu [Guilderland, NY
2009-09-01
A control system for a rotary machine is provided. The rotary machine has at least one rotating member and at least one substantially stationary member positioned such that a clearance gap is defined between a portion of the rotating member and a portion of the substantially stationary member. The control system includes at least one clearance gap dimension measurement apparatus and at least one clearance gap adjustment assembly. The adjustment assembly is coupled in electronic data communication with the measurement apparatus. The control system is configured to process a clearance gap dimension signal and modulate the clearance gap dimension.
Purged window apparatus utilizing heated purge gas
Ballard, Evan O.
1984-01-01
A purged window apparatus utilizing tangentially injected heated purge gases in the vicinity of electromagnetic radiation transmitting windows, and a tapered external mounting tube to accelerate these gases to provide a vortex flow on the window surface and a turbulent flow throughout the mounting tube. Use of this apparatus prevents backstreaming of gases under investigation which are flowing past the mouth of the mounting tube which would otherwise deposit on the windows. Lengthy spectroscopic investigations and analyses can thereby be performed without the necessity of interrupting the procedures in order to clean or replace contaminated windows.
Method for Surface Scanning in Medical Imaging and Related Apparatus
DEFF Research Database (Denmark)
2015-01-01
A method and apparatus for surface scanning in medical imaging is provided. The surface scanning apparatus comprises an image source, a first optical fiber bundle comprising first optical fibers having proximal ends and distal ends, and a first optical coupler for coupling an image from the image...
Medical radiological apparatus
International Nuclear Information System (INIS)
1980-01-01
With the apparatus described, images can be obtained by rotation scanning and the image formation from a three dimensional image matrix is converted into an overall picture. Detectors for both X-ray radiation and γ radiation are present and these consist of a row of detector elements, from each of which a separate read-out can be obtained. Therefore both X-ray and γ ray images emitted from the examined object can be obtained. (Th.P.)
Apparatus to examine pulsed parallel field losses in large conductors
International Nuclear Information System (INIS)
Miller, J.R.; Shen, S.S.
1977-01-01
Conductors in tokamak toroidal field coils will be exposed to pulsed fields both parallel and perpendicular to the current direction. These conductors will likely be quite high capacity (10 to 20 kA) and therefore probably will be built up out of smaller units. We have previously published measurements of losses in conductors exposed to a pulsed parallel field, but those experiments necessarily used monolithic conductors of relatively small cross section because the pulse coil, a torus that surrounded the test conductor, was itself small. Here we describe an apparatus that is conceptually similar but has been scaled up to accept conductors of much larger cross section and current capacity. The apparatus consists basically of a superconducting torus that contains a movable spool to allow test samples to be wound inside without unwinding the torus. Details of apparatus design and capabilities are described and preliminary results from tests of the apparatus and from loss measurements using it are reported
Guo, Heng; Chen, Qian; Qi, Weizhi; Chen, Xingxing; Xi, Lei
2018-04-19
Brain imaging is an important technique in cognitive neuroscience. In this article, we designed a stereotaxic-apparatus-compatible photoacoustic microscope for the studies of rat cortical hemodynamics. Compared with existing optical resolution photoacoustic microscopy (ORPAM) systems, the probe owns feature of fast, light and miniature. In this microscope, we integrated a miniaturized ultrasound transducer with a center frequency of 10 MHz to detect photoacoustic signals and a 2-dimensional (2D) microelectromechanical system (MEMS) scanner to achieve raster scanning of the optical focus. Based on phantom evaluation, this imaging probe has a high lateral resolution of 3.8 μm and an effective imaging domain of 2 × 2 mm 2 . Different from conventional ORPAMs, combining with standard stereotaxic apparatus enables broad studies of rodent brains without any motion artifact. To show its capability, we successfully captured red blood cell flow in the capillary, monitored the vascular changes during bleeding and blood infusion and visualized cortical hemodynamics induced by middle cerebral artery occlusion. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Reference on shooting-blasting apparatus. Spravochnik po prostrelochno-vzryvnoy apparature
Energy Technology Data Exchange (ETDEWEB)
Fridlyander, L Ya
1983-01-01
Purpose, device, technical characteristics of the preforators, powder generators, blasting packers, core lifter, torpedoes, equipment and technology of charging, storage, transporting and testing of apparatus, characteristic errors and elimination of them are presented. Recommendations are made for safe work and efficient use of apparatus in different geological-technical conditions.
Combustion engine variable compression ratio apparatus and method
Lawrence,; Keith, E [Peoria, IL; Strawbridge, Bryan E [Dunlap, IL; Dutart, Charles H [Washington, IL
2006-06-06
An apparatus and method for varying a compression ratio of an engine having a block and a head mounted thereto. The apparatus and method includes a cylinder having a block portion and a head portion, a piston linearly movable in the block portion of the cylinder, a cylinder plug linearly movable in the head portion of the cylinder, and a valve located in the cylinder plug and operable to provide controlled fluid communication with the block portion of the cylinder.
Apparatus and Method for Communication over Power Lines
Krasowski, Michael J. (Inventor); Prokop, Norman F. (Inventor); Greer, III, Lawrence C. (Inventor); Nappier, Jennifer M. (Inventor)
2017-01-01
An apparatus and method are provided for communicating over power lines. The apparatus includes a coupling modem that is situated between a power line and a device. The coupling modem is configured to demodulate a signal received from the power line into a sine signal and a cosine signal. The coupling modem is also configured to modulate a communicated bit stream received from the device into a transmitted signal in order to impose the transmitted signal onto the power line.
Development of an experimental apparatus for boiling analysis
International Nuclear Information System (INIS)
Castro, A.J.A. de.
1984-04-01
The nucleate boiling is the most interesting boiling regime for practical appliccations, including nuclear reactor engineering. such regime is characterized by very high heat transfer rates with only small surface superheating. An experimental apparatus is developed for studying parameters which affect nucleate boiling. The following parameters are analysed: pressure, fluid velocity and the fluid temperature at the test section entrance. The performance of experimental apparatus is analysed by results and by problems raised by the oeration of setup. (Author) [pt
International Nuclear Information System (INIS)
Lyon, R.K.; Eisner, P.N.; Thomas, W.R.I.
1983-01-01
This application discloses a method for and an apparatus in which isotopes of an element in a compared are separated from each other while that compound, i.e., including a mixture of such isotopes, flows along a predetermined path. The apparatus includes a flow tube having a beginning and an end. The mixture of isotopes is introduced into the flow tube at a first introduction point between the beginning and the end thereof to flow the mixture toward the end thereof. A laser irradiates the flow tube dissociating compounds of a preselected one of said isotopes thereby converting the mixture in an isotopically selective manner. The dissociation products are removed from the tube at a first removal point between the first introduction point and the end. The dissociation product removed at the the first removal point are reconverted back into the comound thereby providing a first stage enriched compound. This first stage enriched compound is reintroduced into the flow tube at a second introduction point between the beginning thereof and the first introduction point. Further product is removed from the flow tube at a second removal point between the second introduction point and the first introduction point. The second introduction point is chosen so that the isotope composition of the first stage enriched compound is approximately the same as that of the compound in the flow tube
Electrolysis apparatus and method
International Nuclear Information System (INIS)
1975-01-01
A procedure in which electrolysis is combined with radiolysis to improve the reaction yield is proposed for the production of hydrogen and oxygen from water. An apparatus for this procedure is disclosed. High-energy electric pulses are applied between the anode and kathode of an electrolytical cell in such a way that short-wave electromagnetic radiation is generated at the same time
Apparatus for obtaining radiographs
International Nuclear Information System (INIS)
Frank, L.F.
1977-01-01
An apparatus for making x-ray pictures by imagewise exposing a cloud chamber containing a high atomic number gas mixed with a condensate vapor is described. The gas is under sufficiently high pressure to assure substantially complete absorption of the incident x-rays. Optical means are provided so that visible x-ray tracks are viewed from a direction aligned with the tracks
Calculation of period processing solution syrup in vacuum apparatus
Directory of Open Access Journals (Sweden)
A. A. Slavyanskii
2016-01-01
Full Text Available Important and crucial element in the management of the technological flow of production of sugar product standards is the period of time the enrichment of massecuite, since its neutralization in the process of crystal formation in vacuum apparatus, excess sugar solution. Although currently proposed and implemented in the industry, including as a front-end accompany the process, a number of ways in the real world sugar production in many cases have to resort to the services of an experienced operator. It is obvious that in any case it is necessary to have a surround-dependent glucose solution data on time for the excess sugar solution into the vacuum apparatus. With regard to the period of the enrichment of depleted sucrose solution are entered into this substance excess sucrose solution, it should be noted that this problem is theoretically still insufficiently developed. It is obvious that for practical purposes it is desirable to have a simple and convenient for engineering calculation of sugar processing time dependencies of the specified volume of water from the operating parameters of the process (the required concentration of sucrose, temperature of the solution stirring. The problem is the quantitative analysis of sucrose crystallization in vacuum apparatus, including the timing of enrichment solution to the excess syrup, period of time processing massecuite total this apparatus has been investigated in many works. However, due to its importance to the task of obtaining commercial sugar high standards this issue required further in-depth examination. In the article to support the enrichment process solution sucrose due to neutralize this solvent system in vacuum apparatus, from the standpoint of diffusion theory provides a more reasonable compared to known so far, quantitative analysis of this process. Where as sucrose crystals team are considering a system of balls, uniformly distributed in vacuum apparatus. On the basis of the solution
Filtering apparatus and method for mixing, extraction and/or separation
DEFF Research Database (Denmark)
2013-01-01
The present invention relates to a filtering apparatus and method for mixing a compound of solid and fluid phases, separating the phases and/or extracting fluid from the compound. One embodiment of the invention discloses a filtering apparatus comprising a first filter section accommodating a fir...... in a beer brewing procedure....
Method and apparatus for logging inclined earth boreholes
International Nuclear Information System (INIS)
Youmans, A.H.
1981-01-01
An improved technique is provided for comparing the velocity of an elongated well logging instrument traversing an inclined earth borehole with the playout velocity of the well logging cable at the earth's surface to control both the cable hoist drum rotation and the rate of movement of the subsurface instrument and thus insure cable playout is in equilibrium with the logging instrument movement. Method and apparatus are described for detecting any reduction in movement of the logging instrument through the borehole and for reducing the velocity of the logging cable playout in response thereto by reducing drum rotation. Further, when the velocity of cable playout slows to a preselected value, a monitoring circuit generates control signals which actuate a means of power attached to or integral with the logging instrument which, upon initiation, apply a force to move the logging instrument upward or downward within the borehole
Apparatus and method for tracking a molecule or particle in three dimensions
Werner, James H [Los Alamos, NM; Goodwin, Peter M [Los Alamos, NM; Lessard, Guillaume [Santa Fe, NM
2009-03-03
An apparatus and method were used to track the movement of fluorescent particles in three dimensions. Control software was used with the apparatus to implement a tracking algorithm for tracking the motion of the individual particles in glycerol/water mixtures. Monte Carlo simulations suggest that the tracking algorithms in combination with the apparatus may be used for tracking the motion of single fluorescent or fluorescently labeled biomolecules in three dimensions.
Digital Self-Evaluation and the Cybernetic Regime: A Sketch for a Materialist Apparatus Analysis
Directory of Open Access Journals (Sweden)
Simon Schaupp
2017-12-01
Full Text Available Using the example of self-tracking, this paper develops a materialist approach to the methodology of apparatus analysis. It builds on the Foucauldian concept of the apparatus, which it then subdivides into micro apparatus, as a concrete digital technology, and macro apparatus, as the superordinate regime to which the micro apparatus contributes. To bridge these two concepts, the term of the “urgent need” is used for asking to which broader social problems a given apparatus reacts. Contrary to approaches of “new materialism”, this paper insists on an analytical divide between discourse and matter on the one hand and action structure on the other hand, to be able to consider politico-economic power relations. Using this methodology, the relationship between the techno-practice of self-tracking and a broader cybernetic regime, is illustrated.
Apparatus and method for enhancing tissue repair in mammals
Goodwin, Thomas J. (Inventor); Parker, Clayton R. (Inventor)
2009-01-01
An apparatus is introduced for the use of enhancing tissue repair in mammals. The apparatus includes a sleeve; an electrically conductive coil; a sleeve support; an electrical circuit configured to supply the coil with a square wave time varying electrical current sufficient to create approximately 0.05 gauss to 0.5 gauss. When in use, the sleeve of the apparatus is placed on a mammalian body part and the time varying electromagnetic force of from approximately 0.05 gauss to 0.5 gauss is generated on the mammalian body for an extended period of time so that the tissue is encouraged to be regenerated in the mammalian body part at a rate in excess of the normal tissue regeneration rate relative to regeneration without application of the time varying electromagnetic force.
International Nuclear Information System (INIS)
Vasseur, J.P.
1976-01-01
A novel apparatus for radiographic examination purposes comprising an x-ray source emitting a flat beam is described. Detectors are arranged in the plane of the beam in order each to pick up part of the beam. To avoid the Compton effect, each detector has associated with it an auxiliary detector which only receives the rays emitted by the Compton effect. An electrical circuit forms a predetermined linear combination of the signals respectively picked up by each detector and the associated auxiliary detector, this in order to prevent the errors which are due to the Compton effect when the beam passes through the body being analyzed
Morphology of the hyoid apparatus of some species of odontocetes from southern Brazil.
Directory of Open Access Journals (Sweden)
Dan Jacobs Pretto
2009-03-01
Full Text Available The hyoid apparatus of odontocetes serves as a major attachment point for the muscles and ligaments that subserve breathing, sound production and swallowing. However, most of the literature on anatomy does not consider the bones of this region, presenting general osteological descriptions without considering the comparative aspects. This study sought to determine the intra and interspecific variations of the ossified hyoid apparatus elements from six species of odontocetus. We studied 96 hyoid apparatuses from the following species: Phocoena spinipinnis (n = 1, Pontoporia blainvillei (n = 20, Sotalia guianensis (n = 37, Stenella frontalis (n = 13, Steno bredanensis (n = 6 and Tursiops truncatus (n = 19. Among the six species analyzed, P. spinipinnis, P. blainvillei and S. guianenses presented a diagnostic feature of this apparatus, while the others were best described morphometrically when considering all the hyoid apparatus bones. Intraspecific variation was registered with greater amplitude in T. truncatus, while S. guianensis showed sexual dimorphism. The morphology of the hyoid apparatus proved to be important in the differentiation and characterization of all studied species.
Method And Apparatus For Atomizing And Vaporizing Liquid
Lal, Amit; Mayet, Abdulilah M.
2014-01-01
A method and apparatus for atomizing and vaporizing liquid is described. An apparatus having an ejector configured to eject one or more droplets of liquid may be inserted into a reservoir containing liquid. The ejector may have a vibrating device that vibrates the ejector and causes liquid to move from the reservoir up through the ejector and out through an orifice located on the top of the ejector. The one or more droplets of liquid ejected from the ejector may be heated and vaporized into the air.
Method And Apparatus For Atomizing And Vaporizing Liquid
Lal, Amit
2014-09-18
A method and apparatus for atomizing and vaporizing liquid is described. An apparatus having an ejector configured to eject one or more droplets of liquid may be inserted into a reservoir containing liquid. The ejector may have a vibrating device that vibrates the ejector and causes liquid to move from the reservoir up through the ejector and out through an orifice located on the top of the ejector. The one or more droplets of liquid ejected from the ejector may be heated and vaporized into the air.
Double bypasses soxhlet apparatus for extraction of piperine from Piper nigrum
Subramanian, R.; Subbramaniyan, P.; Noorul Ameen, J.; Raj, V.
2016-01-01
A simple modified soxhlet extractor, double bypasses sidearm soxhlet apparatus (DBSA) was designed and employed for extraction of piperine from Piper nigrum. Total extraction time, time taken for a cycle and yield observed in the double bypass sidearm soxhlet apparatus was compared with the soxhlet apparatus. Extraction time, time taken for an extraction cycle and yield of crude piperine obtained in DBSA were 12 ± 1 h, 8 ± 1.00 min, and 3.90 ± 0.10 g whereas the results obtained in the soxhle...
Energy Technology Data Exchange (ETDEWEB)
Henzl, V., E-mail: henzl@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87544 (United States); Croft, S.; Richard, J.; Swinhoe, M.T.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87544 (United States)
2013-06-01
In this paper, we present a novel approach to estimating the total plutonium content in a spent fuel assembly (SFA) that is based on combining information from a passive measurement of the total neutron count rate (PN) of the assayed SFA and a measure of its multiplication. While PN can be measured essentially with any non-destructive assay (NDA) technique capable of neutron detection, the measure of multiplication is, in our approach, determined by means of active interrogation using an instrument based on the Differential Die-Away technique (DDA). The DDA is a NDA technique developed within the U.S. Department of Energy's Next Generation Safeguards Initiative (NGSI) project focused on the utilization of NDA techniques to determine the elemental plutonium content in commercial nuclear SFA's [1]. This approach was adopted since DDA also allows determination of other SFA characteristics, such as burnup, initial enrichment, and cooling time, and also allows for detection of certain types of diversion of nuclear material. The quantification of total plutonium is obtained using an analytical correlation function in terms of the observed PN and active multiplication. Although somewhat similar approaches relating Pu content with PN have been adopted in the past, we demonstrate by extensive simulation of the fuel irradiation and NDA process that our analytical method is independent of explicit knowledge of the initial enrichment, burnup, and an absolute value of the SFA's reactivity (i.e. multiplication factor). We show that when tested with MCNPX{sup ™} simulations comprising the 64 SFA NGSI Spent Fuel Library-1 we were able to determine elemental plutonium content, using just a few calibration parameters, with an average variation in the prediction of around 1–2% across the wide dynamic range of irradiation history parameters used, namely initial enrichment (IE=2–5%), burnup (BU=15–60 GWd/tU) and cooling time (CT=1–80 y). In this paper we
Approach and tool for computer animation of fields in electrical apparatus
International Nuclear Information System (INIS)
Miltchev, Radoslav; Yatchev, Ivan S.; Ritchie, Ewen
2002-01-01
The paper presents a technical approach and post-processing tool for creating and displaying computer animation. The approach enables handling of two- and three-dimensional physical field phenomena results obtained from finite element software or to display movement processes in electrical apparatus simulations. The main goal of this work is to extend auxiliary features built in general-purpose CAD software working in the Windows environment. Different storage techniques were examined and the one employing image capturing was chosen. The developed tool provides benefits of independent visualisation, creating scenarios and facilities for exporting animations in common file fon-nats for distribution on different computer platforms. It also provides a valuable educational tool.(Author)
Gram staining apparatus for space station applications
Molina, T. C.; Brown, H. D.; Irbe, R. M.; Pierson, D. L.
1990-01-01
A self-contained, portable Gram staining apparatus (GSA) has been developed for use in the microgravity environment on board the Space Station Freedom. Accuracy and reproducibility of this apparatus compared with the conventional Gram staining method were evaluated by using gram-negative and gram-positive controls and different species of bacteria grown in pure cultures. A subsequent study was designed to assess the performance of the GSA with actual specimens. A set of 60 human and environmental specimens was evaluated with the GSA and the conventional Gram staining procedure. Data obtained from these studies indicated that the GSA will provide the Gram staining capability needed for the microgravity environment of space.
Apparatus for isotopic alteration of mercury vapor
Grossman, Mark W.; George, William A.; Marcucci, Rudolph V.
1988-01-01
An apparatus for enriching the isotopic Hg content of mercury is provided. The apparatus includes a reactor, a low pressure electric discharge lamp containing a fill including mercury and an inert gas. A filter is arranged concentrically around the lamp. In a preferred embodiment, constant mercury pressure is maintained in the filter by means of a water-cooled tube that depends from it, the tube having a drop of mercury disposed in it. The reactor is arranged around the filter, whereby radiation from said lamp passes through the filter and into said reactor. The lamp, the filter and the reactor are formed of a material which is transparent to ultraviolet light.
Risch, John S [Kennewick, WA; Dowson, Scott T [West Richland, WA; Hart, Michelle L [Richland, WA; Hatley, Wes L [Kennewick, WA
2008-05-13
A method of displaying correlations among information objects comprises receiving a query against a database; obtaining a query result set; and generating a visualization representing the components of the result set, the visualization including one of a plane and line to represent a data field, nodes representing data values, and links showing correlations among fields and values. Other visualization methods and apparatus are disclosed.
International Nuclear Information System (INIS)
Guo Huiping; Lu Ning; Shang Aiguo; Zhou Chunlin; Chen Yingfen; Yu Hongwei
2004-12-01
For actual demand, an idea of 'on-line monitoring' is put forward as a way of radon monitoring, instead of traditional so called 'off-line monitoring'. In this way, the apparatus has some automatic functions such as continuous monitoring, real-time alarm; thereby, there is no need for operators' intervention in each monitoring process. With technique of hardware and software design in automation's field, the authors have successfully developed the prototype and finished the scale of it in a standard radon-chamber. This apparatus is composed of detector part and secondary-instrument. The detector part is made up of a passive diffusion collecting chamber, high voltage static electricity, semiconductor detector, charge-sensitive preamplifier and forming circuit. The secondary-instrument is actually a micro-controller system, which consists of a single-chip micro-controller cored measure-controlling unit, display unit, printing unit and alarming unit. Taking this apparatus as a cell, a 'on-line Radon Monitoring Platform' based on CAN bus has been put forward, which can realize multi-points environmental radioactivity real-time monitoring radioactivity and data process. (authors)
Energy Technology Data Exchange (ETDEWEB)
Amole, C.; Capra, A.; Menary, S. [Department of Physics and Astronomy, York University, Toronto, Ontario M3J 1P3 (Canada); Ashkezari, M. D.; Hayden, M. E. [Department of Physics, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada); Baquero-Ruiz, M.; Chapman, S.; Little, A.; Povilus, A.; So, C.; Turner, M. [Department of Physics, University of California, Berkeley, California 94720-7300 (United States); Bertsche, W. [Department of Physics, Swansea University, Swansea SA2 8PP (United Kingdom); School of Physics and Astronomy, University of Manchester, Manchester M13 9PL, United Kingdom and The Cockcroft Institute, Daresbury Laboratory, Warrington WA4 4AD (United Kingdom); Butler, E. [Physics Department, CERN, CH-1211 Geneva 23 (Switzerland); Cesar, C. L.; Silveira, D. M. [Instituto de Fisica, Universidade Federal do Rio de Janeiro, Rio de Janeiro 21941-972 (Brazil); Charlton, M.; Eriksson, S.; Isaac, C. A.; Madsen, N.; Napoli, S. C. [Department of Physics, Swansea University, Swansea SA2 8PP (United Kingdom); Collaboration: ALPHA Collaboration; and others
2013-06-15
Knowledge of the residual gas composition in the ALPHA experiment apparatus is important in our studies of antihydrogen and nonneutral plasmas. A technique based on autoresonant ion extraction from an electrostatic potential well has been developed that enables the study of the vacuum in our trap. Computer simulations allow an interpretation of our measurements and provide the residual gas composition under operating conditions typical of those used in experiments to produce, trap, and study antihydrogen. The methods developed may also be applicable in a range of atomic and molecular trap experiments where Penning-Malmberg traps are used and where access is limited.
An apparatus for on-line measuring of the coating weight on art paper
International Nuclear Information System (INIS)
Huang Meifen; Mao Shunjuan
1986-01-01
The method and apparatus for on-line measuring of the coating weight on art paper are described. The design of the coating gauge was based on the technique of charcateristic X-ray fluorescence preferential absorption. The gauge was equipped with a TP-801 micro-computer which makes the gauge capable of showing and typing the data in different forms. The measurement is quick, continuous, accurate and non-destructive. Analysis period is 10 seconds. In on-line measuring, the reproducibility is +- 1 g/m 2 and the relative error of this method amounts to +- 5% with the weighing method as a standard
Spectroscopic Chemical Analysis Methods and Apparatus
Hug, William F. (Inventor); Reid, Ray D. (Inventor); Bhartia, Rohit (Inventor); Lane, Arthur L. (Inventor)
2018-01-01
Spectroscopic chemical analysis methods and apparatus are disclosed which employ deep ultraviolet (e.g. in the 200 nm to 300 nm spectral range) electron beam pumped wide bandgap semiconductor lasers, incoherent wide bandgap semiconductor light emitting devices, and hollow cathode metal ion lasers to perform non-contact, non-invasive detection of unknown chemical analytes. These deep ultraviolet sources enable dramatic size, weight and power consumption reductions of chemical analysis instruments. In some embodiments, Raman spectroscopic detection methods and apparatus use ultra-narrow-band angle tuning filters, acousto-optic tuning filters, and temperature tuned filters to enable ultra-miniature analyzers for chemical identification. In some embodiments Raman analysis is conducted along with photoluminescence spectroscopy (i.e. fluorescence and/or phosphorescence spectroscopy) to provide high levels of sensitivity and specificity in the same instrument.
Levine, Zachary A; Rapp, Michael V; Wei, Wei; Mullen, Ryan Gotchy; Wu, Chun; Zerze, Gül H; Mittal, Jeetain; Waite, J Herbert; Israelachvili, Jacob N; Shea, Joan-Emma
2016-04-19
Translating sticky biological molecules-such as mussel foot proteins (MFPs)-into synthetic, cost-effective underwater adhesives with adjustable nano- and macroscale characteristics requires an intimate understanding of the glue's molecular interactions. To help facilitate the next generation of aqueous adhesives, we performed a combination of surface forces apparatus (SFA) measurements and replica-exchange molecular dynamics (REMD) simulations on a synthetic, easy to prepare, Dopa-containing peptide (MFP-3s peptide), which adheres to organic surfaces just as effectively as its wild-type protein analog. Experiments and simulations both show significant differences in peptide adsorption on CH3-terminated (hydrophobic) and OH-terminated (hydrophilic) self-assembled monolayers (SAMs), where adsorption is strongest on hydrophobic SAMs because of orientationally specific interactions with Dopa. Additional umbrella-sampling simulations yield free-energy profiles that quantitatively agree with SFA measurements and are used to extract the adhesive properties of individual amino acids within the context of MFP-3s peptide adhesion, revealing a delicate balance between van der Waals, hydrophobic, and electrostatic forces.
Instability of confined water films between elastic surfaces.
de Beer, Sissi; 't Mannetje, Dieter; Zantema, Sietske; Mugele, Frieder
2010-03-02
We investigated the dynamics of nanometer thin water films at controlled ambient humidity adsorbed onto two atomically smooth mica sheets upon rapidly bringing the surfaces into contact. Using a surface forces apparatus (SFA) in imaging mode, we found that the water films break up into a distribution of drops with a typical thickness of a few nanometers and a characteristic lateral size and spacing of several micrometers. Whereas the characteristic length is found to be independent of the ambient humidity, the characteristic time of the breakup decreases from approximately 1 to 0.01 s with increasing humidity. The existence of characteristic length and time scales shows that this breakup is controlled by an instability rather than a conventional nucleation and growth mechanism for SFA experiments. These findings cannot be explained by a dispersion-driven instability mechanism. In contrast, a model involving the elastic energies for the deformation of both the mica sheets and the underlying glue layer correctly reproduces the scaling of the characteristic length and time with humidity.
Cluster Implantation and Deposition Apparatus
DEFF Research Database (Denmark)
Hanif, Muhammad; Popok, Vladimir
2015-01-01
In the current report, a design and capabilities of a cluster implantation and deposition apparatus (CIDA) involving two different cluster sources are described. The clusters produced from gas precursors (Ar, N etc.) by PuCluS-2 can be used to study cluster ion implantation in order to develop...
Apparatus for measuring fluid flow
Smith, J.E.; Thomas, D.G.
Flow measuring apparatus includes a support loop having strain gages mounted thereon and a drag means which is attached to one end of the support loop and which bends the sides of the support loop and induces strains in the strain gages when a flow stream impacts thereon.
An accelerated exposure and testing apparatus for building joint sealants.
White, C C; Hunston, D L; Tan, K T; Hettenhouser, J; Garver, J D
2013-09-01
The design, fabrication, and implementation of a computer-controlled exposure and testing apparatus for building joint sealants are described in this paper. This apparatus is unique in its ability to independently control and monitor temperature, relative humidity, ultraviolet (UV) radiation, and mechanical deformation. Each of these environmental factors can be controlled precisely over a wide range of conditions during periods of a month or more. Moreover, as controlled mechanical deformations can be generated, in situ mechanical characterization tests can be performed without removing specimens from the chamber. Temperature and humidity were controlled during our experiments via a precision temperature regulator and proportional mixing of dry and moisture-saturated air; while highly uniform UV radiation was attained by attaching the chamber to an integrating sphere-based radiation source. A computer-controlled stepper motor and a transmission system were used to provide precise movement control. The reliability and effectiveness of the apparatus were demonstrated on a model sealant material. The results clearly show that this apparatus provides an excellent platform to study the long-term durability of building joint sealants.
Bumps, breathers, and waves in a neural network with spike frequency adaptation
International Nuclear Information System (INIS)
Coombes, S.; Owen, M.R.
2005-01-01
We introduce a continuum model of neural tissue that includes the effects of spike frequency adaptation (SFA). The basic model is an integral equation for synaptic activity that depends upon nonlocal network connectivity, synaptic response, and the firing rate of a single neuron. We consider a phenomenological model of SFA via a simple state-dependent threshold firing rate function. As without SFA, Mexican-hat connectivity allows for the existence of spatially localized states (bumps). Importantly recent Evans function techniques are used to show that bumps may destabilize leading to the emergence of breathers and traveling waves. Moreover, a similar analysis for traveling pulses leads to the conditions necessary to observe a stable traveling breather. Simulations confirm our theoretical predictions and illustrate the rich behavior of this model
Apparatus for feeding nuclear fuel pellets to a loading tray
International Nuclear Information System (INIS)
Huggins, T.B.
1979-01-01
Apparatus for feeding nuclear fuel pellets at a uniform predetermined rate between pellet centering and grinding apparatus and a tray for loading pellets into nuclear fuel rod. Pellets discharged from the grinding apparatus are conveyed by a belt to a drive wheel forcing the pellets in engagement with the belt. The pellets under the drive wheel are capable of pushing a line of about 36 pellets onto a pellet dumping mechanism. As the dumping mechanism is actuated to dump the pellets on to a loading tray, the pellets moving toward the mechanism are stopped and the drive wheel is simultaneously lifted off the pellets until the pellet dumping process is completed. (U.K.)
Neu, C P; Hull, M L
2003-04-01
Recent magnetic resonance imaging (MRI) techniques have shown potential for measuring non-uniform deformations throughout the volume (i.e. three-dimensional (3D) deformations) in small orthopedic tissues such as articular cartilage. However, to analyze cartilage deformation using MRI techniques, a system is required which can construct images from multiple acquisitions of MRI signals from the cartilage in both the underformed and deformed states. The objectives of the work reported in this article were to 1) design an apparatus that could apply highly repeatable cyclic compressive loads of 400 N and operate in the bore of an MRI scanner, 2) demonstrate that the apparatus and MRI scanner can be successfully integrated to observe 3D deformations in a phantom material, 3) use the apparatus to determine the load cycle necessary to achieve a steady-state deformation response in normal bovine articular cartilage samples using a flat-surfaced and nonporous indentor in unconfined compression. Composed of electronic and pneumatic components, the apparatus regulated pressure to a double-acting pneumatic cylinder so that (1) load-controlled compression cycles were applied to cartilage samples immersed in a saline bath, (2) loading and recovery periods within a cycle varied in time duration, and (3) load magnitude varied so that the stress applied to cartilage samples was within typical physiological ranges. In addition the apparatus allowed gating for MR image acquisition, and operation within the bore of an MRI scanner without creating image artifacts. The apparatus demonstrated high repeatability in load application with a standard deviation of 1.8% of the mean 400 N load applied. When the apparatus was integrated with an MRI scanner programmed with appropriate pulse sequences, images of a phantom material in both the underformed and deformed states were constructed by assembling data acquired through multiple signal acquisitions. Additionally, the number of cycles to reach
Method and apparatus for performing digital intravenous subtraction angiography
International Nuclear Information System (INIS)
Stein, J.A.
1986-01-01
This invention relates to digital intravenous subtraction angiography (DISA), and more particularly concerns novel apparatus and techniques for providing high resolution angiograms with equipment that coacts with existing standard medical X-ray equipment. A typical medical X-ray generator provides low mA, continuous X-ray exposures illuminating a standard image intensifier producing an image scanned by a conventional television camera to produce a video signal. An analog-to-digital converter digitizes the signal, and adding means adds the digital frame signals together in real time to provide an intermediate digital signal representing the addition of 5 to 20 frames. Digital storage means store the intermediate image signals. Preferably there are two system memories with means for summing a subsequent intermediate image in the second memory while a previously-formed intermediate image is being transferred to disk storage
Medical X-ray techniques in diagnostic radiography. 4. ed.
International Nuclear Information System (INIS)
Plaats, G.J. van der; Vijlbrief, P.
1980-01-01
A step by step account is given of every aspect of the technical factors involved in the production of X-ray images. Chapter titles include, methods of image formation and laws of projection, sharpness and unsharpness, contrast, perceptibility of detail in the radiographic image-image quality, properties of fluoroscopic screens, radiographic films, intensifying screens and cassettes, image intensification and X-ray television, processing technique, fluoroscopy and radiographic technique in general, special radiographic techniques, radiographic examinations using contrast media, exposure and exposure tables and automatic density control, diagnostic X-ray apparatus, and diagnostic stands and accessories. (C.F.)
Development of an experimental apparatus for nucleate boiling analysis
International Nuclear Information System (INIS)
Castro, A.J.A. de.
1984-01-01
An experimental apparatus is developed for the study of the parameters that affect nucleate boiling. The experimental set up is tested for nucleate boiling in an annular test section with subcooled water flow. The following parameters are analysed: pressure, fluid velocity and the fluid temperature at the test section entrance. The performance of the experimental apparatus is analysed by the results and by the problems raised by the operation of the setup. (Author) [pt
Radiator debris removing apparatus and work machine using same
Martin, Kevin L [Washburn, IL; Elliott, Dwight E [Chillicothe, IL
2008-09-02
A radiator assembly includes a finned radiator core and a debris removing apparatus having a compressed air inlet and at least one compressed air outlet configured to direct compressed air through the radiator core. A work machine such as a wheel loader includes a radiator and a debris removing apparatus coupled with on-board compressed air and having at least one pressurized gas outlet configured to direct a gas toward the face of the radiator.
Exposing the Film Apparatus: The Film Archive as a Research Laboratory
Fossati, G.; van den Oever, A.
2016-01-01
Imagine opening the gates to a vault full of media apparatuses and letting loose thirty-two international media scholars and professionals on its heterogeneous content... Exposing the Film Apparatus collects the results of such an experiment. This book addresses the keen awareness of the prominence
Thickness measuring apparatus and method for tire ply and similar materials
International Nuclear Information System (INIS)
Cho, B.Y.; Utt, O.L.
1978-01-01
The invention relates to method and apparatus for measuring the amount of material on opposite sides of the reinforcing cord of a tire ply, and more particularly relates to a backscatter X-ray radiation gauging apparatus and method for obtaining the aforesaid measurements. (author)
A Small-Scale and Low-Cost Apparatus for the Electrolysis of Water
Eggeen, Per-Odd; Kvittingen, Lise
2004-01-01
The construction of two simple, inexpensive apparatuses that clearly show the electrolysis of water are described. Traditionally the electrolysis of water is conducted in a Hofmann apparatus which is expensive and fragile.
[Composite digital allotransplants: surgical technique and different applications].
Casoli, V; Rousvoal, A; Zirak, C; Bakhach, J; Guimberteau, J-C
2007-10-01
Microsurgery and human allotransplantation progress as well as the improvement of immunosuppressive drugs actually allow the development of the composite tissue allotransplantation. One of the latest challenges in plastic surgery is to restore the anatomic and functional structures using similar tissues. Composite tissue allotransplantation will probably reach this goal. Our work is to find new surgical techniques for the reconstruction of the osteotendinous apparatus of the long digits. In this paper, we will demonstrate the surgical technique to harvest the allotransplant and its modulation in the reconstruction of various digital defects.
International Nuclear Information System (INIS)
Lay-Ekuakille, Aimé; Pariset, Carlo; Trotta, Amerigo
2010-01-01
The FDM (filter diagonalization method), an interesting technique used in nuclear magnetic resonance data processing for tackling FFT (fast Fourier transform) limitations, can be used by considering pipelines, especially complex configurations, as a vascular apparatus with arteries, veins, capillaries, etc. Thrombosis, which might occur in humans, can be considered as a leakage for the complex pipeline, the human vascular apparatus. The choice of eigenvalues in FDM or in spectra-based techniques is a key issue in recovering the solution of the main equation (for FDM) or frequency domain transformation (for FFT) in order to determine the accuracy in detecting leaks in pipelines. This paper deals with the possibility of improving the leak detection accuracy of the FDM technique thanks to a robust algorithm by assessing the problem of eigenvalues, making it less experimental and more analytical using Tikhonov-based regularization techniques. The paper starts from the results of previous experimental procedures carried out by the authors
Scaling from single molecule to macroscopic adhesion at polymer/metal interfaces.
Utzig, Thomas; Raman, Sangeetha; Valtiner, Markus
2015-03-10
Understanding the evolution of macroscopic adhesion based on fundamental molecular interactions is crucial to designing strong and smart polymer/metal interfaces that play an important role in many industrial and biomedical applications. Here we show how macroscopic adhesion can be predicted on the basis of single molecular interactions. In particular, we carry out dynamic single molecule-force spectroscopy (SM-AFM) in the framework of Bell-Evans' theory to gain information about the energy barrier between the bound and unbound states of an amine/gold junction. Furthermore, we use Jarzynski's equality to obtain the equilibrium ground-state energy difference of the amine/gold bond from these nonequilibrium force measurements. In addition, we perform surface forces apparatus (SFA) experiments to measure macroscopic adhesion forces at contacts where approximately 10(7) amine/gold bonds are formed simultaneously. The SFA approach provides an amine/gold interaction energy (normalized by the number of interacting molecules) of (36 ± 1)k(B)T, which is in excellent agreement with the interaction free energy of (35 ± 3)k(B)T calculated using Jarzynski's equality and single-molecule AFM experiments. Our results validate Jarzynski's equality for the field of polymer/metal interactions by measuring both sides of the equation. Furthermore, the comparison of SFA and AFM shows how macroscopic interaction energies can be predicted on the basis of single molecular interactions, providing a new strategy to potentially predict adhesive properties of novel glues or coatings as well as bio- and wet adhesion.
Correlating molecular phylogeny with venom apparatus occurrence in Panamic auger snails (Terebridae.
Directory of Open Access Journals (Sweden)
Mandë Holford
2009-11-01
Full Text Available Central to the discovery of neuroactive compounds produced by predatory marine snails of the superfamily Conoidea (cone snails, terebrids, and turrids is identifying those species with a venom apparatus. Previous analyses of western Pacific terebrid specimens has shown that some Terebridae groups have secondarily lost their venom apparatus. In order to efficiently characterize terebrid toxins, it is essential to devise a key for identifying which species have a venom apparatus. The findings presented here integrate molecular phylogeny and the evolution of character traits to infer the presence or absence of the venom apparatus in the Terebridae. Using a combined dataset of 156 western and 33 eastern Pacific terebrid samples, a phylogenetic tree was constructed based on analyses of 16S, COI and 12S mitochondrial genes. The 33 eastern Pacific specimens analyzed represent four different species: Acus strigatus, Terebra argyosia, T. ornata, and T. cf. formosa. Anatomical analysis was congruent with molecular characters, confirming that species included in the clade Acus do not have a venom apparatus, while those in the clade Terebra do. Discovery of the association between terebrid molecular phylogeny and the occurrence of a venom apparatus provides a useful tool for effectively identifying the terebrid lineages that may be investigated for novel pharmacological active neurotoxins, enhancing conservation of this important resource, while providing supplementary information towards understanding terebrid evolutionary diversification.
Energy Technology Data Exchange (ETDEWEB)
Rovinskii, L A; Yarovenko, V L
1977-01-01
A mathematical model is described for kinetics of enzymic hydrolysis of starch in standard apparatus used in alcohol fermentation. The apparatus with uniform mixing and displacement was highly superior compared with other apparatuses. Differences of temperature with the apparatus significantly affects the rate of starch hydrolysis compared with constant temperature.
Flash radiographic technique applied to fuel injector sprays
International Nuclear Information System (INIS)
Vantine, H.C.
1977-01-01
A flash radiographic technique, using 50 ns exposure times, was used to study the pattern and density distribution of a fuel injector spray. The experimental apparatus and method are described. An 85 kVp flash x-ray generator, designed and fabricated at the Lawrence Livermore Laboratory, is utilized. Radiographic images, recorded on standard x-ray films, are digitized and computer processed
Active magnetic regenerator method and apparatus
DeGregoria, Anthony J.; Zimm, Carl B.; Janda, Dennis J.; Lubasz, Richard A.; Jastrab, Alexander G.; Johnson, Joseph W.; Ludeman, Evan M.
1993-01-01
In an active magnetic regenerator apparatus having a regenerator bed of material exhibiting the magnetocaloric effect, flow of heat transfer fluid through the bed is unbalanced, so that more fluid flows through the bed from the hot side of the bed to the cold side than from the cold side to the hot side. The excess heat transfer fluid is diverted back to the hot side of the bed. The diverted fluid may be passed through a heat exchanger to draw heat from a fluid to be cooled. The apparatus may be operated at cryogenic temperatures, and the heat transfer fluid may be helium gas and the fluid to be cooled may be hydrogen gas, which is liquified by the device. The apparatus can be formed in multiple stages to allow a greater span of cooling temperatures than a single stage, and each stage may be comprised of two bed parts. Where two bed parts are employed in each stage, a portion of the fluid passing from the hot side to the cold side of a first bed part which does not have a magnetic field applied thereto is diverted back to the cold side of the other bed part in the stage, where it is passed through to the hot side. The remainder of the fluid from the cold side of the bed part of the first stage is passed to the hot side of the bed part of the second stage.
International Nuclear Information System (INIS)
Wallsten, H.I.
1984-01-01
Apparatus for manufacturing articles is disclosed in which a preheated sheet of thermoplastic material is intermittently fed to present successive preheated portions of the sheet in a work station having a forming tool for forming articles in each successive sheet portion and a stamping tool for co-operating with the forming tool to stamp the formed articles from the sheet. The forming tool has a plurality of forming dies which are movable successively and cyclically into the work station for forming articles in respective successive sheet portions. After each forming operation the stamping tool is brought into engagement with a resilient counter-surface on the forming die to stamp from the sheet the articles formed by that die
Nuclear propulsion apparatus with alternate reactor segments
International Nuclear Information System (INIS)
Szekely, T.
1979-01-01
Nuclear propulsion apparatus comprising: (a) means for compressing incoming air; (b) nuclear fission reactor means for heating said air; (c) means for expanding a portion of the heated air to drive said compressing means; (d) said nuclear fission reactor means being divided into a plurality of radially extending segments; (e) means for directing a portion of the compressed air for heating through alternate segments of said reactor means and another portion of the compressed air for heating through the remaining segments of said reactor means; and (f) means for further expanding the heated air from said drive means and the remaining heated air from said reactor means through nozzle means to effect reactive thrust on said apparatus. 12 claims
Apparatus and method for radioactive waste screening
Akers, Douglas W.; Roybal, Lyle G.; Salomon, Hopi; Williams, Charles Leroy
2012-09-04
An apparatus and method relating to screening radioactive waste are disclosed for ensuring that at least one calculated parameter for the measurement data of a sample falls within a range between an upper limit and a lower limit prior to the sample being packaged for disposal. The apparatus includes a radiation detector configured for detecting radioactivity and radionuclide content of the of the sample of radioactive waste and generating measurement data in response thereto, and a collimator including at least one aperture to direct a field of view of the radiation detector. The method includes measuring a radioactive content of a sample, and calculating one or more parameters from the radioactive content of the sample.
Apparatus for measuring a concentration of radioactivity
International Nuclear Information System (INIS)
Tabuchi, H.; Ogushi, A.
1978-01-01
Disclosed is an apparatus for measuring concentration of radioactivity in a fluid circulating in a cooling system or a disposal system, etc., of a nuclear power plant (e.g. coolant), the apparatus having a plurality of sampling tubes with different diameters depending on the intensities of radioactivity, and the sampling tubes having valves for switching from one fluid to another fluid. The sampling tubes are connected to the system to a discharge pipe, and are disposed in the proximity of a radiation detector adapted to issue a signal representative of radiation. The issued signal is supplied to a multichannel pulse height analyzer and a data processing system providing an indication of the concentrations of radioactivities for respective radionuclides
Apparatus and method for treating waste material
International Nuclear Information System (INIS)
Allison, W.
1981-01-01
Apparatus is described for the packaging of waste material in a vessel, comprising: a vessel entry station having inlet and outlet doors; a filling station downstream of the vessel entry station and having a filling position to which vessels are transferred from the entry station through the outlet door, the filling station having filling means for introducing radioactive waste into the vessel; a mixing station having a mixing position to which a vessel is transferred from the filling position; a capping station having a capping position to which a vessel is transferred from the mixing position; and means for effecting transfer of a vessel through the apparatus. Radiation shielding is provided. (U.K.)
Energy Technology Data Exchange (ETDEWEB)
Muller, Norbert; Piechna, Janusz; Sun, Guangwei; Parraga, Pablo-Francisco
2018-01-02
A wave disc engine apparatus is provided. A further aspect employs a constricted nozzle in a wave rotor channel. A further aspect provides a sharp bend between an inlet and an outlet in a fluid pathway of a wave rotor, with the bend being spaced away from a peripheral edge of the wave rotor. A radial wave rotor for generating electricity in an automotive vehicle is disclosed in yet another aspect.
Thermal power measurement apparatus
International Nuclear Information System (INIS)
1981-01-01
Thermal power measurements are important in nuclear power plants, fossil-fuel plants and other closed loop systems such as heat exchangers and chemical reactors. The main object of this invention is to determine the enthalpy of a fluid using only acoustically determined sound speed and correlating the speed with enthalpy. An enthalpy change is measured between two points in the fluid flow: the apparatus is described in detail. (U.K.)
International Nuclear Information System (INIS)
Grady, J.K.
1985-01-01
X-ray apparatus is described which has a shutter between the X-ray source and the patient. The shutter controls the level of radiation to which the patient is exposed instead of merely discontinuing the electric power supplied to the source. When the shutter is opened a radiation sensor senses the level of X-radiation. When a preset quantity of X-radiation has been measured an exposure control closes the shutter. Instead of using the radiation sensor, the integrated power supplied to the anode of the X-ray source may be measured. (author)
International Nuclear Information System (INIS)
Dent, T.H.; Sumpman, W.C.; Wilhelm, J.J.
1981-01-01
The remote docking apparatus comprises a support plate with locking devices mounted thereon. The locking devices are capable of being inserted into tubular members for suspending the support plate therefrom. A vertical member is attached to the support plate with an attachment mechanism attached to the vertical member. A remote access manipulator is capable of being attached to the attachment mechanism so that the vertical member can position the remote access manipulator so that the remote access manipulator can be initially attached to the tubular members in a well defined manner
Kinematic X-Ray Analysis Apparatus
Koningsberger, D.C.; Brinkgreve, P.
1983-01-01
In an X-ray analysis apparatus, a moving mechanism is provided by a main guide member along which a main slide device can be displaced. Rotatably connected with the main slide device is a detector guide member along which a detection slide device is displaced. The main slide device, as well as the
Induction apparatus monitoring structural strains in liquid-metal-cooled nuclear reactor
International Nuclear Information System (INIS)
Dean, S.A.; Evans, R.A.
1981-01-01
An improved method of monitoring induced torsional and linear strains in the internal structures of liquid metal cooled nuclear reactors is described. An electrical induction apparatus indicates the variation of magnetic coupling caused by a ferromagnetic member of the apparatus being subjected to such strains. (U.K.)
Collective-field-corrected strong field approximation for laser-irradiated metal clusters
International Nuclear Information System (INIS)
Keil, Th; Bauer, D
2014-01-01
The strong field approximation (SFA) formulated in terms of so-called ‘quantum orbits’ led to much insight into intense-laser driven ionization dynamics. In plain SFA, the emitted electron is treated as a free electron in the laser field alone. However, with improving experimental techniques and more advanced numerical simulations, it becomes more and more obvious that the plain SFA misses interesting effects even on a qualitative level. Examples are holographic side lobes, the low-energy structure, radial patterns in photoelectron spectra at low kinetic energies and strongly rotated angular distributions. For this reason, increasing efforts have been recently devoted to Coulomb corrections of the SFA. In the current paper, we follow a similar line but consider ionization of metal clusters. It is known that photoelectrons from clusters can be much more energetic than those emitted from atoms or small molecules, especially if the Mie resonance of the expanding cluster is evoked. We develop a SFA that takes the collective field inside the cluster via the simple rigid-sphere model into account. Our approach is based on field-corrected quantum orbits so that the acceleration process (or any other spectral feature of interest) can be investigated in detail. (paper)
Apparatus and method for stabilization or oxidation of polymeric materials
Paulauskas, Felix L [Knoxville, TN; Sherman, Daniel M [Knoxville, TN
2010-01-19
An apparatus for treating polymeric materials comprises a treatment chamber adapted to maintain a selected atmosphere at a selected temperature; a means for supporting the polymeric material within the chamber; and, a source of ozone-containing gas, which decomposes at the selected temperature yielding at least one reactive oxidative species whereby the polymer is stabilized and cross linked through exposure to the oxidative species in the chamber at the selected temperature. The ozone may be generated by a plasma discharge or by various chemical processes. The apparatus may be configured for either batch-type or continuous-type processing. The apparatus and method are especially useful for preparing polymer fibers, particularly PAN fibers, for later carbonization treatments as well as to make flame-retardant fabrics.
Yu, Shuling; Yuan, Xuejie; Yang, Jing; Yuan, Jintao; Shi, Jiahua; Wang, Yali; Chen, Yuewen; Gao, Shufang
2015-01-01
An attractive method of generating second-order data was developed by a dropping technique to generate pH gradient simultaneously coupled with diode-array spectrophotometer scanning. A homemade apparatus designed for the pH gradient. The method and the homemade apparatus were used to simultaneously determine malachite green (MG) and crystal violet (CV) in water samples. The absorbance-pH second-order data of MG or CV were obtained from the spectra of MG or CV in a series of pH values of HCl-KCl solution. The second-order data of mixtures containing MG and CV that coexisted with interferents were analyzed using multidimensional partial least-squares with residual bilinearization. The method and homemade apparatus were used to simultaneously determine MG and CV in fish farming water samples and in river ones with satisfactory results. The presented method and the homemade apparatus could serve as an alternative tool to handle some analysis problems. Copyright © 2015 Elsevier B.V. All rights reserved.
Maintenance and control of apparatus for radiotherapy
International Nuclear Information System (INIS)
Wakui, Sho
1979-01-01
In order to perform the safe operation of radiotherapy apparatuses and to secure the accuracy in positioning patients and in setting up radiation beam, proper checking-up and maintenance schedule is necessary. Such schedule is described briefly and also the mechanical or electrical equipments designed for securing the safety and accuracy or eliminating in adequate operation are explained, especially on treatment tables and accessories, such as wedge filters, irradiation field indicators and pointers, and the devices for observing patients. The structures and the practical control of the following equipments are explained; standard treatment table, treatment table with a lifting column by oil pressure, mobile positioning control pedestal, positioning control pendaut, mechanical fuse cutter for the safeguard of table height movement, safety interlock to protect table from physical contact with radiation head in rotation and safeguard for arms of a patient in longitudinal movement of treatment table. For the maintenance and control of wedge filters, the kind of filter angle in use, the direction of filter in use and whether filter is used or not are exactly confirmed by adequate display. The direction mechanism of radiation field and the pointers are required to be strict for exact focusing of radiation. Various control apparatuses and monitoring apparatuses are described. (Kobatake, H.)
An apparatus for a complimentary treatment of spasmodic torticollis.
Saito, I; Weiss, T
1988-07-01
We have developed an apparatus for treating spasmodic torticollis that can be used at home both during intensive therapy and follow-up. The refractoriness of spasmodic torticollis requires patients to practice biofeedback training partly on a home basis. However, it is usually difficult for spasmodic torticollis patients to provide and handle electromyographic (EMG) biofeedback training instruments. The present apparatus has 2 parts: first, a harness with a light source which is fixed on both shoulders; second, a photoreceptor, operant system for rewarding effect, and a digital recorder. The light is adjusted to strike the photoreceptor on the forehead when headposition is normal. Subjects are asked to keep the operant system--e.g. a radio--activated. They are trained in various postures as sitting, standing and walking. This apparatus provides a chance of home training to augment and maintain the effect during therapeutic sessions and the follow-up period.
Desai, Parind M; Liew, Celine V; Heng, Paul W S
2013-02-14
The aim of this study was to develop a responsive disintegration test apparatus that is particularly suitable for rapidly disintegrating tablets (RDTs). The designed RDT disintegration apparatus consisted of disintegration compartment, stereomicroscope and high speed video camera. Computational fluid dynamics (CFD) was used to simulate 3 different designs of the compartment and to predict velocity and pressure patterns inside the compartment. The CFD preprocessor established the compartment models and the CFD solver determined the numerical solutions of the governing equations that described disintegration medium flow. Simulation was validated by good agreement between CFD and experimental results. Based on the results, the most suitable disintegration compartment was selected. Six types of commercial RDTs were used and disintegration times of these tablets were determined using the designed RDT disintegration apparatus and the USP disintegration apparatus. The results obtained using the designed apparatus correlated well to those obtained by the USP apparatus. Thus, the applied CFD approach had the potential to predict the fluid hydrodynamics for the design of optimal disintegration apparatus. The designed visiometric liquid jet-mediated disintegration apparatus for RDT provided efficient and precise determination of very short disintegration times of rapidly disintegrating dosage forms. Copyright © 2012 Elsevier B.V. All rights reserved.
Apparatus for combining oxygen and hydrogen
International Nuclear Information System (INIS)
Betz, E.C.
1977-01-01
An apparatus is described for catalytically combining hydrogen and oxygen which includes two concentric catalyst chambers arranged so that the outer chamber surrounds the inner chamber and the gas stream passes radially through the outer catalyst chamber. 10 claims, 2 figures
Apparatus for fuel replacement
International Nuclear Information System (INIS)
Imada, Takahiko.
1974-01-01
Object: To support a telescope mast such that no deforming load is applied to it even during massive vibration, it is held fixed at the time of fuel replacement to permit satisfactory remote control operation by automatic operation. Structure: The body of the fuel replacement apparatus is provided with telescope mast fixing means comprising a slide base supported for reciprocal movement with respect to a telescope mast, an operating arm pivoted at the slide base, a wrist member mounted on the free end of the operating arm and an engagement member for restricting the slide base and operating arm at the time of loading and unloading the fuel. When loading and unloading the fuel, the slide base and operating arm are restrained by the engagement member to reliably restrict the vibration of the telescope mast. When the fuel replacement apparatus is moved, the means provided on the operating arm is smoothly displaced to follow the swing (vibration) of the telescope mast to prevent the deforming load from being applied to the support portion or other areas. The wrist member supports the telescope mast such that it can be rotated while restraining movement in the axial direction, and it is provided with revolution drive means for rotating the telescope mast under remote control. (Kamimura, M.)
Apparatus to detect stable fractional charges on matter
International Nuclear Information System (INIS)
Vanderspek, R.
1980-04-01
The construction of an apparatus designed to detect stable fractional charges on matter, if they exist, to the level of 10 -24 per nucleon is reported and discussed. The charges on a stream of highly consistent droplets produced by the apparatus are determined by accurate measurement of the deflection of the droplets in falling through a static electric field. Maintenance of certain parameters of operation calculated to limit the random effects of electrical and aerodynamical disturbances on the droplets indicate a precision in the measurement of the charge on a droplet of 0.02e can be attained. 7 figures
Wortz, E. C.; Saur, A. J.; Nowlis, D. P.; Kendall, M. P.
1974-01-01
Results are presented of an initial experiment in a research program designed to develop objective techniques for psychological assessment of individuals and groups participating in long-duration space flights. Specifically examined is the rationale for utilizing measures of attention as an objective assessment technique. Subjects participating in the experiment performed various tasks (eg, playing matrix games which appeared on a display screen along with auditory stimuli). The psychophysiological reactions of the subjects were measured and are given. Previous research of various performance and psychophysiological methods of measuring attention is also discussed. The experiment design (independent and dependent variables) and apparatus (computers and display devices) are described and shown. Conclusions and recommendations are presented.
Apparatus for incinerating hazardous waste
Chang, R.C.W.
1994-12-20
An apparatus is described for incinerating wastes, including an incinerator having a combustion chamber, a fluid-tight shell enclosing the combustion chamber, an afterburner, an off-gas particulate removal system and an emergency off-gas cooling system. The region between the inner surface of the shell and the outer surface of the combustion chamber forms a cavity. Air is supplied to the cavity and heated as it passes over the outer surface of the combustion chamber. Heated air is drawn from the cavity and mixed with fuel for input into the combustion chamber. The pressure in the cavity is maintained at least approximately 2.5 cm WC higher than the pressure in the combustion chamber. Gases cannot leak from the combustion chamber since the pressure outside the chamber (inside the cavity) is higher than the pressure inside the chamber. The apparatus can be used to treat any combustible wastes, including biological wastes, toxic materials, low level radioactive wastes, and mixed hazardous and low level transuranic wastes. 1 figure.
Experimental studies of a zeeman-tuned xenon laser differential absorption apparatus.
Linford, G J
1973-06-01
A Zeeman-tuned cw xenon laser differential absorption device is described. The xenon laser was tuned by axial magnetic fields up to 5500 G generated by an unusually large water-cooled dc solenoid. Xenon laser lines at 3.37 micro, 3.51 micro, and 3.99 micro were tuned over ranges of 6 A, 6 A, and 11 A, respectively. To date, this apparatus has been used principally to study the details of formaldehyde absorption lines lying near the 3 .508-micro xenon laser transition. These experiments revealed that the observed absorption spectrum of formaldehyde exhibits a sufficiently unique spectral structure that the present technique may readily be used to measure relative concentrations of formaldehyde in samples of polluted air.
46 CFR 28.205 - Fireman's outfits and self-contained breathing apparatus.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Fireman's outfits and self-contained breathing apparatus... the Boundary Lines or With More Than 16 Individuals On Board, or for Fish Tender Vessels Engaged in the Aleutian Trade § 28.205 Fireman's outfits and self-contained breathing apparatus. (a) Each vessel...
Apparatus, System, and Method for Forward Osmosis in Water Reuse
Yangali-Quintanilla, Victor
2013-01-03
An apparatus, system, and method for desalinating water is presented. The invention relates to recovery of water from impaired water sources by using FO and seawater as draw solution (DS). The seawater becomes diluted over time and can be easily desalinated at very low pressures. Thus, a device consumes less energy when recovering water. The apparatus, system and method comprise an immersed forward osmosis cell.
Multicusp plasma containment apparatus
International Nuclear Information System (INIS)
Limpaecher, R.
1980-01-01
It has been discovered that plasma containment by a chamber having multi-pole magnetic cusp reflecting walls in combination with electronic injection for electrostatic containment provides the means for generating magnetic field free quiescent plasmas for practical application in ion-pumps, electronic switches, and the like. 1250 ''alnico v'' magnets 1/2 '' X 1/2 '' X 1 1/2 '' provide containment in one embodiment. Electromagnets embodying toroidal funneling extend the principle to fusion apparatus
Study on blood compatibility of the radiation sterilized disposable burette transfusion apparatus
International Nuclear Information System (INIS)
Chen Guochong; Liu Wen; Liu Qingfang
2011-01-01
The blood compatibility of the radiation sterilized disposable burette transfusion apparatus was investigated to provide evidence for the safety of radiation sterilized medical devices. The initial bacteria burden of the disposable burette transfusion apparatus was examined according to the ISO11737 standard, and the whole blood clotting time, prothrombin time, partial thromboplastin time and hemolysis rate of the samples were determined. There was no significant difference between the radiation sterilized samples and negative controls on WBCT, PT and PTT (p>0.05). Haemolysis test showed that the haemolysis rate of the sample sterilized by irradiation was 1.38%, which was coincidence with the criteria of the medical devices. After sterilization by irradiation, disposable burette transfusion apparatus show good blood compatibility, which could be considered that radiation sterilization is a biologically safe method for the medical apparatus. (authors)
Object Tracking Vision System for Mapping the UCN τ Apparatus Volume
Lumb, Rowan; UCNtau Collaboration
2016-09-01
The UCN τ collaboration has an immediate goal to measure the lifetime of the free neutron to within 0.1%, i.e. about 1 s. The UCN τ apparatus is a magneto-gravitational ``bottle'' system. This system holds low energy, or ultracold, neutrons in the apparatus with the constraint of gravity, and keeps these low energy neutrons from interacting with the bottle via a strong 1 T surface magnetic field created by a bowl-shaped array of permanent magnets. The apparatus is wrapped with energized coils to supply a magnetic field throughout the ''bottle'' volume to prevent depolarization of the neutrons. An object-tracking stereo-vision system will be presented that precisely tracks a Hall probe and allows a mapping of the magnetic field throughout the volume of the UCN τ bottle. The stereo-vision system utilizes two cameras and open source openCV software to track an object's 3-d position in space in real time. The desired resolution is +/-1 mm resolution along each axis. The vision system is being used as part of an even larger system to map the magnetic field of the UCN τ apparatus and expose any possible systematic effects due to field cancellation or low field points which could allow neutrons to depolarize and possibly escape from the apparatus undetected. Tennessee Technological University.
International Nuclear Information System (INIS)
Yilmaz, Saim; Sindel, Timur; Ceken, Kagan; Alimoglu, Emel; Lueleci, Ersin
2001-01-01
Purpose: To investigate the value of the retrograde popliteal artery approach for the percutaneous intentional extraluminal recanalization (PIER) of long superficial femoral artery (SFA) occlusions.Methods: During a period of 17 months, PIER through ultrasound-guided retrograde popliteal artery puncture was performed for 39 long SFA occlusions in 37 patients. In six patients, six additional iliac artery stenoses were also treated via the popliteal approach.Results: The procedure was technically successful in 32 (82%) of 39 SFA occlusions; in 29, lesions were treated with balloon angioplasty alone, and in three, stents were also used. Cumulative patency rate was 66% at 6 months, 62% at 1 year, and 59% at 18 months. Additional iliac artery stenoses were successfully treated in the same session. Complications included two minor hematomas and two SFA ruptures, which required no treatment.Conclusion: PIER through retrograde popliteal puncture is a safe and effective method in the treatment of long femoropopliteal occlusions, with a high technical success, low complication rate and a reasonable short-term patency rate. The technique offers an alternative in cases where standard PIER is unsuccessful or contraindicated
Method and apparatus for dismantling and disposing of fuel assemblies
International Nuclear Information System (INIS)
Meuschke, R.E.; Schulties, J.R.
1985-01-01
This invention relates to apparatus and a method for dismantling, shearing, and compacting a fuel assembly frame skeleton. It uses an apparatus capable of hanging or being supported in the transfer canal of the spent fuel pit of the fuel handling building. This apparatus includes a bottom nozzle shear which is held under water to shear off the bottom nozzle and convey it to a scrap transfer bin. Then the remaining portion is brought to a skeleton compactor and shear, also held under water. The compacted skeleton is sheared into a number of smaller portions. After compacting and shearing, the individual portions are fed to the scrap transfer bin. The compacted and sheared skeleton assembly may be placed into a container that is adapted to hold four skeletons for off-site removal
Apparatus and method for oxidation and stabilization of polymeric materials
Paulauskas, Felix L [Knoxville, TN; White, Terry L [Knoxville, TN; Sherman, Daniel M [Knoxville, TN
2009-05-19
An apparatus for treating polymeric materials comprises a treatment chamber adapted to maintain a selected atmosphere; a means for supporting the polymeric material within the chamber; and, a source of plasma-derived gas containing at least one reactive oxidative species whereby the polymer is stabilized and cross linked through exposure to the oxidative species in the chamber at a selected temperature. The polymer may be directly exposed to the plasma, or alternatively, the plasma may be established in a separate volume from which the reactive species may be extracted and introduced into the vicinity of the polymer. The apparatus may be configured for either batch-type or continuous-type processing. The apparatus and method are especially useful for preparing polymer fibers, particularly PAN fibers, for later carbonization treatments.
Therapeutic radiation apparatus having an optical pointer
International Nuclear Information System (INIS)
1981-01-01
This patent specification relates to a therapeutic irradiating apparatus including a radiation source arranged to provide a beam of penetrating radiation and an optical alignment indicator comprising at least two light sources each provided with means to provide a planar divergent beam of light located so that at least two light beams intersect along a line substantially coincident with the central axis of the path of the radiation beam. The claim relates to cylindrical lenses providing the means of providing the divergent beams, and to lasers as the light sources. Claims are also made for the apparatus providing means of supporting and aligning the patient, and for disposing the light sources so that the exit point of the radiation beam is illuminated. (U.K.)
Data structures and apparatuses for representing knowledge
Hohimer, Ryan E; Thomson, Judi R; Harvey, William J; Paulson, Patrick R; Whiting, Mark A; Tratz, Stephen C; Chappell, Alan R; Butner, Robert S
2014-02-18
Data structures and apparatuses to represent knowledge are disclosed. The processes can comprise labeling elements in a knowledge signature according to concepts in an ontology and populating the elements with confidence values. The data structures can comprise knowledge signatures stored on computer-readable media. The knowledge signatures comprise a matrix structure having elements labeled according to concepts in an ontology, wherein the value of the element represents a confidence that the concept is present in an information space. The apparatus can comprise a knowledge representation unit having at least one ontology stored on a computer-readable medium, at least one data-receiving device, and a processor configured to generate knowledge signatures by comparing datasets obtained by the data-receiving devices to the ontologies.
Apparatus for monitoring two-phase flow
Sheppard, John D.; Tong, Long S.
1977-03-01
A method and apparatus for monitoring two-phase flow is provided that is particularly related to the monitoring of transient two-phase (liquid-vapor) flow rates such as may occur during a pressurized water reactor core blow-down. The present invention essentially comprises the use of flanged wire screens or similar devices, such as perforated plates, to produce certain desirable effects in the flow regime for monitoring purposes. One desirable effect is a measurable and reproducible pressure drop across the screen. The pressure drop can be characterized for various known flow rates and then used to monitor nonhomogeneous flow regimes. Another useful effect of the use of screens or plates in nonhomogeneous flow is that such apparatus tends to create a uniformly dispersed flow regime in the immediate downstream vicinity. This is a desirable effect because it usually increases the accuracy of flow rate measurements determined by conventional methods.
Light Emitting, Photovoltaic or Other Electronic Apparatus and System
Ray, William Johnstone (Inventor); Lowenthal, Mark D. (Inventor); Shotton, Neil O. (Inventor); Blanchard, Richard A. (Inventor); Lewandowski, Mark Allan (Inventor); Fuller, Kirk A. (Inventor); Frazier, Donald Odell (Inventor)
2018-01-01
The present invention provides an electronic apparatus, such as a lighting device comprised of light emitting diodes (LEDs) or a power generating apparatus comprising photovoltaic diodes, which may be created through a printing process, using a semiconductor or other substrate particle ink or suspension and using a lens particle ink or suspension. An exemplary apparatus comprises a base; at least one first conductor; a plurality of diodes coupled to the at least one first conductor; at least one second conductor coupled to the plurality of diodes; and a plurality of lenses suspended in a polymer deposited or attached over the diodes. The lenses and the suspending polymer have different indices of refraction. In some embodiments, the lenses and diodes are substantially spherical, and have a ratio of mean diameters or lengths between about 10:1 and 2:1. The diodes may be LEDs or photovoltaic diodes, and in some embodiments, have a junction formed at least partially as a hemispherical shell or cap.
International Nuclear Information System (INIS)
Yamada, Toshiki; Shinohara, Hidenori; Kamikado, Toshiya; Okuno, Yoshishige; Suzuki, Hitoshi; Mashiko, Shinro; Yokoyama, Shiyoshi
2008-01-01
The spray-jet molecular beam apparatus enabled us to produce a molecular beam of non-volatile molecules under high vacuum from a sprayed mist of sample solutions. The apparatus has been used in spectroscopic studies and as a means of molecular beam deposition. We analyzed the molecular beam, consisting of non-volatile, solvent, and carrier-gas molecules, by using femtosecond- and nanosecond- laser mass spectroscopy. The information thus obtained provided insight into the molecular beam produced by the spray-jet technique
Dynamic Three-Dimensional Geometry of the Aortic Valve Apparatus-A Feasibility Study
Khamooshian, Arash; Amador, Yannis; Hai, Ting; Jeganathan, Jelliffe; Saraf, Maria; Mahmood, Eitezaz; Matyal, Robina; Khabbaz, Kamal R.; Mariani, Massimo; Mahmood, Feroze
OBJECTIVE: To provide (1) an overview of the aortic valve (AV) apparatus anatomy and nomenclature, and (2) data regarding the normal AV apparatus geometry and dynamism during the cardiac cycle obtained from three-dimensional transesophageal echocardiography (3D TEE). DESIGN: Retrospective
Method and apparatus for measuring electromagnetic radiation
Been, J. F. (Inventor)
1973-01-01
An apparatus and method are described in which the capacitance of a semiconductor junction subjected to an electromagnetic radiation field is utilized to indicate the intensity or strength of the radiation.
Charge exchange cooling in the tandem mirror plasma confinement apparatus
Logan, B. Grant
1978-01-01
Method and apparatus for cooling a plasma of warm charged species confined in the center mirror cell of the tandem mirror apparatus by injecting cold neutral species of the plasma into at least one mirroring region of the center mirror cell, the cooling due to the loss of warm charged species through charge exchange with the cold neutral species with resulting diffusion of the warm neutral species out of the plasma.
Method and apparatus for controlling gas evolution from chemical reactions
Skorpik, James R.; Dodson, Michael G.
1999-01-01
The present invention is directed toward monitoring a thermally driven gas evolving chemical reaction with an acoustic apparatus. Signals from the acoustic apparatus are used to control a heater to prevent a run-away condition. A digestion module in combination with a robotic arm further automate physical handling of sample material reaction vessels. The invention is especially useful for carrying out sample procedures defined in EPA Methods SW-846.
Charge exchange cooling in the tandem mirror plasma confinement apparatus
International Nuclear Information System (INIS)
Logan, B.G.
1978-01-01
A method and apparatus are described for cooling a plasma confined in the center mirror cell of the tandem mirror apparatus by injecting cold neutral species of the plasma into at least one mirroring region of the center mirror cell. The cooling is due to the loss of warm charged species through charge exchange with the cold neutral species with resulting diffusion of the warm neutral species out of the plasma
CATEGORICAL IMAGE COMPONENTS IN THE FORMING SYSTEM OF A MARKETING TECHNIQUES MANAGER’S IMAGE CULTURE
Directory of Open Access Journals (Sweden)
Anna Borisovna Cherednyakova
2015-08-01
Full Text Available Based on the understanding of the image culture formation of managers of marketing techniques, as a representative of the social and communication interaction of public structures, categorical apparatus of image culture with an emphasis on the etymology of the image, as an integral component of image culture was analyzed. Categorical components of the image are presented from the standpoint of image culture, as personal new formation, an integral part of the professional activity of the marketing techniques manager: object-communicative categorical component, subject-activity categorical component of image, personality-oriented categorical component, value-acmeological categorical component of image.The aim is to identify and justify the image categorical components as a component of image culture of the marketing techniques manager.Method and methodology of work – a general scientific research approach reflecting scientific apparatus of research.Results. Categorical components of the image, as an image culture component of manager of marketing techniques were defined.Practical implication of the results. The theoretical part of «Imageology» course, special course «Image culture of manager of marketing techniques», the theoretical and methodological study and the formation of image culture.
Irradiated fuel examination using the Cerenkov technique
International Nuclear Information System (INIS)
Nicholson, N.; Dowdy, E.J.
1981-03-01
A technique for monitoring irradiated nuclear fuel inventories located in water filled storage ponds has been developed and demonstrated. This technique provides sufficient qualitative information to be useful as a confirmatory technique to International Atomic Energy Agency inspectors. Measurements have been made on the Cerenkov glow light intensity from irradiated fuel that show the intensity of this light to be proportional to the cooling time. Fieldable instruments used in several tests confirm that such measurements can be made easily and rapidly, without fuel assembly movement or the introduction of apparatus into the storage ponds. The Cerenkov technique and instrumentation have been shown to be of potential use to operators of reactor spent fuel facilities and away from reactor storage facilities, and to the International Atomic Energy Agency inspectors who provide surveillance of the irradiated fuel stored in these facilities
International Nuclear Information System (INIS)
Herrschaft, H.
1976-01-01
The invention relates to a measuring probe for an isotope diagnostics apparatus to determine the distribution of radioactive substances in a body by measuring the radiation emanating from this body by means of a multiplicity of measuring probes directed simultaneously towards areas of measuring surfae and carried in guidances of a holding block. The measuring results of the individual probes are recorded separately, thus allowing the possibility of being evaluated separately, too. Measuring probes of this kind are used in multi-channel measuring objects and are useful particularly for determining the regional cerebral blood flow. (orig./ORU) [de
Tomographic scanning apparatus
International Nuclear Information System (INIS)
Abele, M.
1983-01-01
A computerized tomographic scanning apparatus suitable for diagnosis and for improving target identification in stereotactic neurosurgery is described. It consists of a base, a source of penetrating energy, a detector which produces scanning signals and detector positioning means. A frame with top and bottom arms secures the detector and source to the top and bottom arms respectively. A drive mechanism rotates the frame about an axis along which the frame may also be moved. Finally, the detector may be moved relative to the bottom arm in a direction contrary to the rotation of the frame. (U.K.)
Double bypasses soxhlet apparatus for extraction of piperine from Piper nigrum
Directory of Open Access Journals (Sweden)
R. Subramanian
2016-09-01
Full Text Available A simple modified soxhlet extractor, double bypasses sidearm soxhlet apparatus (DBSA was designed and employed for extraction of piperine from Piper nigrum. Total extraction time, time taken for a cycle and yield observed in the double bypass sidearm soxhlet apparatus was compared with the soxhlet apparatus. Extraction time, time taken for an extraction cycle and yield of crude piperine obtained in DBSA were 12 ± 1 h, 8 ± 1.00 min, and 3.90 ± 0.10 g whereas the results obtained in the soxhlet method were 22 ± 1 h, 16 ± 1.00 min, and 3.80 ± 0.18 g, respectively. The results obtained in DBSA have demonstrated that this approach is as efficient as the soxhlet apparatus with drastic reduction of extraction time. On the basis of this result, we propose DBSA as the most efficient method and an alternative to the soxhlet extractor.
Apparatus for inspecting a irradiated nuclear fuel rod
International Nuclear Information System (INIS)
Saura, Hideaki; Yonemura, Eizo.
1975-01-01
Object: To increase safety and inspection efficiency by operating irradiated fuel rods, which are accommodated in a water-filled pool after being taken out from the reactor. Structure: When making inspection of irradiated fuel rods, particularly the cladding tube thereof, a fuel box which stores irradiated fuel rods in a water pool is secured to a securement mechanism with slime removal apparatus and inspection apparatus on either side capable of being vertically moved, and it is then stopped at a water depth of about 2 meters. When the lid of the box is opened, irradiated fuel rods are taken out with gripping means and then secured together with the gripping means to an operation base provided on the outside of the pool. Thereafter, the box is lowered by operating pedals on the operation base to completely pull out the irradiated fuel rods from the box, and the irradiated fuel rods are then horizontally moved and then held in a suspended state. Next a slime removal apparatus in raised by operating pedals and an inspection element assembly are progressively raised for inspection of the state of the cladding tube of each fuel rod after removal of slime therefrom. (Nakamura, S.)
Low-energy ion-beam deposition apparatus equipped with surface analysis system
International Nuclear Information System (INIS)
Ohno, Hideki; Aoki, Yasushi; Nagai, Siro.
1994-10-01
A sophisticated apparatus for low energy ion beam deposition (IBD) was installed at Takasaki Radiation Chemistry Research Establishment of JAERI in March 1991. The apparatus is composed of an IBD system and a real time/in-situ surface analysis system for diagnosing deposited thin films. The IBD system provides various kinds of low energy ion down to 10 eV with current density of 10 μA/cm 2 and irradiation area of 15x15 mm 2 . The surface analysis system consists of RHEED, AES, ISS and SIMS. This report describes the characteristics and the operation procedure of the apparatus together with some experimental results on depositing thin carbon films. (author)
Improvements relating to apparatus for examining bodies by means of penetrating radiation
International Nuclear Information System (INIS)
Hounsfield, G.N.
1977-01-01
Improved radiographic apparatus is described for examining the human body. It is applicable to either X- or γ-radiation. Some disadvantages of the apparatus described in BP 1283915 are pointed out and the present apparatus seeks to reduce these disadvantages. One such disadvantage is that the time taken by scanning is relatively long since the transverse scanning has to be sufficiently slow to allow an adequate photon count to be obtained on each of closely space parallel beam paths; this affects the results obtained from parts of the patient's body liable to be obscured by movement of the patient's organs. The apparatus described includes means for orbiting the source and detector around the body so as to irradiate a planar section of the body from a number of different directions, with means for moving the source and detector laterally so as to scan the radiation across the planar section. (U.K.)
Pyrolysis process and apparatus
Lee, Chang-Kuei
1983-01-01
This invention discloses a process and apparatus for pyrolyzing particulate coal by heating with a particulate solid heating media in a transport reactor. The invention tends to dampen fluctuations in the flow of heating media upstream of the pyrolysis zone, and by so doing forms a substantially continuous and substantially uniform annular column of heating media flowing downwardly along the inside diameter of the reactor. The invention is particularly useful for bituminous or agglomerative type coals.
Pulse radiolysis apparatus for monitoring at 2000 Å
DEFF Research Database (Denmark)
Christensen, H.C.; Nilsson, G.; Pagsberg, Palle Bjørn
1969-01-01
A pulse radiolysis apparatus with photometric monitoring has been built around an 11 MeV, 250 mA peak current, linac that delivers single 0.25 to 4 μsec pulses. The novel features of the apparatus include (1) a 450 W xenon lamp as the analyzing light source which in pulsed operation had a 25 times...... increased luminance; (2) a fast electronic switch that cut out the signal due to the Cerenkov radiation; (3) a secondary emission chamber that allowed the simultaneous measurement of the current and the direction of the pulsed electron beam; and (4) a system for remote controlled change of liquid samples...
Power control apparatus and methods for electric vehicles
Gadh, Rajit; Chung, Ching-Yen; Chu, Chi-Cheng; Qiu, Li
2016-03-22
Electric vehicle (EV) charging apparatus and methods are described which allow the sharing of charge current between multiple vehicles connected to a single source of charging energy. In addition, this charge sharing can be performed in a grid-friendly manner by lowering current supplied to EVs when necessary in order to satisfy the needs of the grid, or building operator. The apparatus and methods can be integrated into charging stations or can be implemented with a middle-man approach in which a multiple EV charging box, which includes an EV emulator and multiple pilot signal generation circuits, is coupled to a single EV charge station.
The new PVLAS apparatus for detection of magnetic birefringence of vacuum
International Nuclear Information System (INIS)
Della Valle, F.; Di Domenico, G.; Gastaldi, U.; Milotti, E.; Messineo, G.; Pengo, R.; Piemontese, L.; Ruoso, G.; Zavattini, G.
2013-01-01
The PVLAS experiment aims at the observation and measurement of the effect of magnetic birefringence of vacuum (MBV) predicted by Quantum Electrodynamics. We describe here the new PVLAS apparatus which is currently being set up in INFN Ferrara. The apparatus features two rotating permanent dipole magnets and an ellipsometer operating under UHV with a high finesse Fabry–Perot cavity
A new apparatus for electron-ion multiple coincidence momentum imaging spectroscopy
International Nuclear Information System (INIS)
Morishita, Y.; Kato, M.; Pruemper, G.; Liu, X.-J.; Lischke, T.; Ueda, K.; Tamenori, Y.; Oura, M.; Yamaoka, H.; Suzuki, I.H.; Saito, N.
2006-01-01
We have developed a new experimental apparatus for the electron-ion multiple coincidence momentum imaging spectroscopy in order to obtain the angular distributions of vibration-resolved photoelectrons from molecules fixed in space. The apparatus consists of a four-stage molecular supersonic jet and a spectrometer analyzing three-dimensional momenta of fragment ions and electrons in coincidence
Apparatus for distillation of bituminous material
Energy Technology Data Exchange (ETDEWEB)
Carthaus, E; von Rittersberg, K; Abraham, A
1917-05-03
Apparatus for dry distillation of bituminous material, such as oil shale and brown coal with simultaneous fractional separation of the distillate, consists in the fact, that the domed water-cooled condenser, arranged above the conveyer carrying it, is divided by double vertical partitions in the chamber.
Apparatus for monitoring two-phase flow
International Nuclear Information System (INIS)
Sheppard, J.D.; Tong, L.S.
1977-01-01
A method and apparatus for monitoring two-phase flow is provided that is particularly related to the monitoring of transient two-phase (liquid-vapor) flow rates such as may occur during a pressurized water reactor core blow-down. The present invention essentially comprises the use of flanged wire screens or similar devices, such as perforated plates, to produce certain desirable effects in the flow regime for monitoring purposes. One desirable effect is a measurable and reproducible pressure drop across the screen. The pressure drop can be characterized for various known flow rates and then used to monitor nonhomogeneous flow regimes. Another useful effect of the use of screens or plates in nonhomogeneous flow is that such apparatus tends to create a uniformly dispersed flow regime in the immediate downstream vicinity. This is a desirable effect because it usually increases the accuracy of flow rate measurements determined by conventional methods. 3 claims, 9 figures
An apparatus to search for free neutron-antineutron oscillations
International Nuclear Information System (INIS)
Bressi, G.; Calligarich, E.; Cambiaghi, M.; Dolfini, R.; Gigli Berzolari, A.; Lanza, A.; Liguori, G.; Mauri, F.; Piazzoli, A.; Ratti, S.P.; Scannicchio, D.; Torre, P.; Conversi, M.; De Zorzi, G.; Massa, F.; Zanello, D.; Cardarelli, R.; Santonico, R.; Terrani, M.
1987-01-01
After recalling the phenomenology of neutron-antineutron oscillations expected to occur if the baryon number is not rigorously conserved, the apparatus developed and used in a search for such a process, currently being carried out at the Pavia nuclear reactor, is described in some detail. The apparatus involves a large volume neutron channel (≅ 20 m 3 ) in which the earth magnetic field has been reduced by a factor 50, and large area detectors (scintillators, flash chambers and 'resistive plate counters') operating under conditions of extremely severe background from the reactor. (orig.)
Apparatus for posting materials into and out of enclosures
International Nuclear Information System (INIS)
Sperinck, W.A.; Ashcroft, K.C.
1986-01-01
The patent concerns an apparatus for posting toxic or radioactive materials into and out of a high integrity enclosure, such as a glovebox, through a port in a wall of the enclosure. The apparatus comprises a container for the materials, with a lid which is engageable with a door for the port, and the container is supported in a cradle. The door cannot be opened in the absence of a container in the cradle, and the container cannot be removed when the door and lid unit is away from the port. (UK)
Apparatus for producing carbon-coated nanoparticles and carbon nanospheres
Energy Technology Data Exchange (ETDEWEB)
Perry, W. Lee; Weigle, John C.; Phillips, Jonathan
2015-10-20
An apparatus for producing carbon-coated nano- or micron-scale particles comprising a container for entraining particles in an aerosol gas, providing an inlet for carbon-containing gas, providing an inlet for plasma gas, a proximate torch for mixing the aerosol gas, the carbon-containing gas, and the plasma gas, bombarding the mixed gases with microwaves, and providing a collection device for gathering the resulting carbon-coated nano- or micron-scale particles. Also disclosed is a method and apparatus for making hollow carbon nano- or micro-scale spheres.
Apparatus and method for magnetically unloading a rotor bearing
Energy Technology Data Exchange (ETDEWEB)
Sanders, Seth Robert
2018-02-13
An apparatus and method for unloading a rotor bearing is described. The apparatus includes an electromagnet for levitating the rotor. In one embodiment, a sensor of the magnetic field near the electromagnet is used to control the current to levitate the rotor. In another embodiment, a method is provided that includes rotating the rotor, increasing the current to levitate the rotor and decrease the gap between electromagnet and rotor, and then reducing the current to levitate the rotor with a minimal amount of electric power to the electromagnet.
Method and apparatus for vibrating a substrate during material formation
Bailey, Jeffrey A [Richland, WA; Roger, Johnson N [Richland, WA; John, Munley T [Benton City, WA; Walter, Park R [Benton City, WA
2008-10-21
A method and apparatus for affecting the properties of a material include vibrating the material during its formation (i.e., "surface sifting"). The method includes the steps of providing a material formation device and applying a plurality of vibrations to the material during formation, which vibrations are oscillations having dissimilar, non-harmonic frequencies and at least two different directions. The apparatus includes a plurality of vibration sources that impart vibrations to the material.
Safety apparatus for serious radioactive accidents (1962)
International Nuclear Information System (INIS)
Estournel, R.; Rodier, J.
1962-01-01
In the case of a serious radioactive accident, radioactive dust and gases may be released into the atmosphere. It is therefore necessary to be able to evaluate rapidly the importance of the risk to the surrounding population, and to be able to ensure, even in the event of an evacuation of the Centre, the continuation of the radioactivity analyses and the decontamination of the personnel. For this, the Anti-radiation Protection Service at Marcoule has organised mobile detection teams and designed a mobile laboratory and a mobile shower-unit. After describing the duty of the mobile teams, the report gives a description of the apparatus which would be used at the Marcoule Centre in the case of a serious radioactive accident. The method of using this apparatus is given. (authors) [fr
Apparatus and method for assembling fuel elements
International Nuclear Information System (INIS)
Arya, S.P.
1978-01-01
A nuclear fuel element assembling method and apparatus is preferably operable under programmed control unit to receive fuel rods from storage, arrange them into axially aligned stacks of closely monitored length, and transfer the stacks of fuel rods to a loading device for insertion into longitudinal passages in the fuel elements. In order to handle large numbers of one or more classifications of fuel rods or other cylindrical parts, the assembling apparatus includes at least two feed troughs each formed by a pair of screw members with a movable table having a plurality of stacking troughs for alignment with the feed troughs and with a conveyor for delivering the stacks to the loading device, the fuel rods being moved along the stacking troughs upon a fluid cushion. 23 claims, 6 figures
Apparatus, system, and method for traffic monitoring
Claudel, Christian G.
2016-08-25
An apparatus, system, and method for traffic monitory can have a Lagrangian inertial measurement unit. The Lagrangian inertial measurement unit can have a processor, an accelerometer, a gyroscope, and/or a wireless transmitter. The processor can have an integrated direction cosine matrix. The accelerometer can be configured to measure linear accelerations of a vehicle and/or can communicate measured linear acceleration to the processor. The gyroscope can be configured to measure rotational accelerations of the vehicle and/or can communicate measured rotational acceleration to the processor. The processor can be configured to calculate estimated vehicle speed and/or estimated vehicle attitude. The wireless transmitter can be configured to wirelessly transmit estimated vehicle speed and/or estimated vehicle attitude. The apparatus, system, and method can be integrated with a wireless sensor network.
A low cost apparatus for measuring the xylem hydraulic conductance in plants
Directory of Open Access Journals (Sweden)
Luciano Pereira
2012-01-01
Full Text Available Plant yield and resistance to drought are directly related to the efficiency of the xylem hydraulic conductance and the ability of this system to avoid interrupting the flow of water. In this paper we described in detail the assembling of an apparatus proposed by TYREE et al. (2002, and its calibration, as well as low cost adaptations that make the equipment accessible for everyone working in this research area. The apparatus allows measuring the conductance in parts of roots or shoots (root ramifications or branches, or in the whole system, in the case of small plants or seedlings. The apparatus can also be used to measure the reduction of conductance by embolism of the xylem vessels. Data on the hydraulic conductance of eucalyptus seedlings obtained here and other reports in the literature confirm the applicability of the apparatus in physiological studies on the relationship between productivity and water stress.
Diseases of the branquial apparatus
International Nuclear Information System (INIS)
Perez-Candela, V.; Wiehoff, A.; Avial, R.
2000-01-01
To correlate ht embryologic and radiologic findings in the branchial apparatus or system with the anomalies that can occur. We reviewed the cases of branchial anomalies examined over the past 6 years, finding periparotid cysts at the first branchial cleft (n=2), cysts (n=13) and fistulas (n=4) at the second, and cysts (n=2) and thymopharyngeal cysts (n=3) at the third. The studies included ultrasound, computed tomography, magnetic resonance imaging and fistulography. All the patients underwent surgery, with histological confirmation. Knowledge of the embryology of the branchial apparatus or system helps in the understanding of anomalies, which appear as cervical cystic masses, mainly located along the anterior border of the sternocleidomastoid (SCM) muscle, or as fistulas running from the exterior to the pharyngeal lumen at the level of the tonsillar fossa, sometimes forming sinuses, that is fistulas that are blind at either the external or internal end. The most common anomalies arise from the second branchial cleft and are easily diagnosed in the presence of a cystic mass located to one side of the SCM muscle, behind the submandibular gland and occupying the carotid space. (Author) 14 refs
Nuclear fuel rod loading apparatus
International Nuclear Information System (INIS)
King, H.B.; Macivergan, R.; Mckenzie, G.W.
1980-01-01
An apparatus incorporating a microprocessor control is provided for automatically loading nuclear fuel pellets into fuel rods commonly used in nuclear reactor cores. The apparatus comprises a split ''v'' trough for assembling segments of fuel pellets in rows and a shuttle to receive the fuel pellets from the split ''v'' trough when the two sides of the split ''v'' trough are opened. The pellets are weighed while in the shuttle, and the shuttle then moves the pellets into alignment with a fuel rod. A guide bushing is provided to assist the transfer of the pellets into the fuel rod. A rod carousel which holds a plurality of fuel rods presents the proper rod to the guide bushing at the appropriate stage in the loading sequence. The bushing advances to engage the fuel rod, and the shuttle advances to engage the guide bushing. The pellets are then loaded into the fuel rod by a motor operated push rod. The guide bushing includes a photocell utilized in conjunction with the push rod to measure the length of the row of fuel pellets inserted in the fuel rod
Conveyor with rotary airlock apparatus
Kronbert, J.W.
1993-01-01
This invention is comprised of an apparatus for transferring objects from a first region to a second region, the first and second regions having differing atmospheric environments. The apparatus includes a shell having an entrance and an exit, a conveyer belt running through the shell from the entrance to the exit, and a horizontally mounted `revolving door` with at least four vanes revolving about its axis. The inner surface of the shell and the top surface of the conveyer belt act as opposing walls of the `revolving door`. The conveyer belt dips as it passes under but against the revolving vanes so as not to interfere with them but to engage at least two of the vanes and define thereby a moving chamber. Preferably, the conveyer belt has ridges or grooves on its surface that engage the edges of the vanes and act to rotate the vane assembly. Conduits are provided that communicate with the interior of the shell and allow the adjustment of the atmosphere of the moving chamber or recovery of constituents of the atmosphere of the first region from the moving chamber before they escape to the second region.
Nuclear reactor core servicing apparatus
International Nuclear Information System (INIS)
Andrea, C.
1977-01-01
Disclosed is an improved core servicing apparatus for a nuclear reactor of the type having a reactor vessel, a vessel head having a head penetration therethrough, a removable plug adapted to fit in the head penetration, and a core of the type having an array of elongated assemblies. The improved core servicing apparatus comprises a plurality of support columns suspended from the removable plug and extending downward toward the nuclear core, rigid support means carried by each of the support columns, and a plurality of servicing means for each of the support columns for servicing a plurality of assemblies. Each of the plurality of servicing means for each of the support columns is fixedly supported in a fixed array from the rigid support means. Means are provided for rotating the rigid support means and servicing means between condensed and expanded positions. When in the condensed position, the rigid support means and servicing means lie completely within the coextensive boundaries of the plug, and when in the expanded position, some of the rigid support means and servicing means lie without the coextensive boundaries of the plug
Pipe and hose decontamination apparatus
International Nuclear Information System (INIS)
Fowler, D.E.
1985-01-01
A pipe and hose decontamination apparatus is disclosed using freshly filtered high pressure Freon solvent in an integrated closed loop to remove radioactive particles or other contaminants from items having a long cylindrical geometry such as hoses, pipes, cables and the like. The pipe and hose decontamination apparatus comprises a chamber capable of accomodating a long cylindrical work piece to be decontaminated. The chamber has a downward sloped bottom draining to a solvent holding tank. An entrance zone, a cleaning zone and an exit drying zone are defined within the chamber by removable partitions having slotted rubber gaskets in their centers. The entrance and exit drying zones contain a horizontally mounted cylindrical housing which supports in combination a plurality of slotted rubber gaskets and circular brushes to initiate mechanical decontamination. Solvent is delivered at high pressure to a spray ring located in the cleaning zone having a plurality of nozzles surrounding the work piece. The solvent drains into a solvent holding tank located below the nozzles and means are provided for circulating the solvent to and from a solvent cleaning, distilling and filter unit
Filter apparatus for actively reducing noise
Berkhoff, Arthur P.; Nijsse, G.
2010-01-01
A filter apparatus for reducing noise from a primary noise source, comprising a secondary source signal connector for generating secondary noise to reduce said primary noise and a sensor connector for connecting to a sensor for measuring said primary and secondary noise as an error signal. A first
Apparatus and method for reconstructing data
International Nuclear Information System (INIS)
1981-01-01
A method and apparatus is described for constructing a two-dimensional picture of an object slice from linear projections of radiation not absorbed or scattered by the object, using convolution methods of data reconstruction, useful in the fields of medical radiology, microscopy, and non-destructive testing. (U.K.)
Method and apparatus for calibrating spectrophotometers
Schreutelkamp, F.H.
2003-01-01
The present invention relates to a method of calibrating spectrophotometers by placing one or more filters in the light path of the spectrophotometer and measuring the amount of radiation by means of a detector. The present invention furthermore relates to an apparatus to be used with such a method.
Apparatus, system, and method for traffic monitoring
Claudel, Christian G.; Mousa, Mustafa; Abdulaal, Mohammed
2016-01-01
An apparatus, system, and method for traffic monitory can have a Lagrangian inertial measurement unit. The Lagrangian inertial measurement unit can have a processor, an accelerometer, a gyroscope, and/or a wireless transmitter. The processor can
Method and apparatus of prefetching streams of varying prefetch depth
Gara, Alan [Mount Kisco, NY; Ohmacht, Martin [Yorktown Heights, NY; Salapura, Valentina [Chappaqua, NY; Sugavanam, Krishnan [Mahopac, NY; Hoenicke, Dirk [Seebruck-Seeon, DE
2012-01-24
Method and apparatus of prefetching streams of varying prefetch depth dynamically changes the depth of prefetching so that the number of multiple streams as well as the hit rate of a single stream are optimized. The method and apparatus in one aspect monitor a plurality of load requests from a processing unit for data in a prefetch buffer, determine an access pattern associated with the plurality of load requests and adjust a prefetch depth according to the access pattern.
Vibration damping method and apparatus
Redmond, James M.; Barney, Patrick S.; Parker, Gordon G.; Smith, David A.
1999-01-01
The present invention provides vibration damping method and apparatus that can damp vibration in more than one direction without requiring disassembly, that can accommodate varying tool dimensions without requiring re-tuning, and that does not interfere with tool tip operations and cooling. The present invention provides active dampening by generating bending moments internal to a structure such as a boring bar to dampen vibration thereof.
Calibration assembly for nuclear reactor vessel inspection apparatus
International Nuclear Information System (INIS)
Elsner, H.J.
1981-01-01
A removable calibration assembly can be utilized to verify the angular mounting of transducers in an array employed in an ultrasonic inpsection apparatus, to calibrate one axis of movement of the array with reference to a starting point, or to measure and calibrate the speed per unit of distance of the transducer's ultrasonic beam in the operating medium. The calibration assembly includes both a large and small reflecting surface separated by known distances, and several large cones, the tips of which are machined or adjusted to angles at which certain of the transducers are to be mounted. Clamping means for securing the calibration assembly to the inspection apparatus at a predetermined orientation is provided
In situ/non-contact superfluid density measurement apparatus
Nam, Hyoungdo; Su, Ping-Hsang; Shih, Chih-Kang
2018-04-01
We present a double-coil apparatus designed to operate with in situ capability, which is strongly desired for superconductivity studies on recently discovered two-dimensional superconductors. Coupled with a scanning tunneling microscope, the study of both local and global superconductivity [for superconducting gap and superfluid density (SFD), respectively] is possible on an identical sample without sample degradations due to damage, contamination, or oxidation in an atmosphere. The performance of the double-coil apparatus was tested on atomically clean surfaces of non-superconducting Si(111)-7 × 7 and on superconducting films of 100 nm-thick Pb and 1.4 nm-ultrathin Pb. The results clearly show the normal-to-superconductor phase transition for Pb films with a strong SFD.
Robotic UV-Vis apparatus for long-term characterization of drug release from nanochannels
International Nuclear Information System (INIS)
Geninatti, T; Grattoni, A; Small, E
2014-01-01
Reliable monitoring of the kinetics of molecular release from drug delivery devices is crucial for their therapeutic success. Commercially available UV-Vis spectrophotometers provide reliable quantification of analyte concentrations directly correlated to the absorbance of fluids. However, they are not suitable for long-term measurements requiring high frequency of sampling from a large number of replicates and continuous fluid mixing, all of which are necessary for evaluation of drug delivery devices. To address this need, we developed a novel robotic apparatus serially connected to a commercial UV-Vis spectrophotometer. The robotic apparatus enables us to automatically and reliably acquire long-term data for up to 48 samples with high frequency of measurements and independent magnetic stirring. We equipped the robotic apparatus with independent connectors that allowed us to apply an electric potential to each sample for electrokinetic studies. The apparatus repeatability and accuracy was demonstrated in comparison to a commercial UV-Vis spectrophotometer. The system was successfully employed to characterize the diffusion kinetics of acetone and doxorubicin through nanochannel membranes (nDS) designed for long-term drug delivery. Dendritic fullerene 1 was used to show that the robotic apparatus routes the electric potential to nanochannel membranes enabling us to investigate the actively controlled release of molecules. Our results demonstrate that the robotic apparatus could widely broaden the range of applications of UV-Vis spectrophotometry, especially in the case of large sample processing and for long-term diffusive and electrokinetic studies in drug delivery. (technical design note)
Ventilation system for 99Mo production apparatus
International Nuclear Information System (INIS)
Izumo, Mishiroku; Okane, Shougo; Sorita, Takami; Aoyama, Saburou
1978-04-01
In production of 20 Ci 99 Mo from 235 U fission, about 120 Ci of radioiodine ( 131 I, 132 I, and 133 I) is involved. To remove airborne radioiodine from the exhaust air from production apparatus and minimize radioiodine release to the atmosphere, the ventilation system is equipped with 2 units of Model-FD charcoal filter (KI 3 -Impregnated charcoal 2 inch thick of Barnebey-Cheney Co.). From September 1976 to December 1977, 21 runs of 99 Mo production involving airborne radioiodine were carried out. The ventilation system was operated continuously for the whole 15 months period; variation in removal efficiency of airborne radioiodine from the exhaust air stream was observed. In the runs valuable experiences were gained in operation and maintenance of the ventilation system including activated charcoal filter and health-physics management of such facility. Following are the results: (1) Airborne radioiodine from 99 Mo production apparatus is reduced to 10 -3 % of the original quantity. (2) When the ventilation system is operated at a maximum air flow rate through the filter, the average efficiency during 15 months is over 98%. (3) Airborne radioiodine released from 99 Mo production apparatus to the ventilation system is less than 5% particulate iodine and alkyl iodines and more than 95% inorganic iodine. (4) Airborne radioiodine released from the stack is less than 28 μCi/run, which is below the limit in regulations on Radioisotope Production Laboratory. (auth.)
Apparatus for testing semiconductor devices and capacitors
International Nuclear Information System (INIS)
York, R.A.
1984-01-01
An apparatus is provided for testing semiconductor devices. The apparatus tests the impedance of the semiconductor devices in both conducting and non-conducting states to detect semiconductors whose impedance in the conducting state is too high or whose impedance in the non-conducting state is too low. The apparatus uses a battery source for low voltage d.c. The circuitry for detecting when the impedance is too high in the conducting state includes a lamp in series with the battery source and the semiconductor device, whereby the impedance of the semiconductor device determines whether sufficient current will flow through the lamp to cause the lamp to illuminate. A d.c. to d.c. converter is provided to boost the voltage from the battery source to a relatively high voltage d.c. The relatively high voltage d.c. can be connected by a switch to circuitry for detecting when the impedance of the semiconductor device in the non-conducting state is too low. The circuitry for detecting when the impedance of the semiconductor device is too low includes a resistor which senses the current flowing in the device and converts the current into a voltage proportional to the leakage current. This voltage is then compared against a fixed reference. Further circuitry is provided for providing a visual indication when the voltage representative of leakage in relation to the reference signal indicates that there is excessive current flow through the semiconductor device
International Nuclear Information System (INIS)
Inohara, Yasuto; Ioka, Ikuo; Fukaya, Kiyoshi; Tachibana, Katsumi; Suzuki, Tomio; Kiuchi, Kiyoshi
2001-03-01
On the development of cladding materials for advanced power reactors, it is important to clarify long performance and to control the compatibility to high temperature water at heat conducting surfaces under heavy irradiation. On the present study, the high temperature water loop with an autoclave was made for examining the corrosion behavior up to the super critical water range and for developing the simulation testing technique under irradiation in the hot cell. The loop is applicable to immersion tests in the temperature and pressure ranges up to 450degC and 25 MPa that are covered the surface temperature range of fuel claddings. One of the characteristics of this apparatus is a pair of sapphire windows of autoclave for in-situ observations, and a phase transition from water to super critical water conditions was clearly verified through these windows. In this apparatus, it is possible to control the temperature, pressure and Dissolved Oxygen (DO) within a fluctuations of few % on three phases, namely, water, steam and super critical water. (author)
International Nuclear Information System (INIS)
Hammerschmidt, U.
1995-01-01
The thermal conductivity of the refrigerants R22, R123, R134a, R142b, R143a, and R152a has been determined as a function of temperature in the range from 300 to 460 K. Measurements were carried out at atmospheric pressure with an improved guarded hot-plate apparatus. The width of the instrument's gas layer and the temperature difference across the metering section were varied to detect any stray heat transfer. Radiation correction factors were derived from IR absorption spectra. The uncertainty of the measurements is estimated to be 2% at a standard deviation of less than 0.1%. Our data sets are compared with corresponding hot wire results. In contrast to the generally preferred hot wire technique, with its possible electrical and chemical interactions between the wire and the polar refrigerant, there are no such difficulties using a guarded hot-plate apparatus. Our data sets may thus contribute to the discussions on discrepancies in thermal conductivity values from various authors using hot wire as one particular method
Construct a procedure to verify radiation protection for apparatus of industrial gamma radiography
International Nuclear Information System (INIS)
Nghiem Xuan Long; Trinh Dinh Truong; Dinh Chi Hung; Le Ngoc Hieu
2013-01-01
Apparatus for industrial gamma radiography include an exposure container, source guide tube, remote control hand crank assembly and other attached equipment. It is used a lot in inspection and evaluation of projects. In Vietnam, there are now more than 50 companies in radiography field and more than 100 apparatus are being used on the site. Therefore, the verification and evaluation is very necessary and important. This project constructs a procedure to verify a radiation protection for apparatus in the industrial gamma radiography for its application in Vietnam. (author)
Apparatus for sealing a rotatable shield plug in a liquid metal nuclear reactor
International Nuclear Information System (INIS)
Winkleblack, R.K.
1980-01-01
An apparatus for sealing a rotatable shield plug in a nuclear reactor having liquid metal coolant is described. The apparatus includes a dip -ring seal adapted to provide a fluid barrier between the liquid metal and the atmosphere and to permit rotation of the shield plug. The apparatus also includes a static seal for the rotatable shield plug located between the dip-ring seal and the liquid metal. The static seal isolates the dip-ring seal from the liquid metal vapor during operation at power and can be disengaged for rotation of the shield plug
Disquisition and technical alteration about TL apparatus
International Nuclear Information System (INIS)
Wang Guangxiang; Li Mingliang
2002-01-01
The author simply introduces the disadvantage of TL apparatus controlled by single chip. The project uses the PC computer to replace single chip control. So it must be changed the interface and made up a software with Chinese
[Development of electroforming apparatus for coronal restoration].
Watanabe, M; Sawada, T; Ukiya, M
1989-03-01
As dental technologies become highly developed, techniques have been more diversified. From as aspect of prosthodontic practice, both esthetic and functional requirements are emphasized for coronal restoration and consequently, these should be considered in the routine procedure. In fabrication of coronal restorations, metal, porcelain and resin are commonly used, and there exists the various disadvantages for metal cast method due to complicated processes by using different dental materials. Therefore, an electroforming apparatus was developed by us to replace the conventional procedure by a cathode rotary system. It was applied for coronal restorations to allow an electroforming directly on a working model. An experiment was successfully conducted to apply for a veneer crown on abutment tooth of upper central incisor on plaster model. The results were obtained as follows, 1. It was become possible to construct a metal framework by the electroforming. 2. Metal framework can be constructed on the same working model without a duplication of it. 3. The combined system for cathode rotation and liquid circulation could shorten the electroposition time, and allows a high current density extending to 50 A/dm2.
Nuclear resonance apparatus including means for rotating a magnetic field
International Nuclear Information System (INIS)
Sugimoto, H.
1983-01-01
A nuclear magnetic resonance apparatus including magnet apparatus for generating a homogeneous static magnetic field between its magnetic poles, shims of a magnetic substance mounted on the magnetic poles to apply a first gradient magnetic field intensity distribution in a direction orthogonal as to the direction of line of magnetic force of the static magnetic field, gradient magnetic field generating electromagnetic apparatus for generating a second gradient magnetic field having a gradient magnetic field intensity distribution in superimposition with the static magnetic field and for changing the magnetic field gradient of the first gradient magnetic field, an oscillator for generating an oscillating output having a frequency corresponding to the nuclear magnetic resonance condition of an atomic nucleus to be measured, a coil wound around a body to be examined for applying the output of said oscillator as electromagnetic waves upon the body, a receiver for detecting the nuclear magnetic resonance signals received by the coil, a gradient magnetic field controller making a magnetic field line equivalent to the combined gradient magnetic fields and for rotating the line along the section of the body to be examined by controlling said gradient magnetic field generating electromagnetic apparatus and devices for recording the nuclear magnetic resonance signals, for reconstructing the concentration distribution of the specific atomic nuclei in the section of the body, and a display unit for depicting the result of reconstruction
International Nuclear Information System (INIS)
Gelinas, R.C.
1984-01-01
A system for transmission of information using a curl-free magnetic vector potential radiation field. The system includes current-carrying apparatus for generating a magnetic vector potential field with a curl-free component coupled to apparatus for modulating the current applied to the field generating apparatus. Receiving apparatus includes a detector with observable properties that vary with the application of an applied curl-free magnetic vector potential field. Analyzing apparatus for determining the information content of modulation imposed on the curl-free vector potential field can be established in materials that are not capable of transmitting more common electromagnetic radiation
Flow coating apparatus and method of coating
Hanumanthu, Ramasubrahmaniam; Neyman, Patrick; MacDonald, Niles; Brophy, Brenor; Kopczynski, Kevin; Nair, Wood
2014-03-11
Disclosed is a flow coating apparatus, comprising a slot that can dispense a coating material in an approximately uniform manner along a distribution blade that increases uniformity by means of surface tension and transfers the uniform flow of coating material onto an inclined substrate such as for example glass, solar panels, windows or part of an electronic display. Also disclosed is a method of flow coating a substrate using the apparatus such that the substrate is positioned correctly relative to the distribution blade, a pre-wetting step is completed where both the blade and substrate are completed wetted with a pre-wet solution prior to dispensing of the coating material onto the distribution blade from the slot and hence onto the substrate. Thereafter the substrate is removed from the distribution blade and allowed to dry, thereby forming a coating.
Photovoltaic array mounting apparatus, systems, and methods
West, John Raymond; Atchley, Brian; Hudson, Tyrus Hawkes; Johansen, Emil
2014-12-02
An apparatus for mounting a photovoltaic (PV) module on a surface, including a support with an upper surface, a lower surface, tabs, one or more openings, and a clip comprising an arm and a notch, where the apparatus resists wind forces and seismic forces and creates a grounding electrical bond between the PV module, support, and clip. The invention further includes a method for installing PV modules on a surface that includes arranging supports in rows along an X axis and in columns along a Y axis on a surface such that in each row the distance between two neighboring supports does not exceed the length of the longest side of a PV module and in each column the distance between two neighboring supports does not exceed the length of the shortest side of a PV module.
International Nuclear Information System (INIS)
Blanc, J.Y.; Hardy, J.L.; Trotabas, M.
1990-01-01
This paper describes the state-of-the-art in the Saclay hot cells for examining L.W.R. fuels. First, we present the classical path followed by a fuel rod in the laboratory, to begin with non-destructive testing. This is completed by destructive examinations, such as free volume determination and fission gases analyses, density measurement and metallographies including X-rays diffraction and microprobe (EPMA/WDX). These two last techniques enable the identification of elements and chemical nature of compounds which are present. We also perform mechanical tests on metallic components, on clads and guide-tubes (tensile tests, creep, burst or fatigue tests by internal pressure). Another apparatus is devoted to the study of irradiated clad behaviour during LOCA-type transients. In the second chapter, a particular emphasis is given to the developments in progress, or planned in the near future. This includes: (a) The implementation of a new non-destructive testing bench to inspect more fuel rods simultaneously. (b) A new image analyzer to be applied e.g. to hydrides analysis in the clad, or to the inspection of safety test fuel bundles. (c) As for mechanical testing, we describe here the tensile tests on clads or on guide-tubes, performed on longitudinal samples or ring samples
Apparatus for chemical synthesis
Kong, Peter C [Idaho Falls, ID; Herring, J Stephen [Idaho Falls, ID; Grandy, Jon D [Idaho Falls, ID
2011-05-10
A method and apparatus for forming a chemical hydride is described and which includes a pseudo-plasma-electrolysis reactor which is operable to receive a solution capable of forming a chemical hydride and which further includes a cathode and a movable anode, and wherein the anode is moved into and out of fluidic, ohmic electrical contact with the solution capable of forming a chemical hydride and which further, when energized produces an oxygen plasma which facilitates the formation of a chemical hydride in the solution.
Acoustic calibration apparatus for calibrating plethysmographic acoustic pressure sensors
Zuckerwar, Allan J. (Inventor); Davis, David C. (Inventor)
1995-01-01
An apparatus for calibrating an acoustic sensor is described. The apparatus includes a transmission material having an acoustic impedance approximately matching the acoustic impedance of the actual acoustic medium existing when the acoustic sensor is applied in actual in-service conditions. An elastic container holds the transmission material. A first sensor is coupled to the container at a first location on the container and a second sensor coupled to the container at a second location on the container, the second location being different from the first location. A sound producing device is coupled to the container and transmits acoustic signals inside the container.
Mass transfer apparatus and method for separation of gases
Energy Technology Data Exchange (ETDEWEB)
Blount, Gerald C.; Gorensek, Maximilian Boris; Hamm, Luther L.
2018-01-16
A process and apparatus for separating components of a source gas is provided in which more soluble components of the source gas are dissolved in an aqueous solvent at high pressure. The system can utilize hydrostatic pressure to increase solubility of the components of the source gas. The apparatus includes gas recycle throughout multiple mass transfer stages to improve mass transfer of the targeted components from the liquid to gas phase. Separated components can be recovered for use in a value added application or can be processed for long-term storage, for instance in an underwater reservoir.
Functional Morphology of Venom Apparatus of Euscorpius mingrelicus(Scorpiones: Euscorpiidae)
YİĞİT, Nazife; BAYRAM, Abdullah; DANIŞMAN, Tarık
2007-01-01
The objective of the present study is to describe the functional morphology of venom apparatus of Euscorpius mingrelicus (Kessler, 1874) by using light microscope and scanning electron microscope (SEM). The venom apparatus, situates in the last segment of metasoma (telson), is composed of a pair of venom glands and sting. Telson is covered by cuticular exoskeleton as well as all body, and there are cuticular setae and pits on it as serve sensory organ. The general organization of the venom ap...
Measurement of krypton-85 in the atmosphere with a portable apparatus
International Nuclear Information System (INIS)
Okai, T.
1984-01-01
A portable apparatus was developed for the rapid collection, separation and counting of krypton-85 in environmental air samples. The apparatus consists of a molecular sieve trap for the elimination of H 2 O and CO 2 , a charcoal trap for the collection of krypton, a chromatographic column for the isolation of krypton in the air sample and a vial for the disolution of krypton in the scintillation solution. With this apparatus, krypton can be collected from half a cubic meter of air with 94% recovery in about 3 hrs. The measurements of krypton-85 were done several time in Fukuoka area from Jan. 30 to Dec. 9, 1981. The krypton-85 concentration was found to be approximately 21 pCi/m 3 air. The results were compared with those obtained by foreign investigators. (author)
Interpellation by the Force: Biopolitical Cultural Apparatuses in The Force Awakens
Directory of Open Access Journals (Sweden)
Simon Orpana
2017-12-01
Full Text Available Following Nicholas Brown’s and Fredric Jameson’s ideas about pastiche and art under postmodern capitalism, this essay argues that Star Wars: The Force Awakens is not so much a film as a means of interpellating a new generation of fans into the Star Wars universe and its attendant merchandising empire. I introduce the idea of Biopolitical Cultural Apparatuses as an adaptation of Louis Althusser’s theory of ideology to the neoliberal context, where state apparatuses have been retooled and augmented by cultural apparatuses that manage desires and expectations at the level of bodies, ritual, and affect. In this context, the Death Star emerges as an image of the disavowed totality that global capitalism must repeatedly conjure and dispatch as it projects itself, expansively, into the future.
Energy Technology Data Exchange (ETDEWEB)
Huiping, Guo [The Second Artillery Engineering College, Xi' an (China)
2007-06-15
For satisfying calibration request of radon measure in the laboratory, the calibration apparatus for radon activity measure is designed and realized. The calibration apparatus can auto-control and auto-measure in three models. sequent mode, pulse mode and constant mode. The stability and reliability of the calibration apparatus was tested under the three models. The experimental result shows that the apparatus can provides an adjustable and steady radon activity concentration environment for the research of radon and its progeny and for the calibration of its measure. (authors)
Plasma/Neutral-Beam Etching Apparatus
Langer, William; Cohen, Samuel; Cuthbertson, John; Manos, Dennis; Motley, Robert
1989-01-01
Energies of neutral particles controllable. Apparatus developed to produce intense beams of reactant atoms for simulating low-Earth-orbit oxygen erosion, for studying beam-gas collisions, and for etching semiconductor substrates. Neutral beam formed by neutralization and reflection of accelerated plasma on metal plate. Plasma ejected from coaxial plasma gun toward neutralizing plate, where turned into beam of atoms or molecules and aimed at substrate to be etched.
Integrated-fin gasket for palm cubic-anvil high pressure apparatus
Energy Technology Data Exchange (ETDEWEB)
Cheng, J.-G. [Institute for Solid State Physics, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8581 (Japan); Beijing National Laboratory for Condensed Matter Physics and Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Matsubayashi, K.; Nagasaki, S.; Hisada, A.; Hirayama, T.; Uwatoko, Y. [Institute for Solid State Physics, University of Tokyo, 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8581 (Japan); Hedo, M. [Faculty of Science, University of Ryukyus, Senbaru, Nishihara, Okinawa 903-0213 (Japan); Kagi, H. [Graduate School of Science, University of Tokyo, 7-3-1, Hongo Bunkyo-Ku, Tokyo 113-0033 (Japan)
2014-09-15
We described an integrated-fin gasket technique for the palm cubic-anvil apparatus specialized for the high-pressure and low-temperature measurements. By using such a gasket made from the semi-sintered MgO ceramics and the tungsten-carbide anvils of 2.5 mm square top, we successfully generate pressures over 16 GPa at both room and cryogenic temperatures down to 0.5 K. We observed a pressure self-increment for this specific configuration and further characterized the thermally induced pressure variation by monitoring the antiferromagnetic transition temperature of chromium up to 12 GPa. In addition to enlarge the pressure capacity, such a modified gasket also improves greatly the surviving rate of electrical leads hanging the sample inside a Teflon capsule filled with the liquid pressure-transmitting medium. These improvements should be attributed to the reduced extrusion of gasket materials during the initial compression.
A New Cost-Effective Diode Laser Polarimeter Apparatus Constructed by Undergraduate Students
Lisboa, Pedro; Sotomayor, Joo; Ribeiro, Paulo
2010-01-01
The construction of a diode laser polarimeter apparatus by undergraduate students is described. The construction of the modular apparatus by undergraduate students gives them an insight into how it works and how the measurement of a physical or chemical property is conducted. The students use the polarimeter to obtain rotation angle values for the…
A cryogenic tensile testing apparatus for micro-samples cooled by miniature pulse tube cryocooler
International Nuclear Information System (INIS)
Chen, L B; Liu, S X; Gu, K X; Zhou, Y; Wang, J J
2015-01-01
This paper introduces a cryogenic tensile testing apparatus for micro-samples cooled by a miniature pulse tube cryocooler. At present, tensile tests are widely applied to measure the mechanical properties of materials; most of the cryogenic tensile testing apparatus are designed for samples with standard sizes, while for non-standard size samples, especially for microsamples, the tensile testing cannot be conducted. The general approach to cool down the specimens for tensile testing is by using of liquid nitrogen or liquid helium, which is not convenient: it is difficult to keep the temperature of the specimens at an arbitrary set point precisely, besides, in some occasions, liquid nitrogen, especially liquid helium, is not easily available. To overcome these limitations, a cryogenic tensile testing apparatus cooled by a high frequency pulse tube cryocooler has been designed, built and tested. The operating temperatures of the developed tensile testing apparatus cover from 20 K to room temperature with a controlling precision of ±10 mK. The apparatus configurations, the methods of operation and some cooling performance will be described in this paper. (paper)
A detailed analysis of adhesion mechanics between a compliant elastic coating and a spherical probe
International Nuclear Information System (INIS)
Sridhar, I; Zheng, Z W; Johnson, K L
2004-01-01
As length scales decrease, adhesive forces become increasingly important. These adhesive forces contribute to the normal load in experiments conducted on thin layered systems using micro-probe instruments such as the surface force apparatus (SFA) and the atomic force microscope (AFM). Adhesion between these thin-layer systems was analysed by Sridhar et al (1997 J. Phys. D: Appl. Phys. 30 1710) for the SFA geometry and Johnson and Sridhar (2001 J. Phys. D: Appl. Phys. 34 683) for AFM using a numerical SJF (Sridhar-Johnson-Fleck) version of the JKR (Johnson-Kendal-Roberts) theory. In this paper, adhesion mechanics between a compliant elastic coating and a spherical probe is investigated using the SJF model in detail. When the substrate is rigid, the non-dimensional pull-off force may differ from the JKR value of -0.5 by as much as 90%. Computations of the contact size at zero load and pull-off force are presented for a range of values of adhesion energy. Finally, empirical relations for the contact load and contact compliance as a function of contact radius were obtained from the numerical data for practical layer-substrate material systems
International Nuclear Information System (INIS)
Von Benken, C.; Johnson, E.A.; Nordberg, M.
1989-01-01
The authors present an apparatus capable of detecting micron sized particles traveling at speeds up to 10 6 cm/sec. The apparatus uses light scattering methods with automated data processing. Data generated by this apparatus should be extremely useful in radiation damage studies of components in contamination sensitive optical systems
Heated junction thermocouple level measurement apparatus
International Nuclear Information System (INIS)
Bevilacqua, F.; Burger, J.M.
1984-01-01
A liquid level sensing apparatus senses the level of liquid surrounding the apparatus. A plurality of axially spaced sensors are enclosed in a separator tube. The separator tube tends to collapse the level of a two-phase fluid within the separator tube into essentially a liquid phase and a gaseous phase where the collapsed level bears a relationship to the coolant inventory outside the separator tube. The level of the liquid phase is sensed by level sensing apparatus. The separator tube contains inlet-outlet ports near the top and bottom thereof to equalize the liquid level inside and outside the separator tube when the level fluctuates or the water within the separator tube flashes to steam. Each sensor is comprised of a heater, a heated thermocouple junction and an unheated thermocouple junction within an elongated heat conductive housing. The heated portion of housing is enclosed in a splash guard with inlet-outlet ports near the top and bottom to equalize the liquid level inside and outside the splash guardand to eliminate the spurious indications of liquid level change which may arise if water droplets contact the housing in the region of the heater. To prevent steam bubbles entrained in a two-phase fluid cross flow from entering the lateral inlet-outlet ports of the separator tube, the separator tube is enclosed in support tube which may in turn be enclosed in an otherwise unused control element assembly shroud. The lateral inlet-outlet ports of separator tube are axially offset from lateral inlet-outlet ports of support tube at least where support tube is subjected to cross flow. The shroud is open on the bottom and has lateral inlet-outlet ports to facilitate liquid level fluctuations to equalize inside and outside shroud
Data eye monitor method and apparatus
Energy Technology Data Exchange (ETDEWEB)
Gara, Alan G [Mount Kisco, NY; Marcella, James A [Rochester, MN; Ohmacht, Martin [Yorktown Heights, NY
2012-01-31
An apparatus and method for providing a data eye monitor. The data eye monitor apparatus utilizes an inverter/latch string circuit and a set of latches to save the data eye for providing an infinite persistent data eye. In operation, incoming read data signals are adjusted in the first stage individually and latched to provide the read data to the requesting unit. The data is also simultaneously fed into a balanced XOR tree to combine the transitions of all incoming read data signals into a single signal. This signal is passed along a delay chain and tapped at constant intervals. The tap points are fed into latches, capturing the transitions at a delay element interval resolution. Using XORs, differences between adjacent taps and therefore transitions are detected. The eye is defined by segments that show no transitions over a series of samples. The eye size and position can be used to readjust the delay of incoming signals and/or to control environment parameters like voltage, clock speed and temperature.
Apparatus for generating nonlinear pulse patterns
Nakamura, N.M.I.
Apparatus for generating a plurality of nonlinear pulse patterns from a single linear pulse pattern. A first counter counts the pulses of the linear pulse pattern and a second counter counts the pulses of the nonlinear pulse pattern. A comparator compares the counts of both counters, and in response to an equal count, a gate is enabled to gate a pulse of the linear pattern as a pulse of the nonlinear pattern, the latter also resetting the first counter. Presettable dividers divide the pulses of each pattern before they are counted by the respective counters. Apparatus for generating a logarithmic pulse pattern from a linear pulse pattern to any log base is described. In one embodiment, a shift register is used in place of the second counter to be clocked by each pulse of the logarithmic pattern to generate the pattern. In another embodiment, a memory stores the logarithmic pattern and is addressed by the second counter which is clocked by the pulses of the logarithmic pulse pattern.
Magnetic resonance imaging apparatus
International Nuclear Information System (INIS)
Ehnholm, G.J.
1991-01-01
This patent describes an electron spin resonance enhanced magnetic resonance (MR) imaging (ESREMRI) apparatus able to generate a primary magnetic field during periods of nuclear spin transition excitation and magnetic resonance signal detection. This allows the generation of ESREMRI images of a subject. A primary magnetic field of a second and higher value generated during periods of nuclear spin transition excitation and magnetic resonance signal detection can be used to generate conventional MR images of a subject. The ESREMRI and native MR images so generated may be combined, (or superimposed). (author)
International Nuclear Information System (INIS)
1977-01-01
The X-ray photographic system is designed for medical applications. Two detectors are used for surveys in different planes, and produce electrical signals which are supplied to a comparator. The electron beams are examined according to a system of reference time steps. The apparatus includes a light source and a photo-detector and enables a reference signal to be produced against which the detected signals are compared. The beam source is formed from an electron gun, an extractor electrode and an anode; beam then passes through a collimator. (G.C.)
International Nuclear Information System (INIS)
Gaunt, R.R.; Ashman, C.M.
1987-01-01
A control rod testing apparatus is described comprising: a first guide means having a vertical cylindrical opening for grossly guiding a control rod; a second guide means having a vertical cylindrical opening for grossly guiding a control rod. The first and second guide means are supported at axially spaced locations with the openings coaxial; and a substantially cylindrical subassembly having a vertical cylindrical opening therethrough. The subassembly is trapped coaxial with and between the first and second guide means, and the subassembly radially floats with respect to the first and second guide means
Method of and apparatus for decontaminating radioactive garments
International Nuclear Information System (INIS)
Capella, J.A.; Morrison, D.R.
1980-01-01
Garments are deposited in a cleaning drum which is agitated during a wash cycle. A dry cleaning solvent is continuously added to the drum during the wash cycle and continuously removed from the drum during the wash cycle to flush the radioactive particulate material separated from the garments into a sump. The solvent is pumped from the sump for addition to the drum during the wash cycle and the pumped solvent is filtered to remove substantially all of the radioactive particulate material suspended in the solvent. Radiation sensors permit monitoring of the recycled solvent to ensure satisfactory operation of filters. The solvent is cleaned by a distilling apparatus, a condenser and a moisture separating apparatus. A fan dryer is provided. (author)
Processes, data structures, and apparatuses for representing knowledge
Hohimer, Ryan E [West Richland, WA; Thomson, Judi R [Guelph, CA; Harvey, William J [Richland, WA; Paulson, Patrick R [Pasco, WA; Whiting, Mark A [Richland, WA; Tratz, Stephen C [Richland, WA; Chappell, Alan R [Seattle, WA; Butner, R Scott [Richland, WA
2011-09-20
Processes, data structures, and apparatuses to represent knowledge are disclosed. The processes can comprise labeling elements in a knowledge signature according to concepts in an ontology and populating the elements with confidence values. The data structures can comprise knowledge signatures stored on computer-readable media. The knowledge signatures comprise a matrix structure having elements labeled according to concepts in an ontology, wherein the value of the element represents a confidence that the concept is present in an information space. The apparatus can comprise a knowledge representation unit having at least one ontology stored on a computer-readable medium, at least one data-receiving device, and a processor configured to generate knowledge signatures by comparing datasets obtained by the data-receiving devices to the ontologies.
How-to-Do-It: Apparatus & Experimental Design for Measuring Fermentation Rates in Yeast.
Tatina, Robert
1989-01-01
Describes an apparatus that facilitates the quantitative study of fermentation in yeast by allowing simultaneous measurements of fermentation rates in several treatments and a control. Explains a laboratory procedure in which the apparatus is used. Several suggestions for further investigations are included. (Author/RT)