WorldWideScience

Sample records for apparatus sfa technique

  1. Stenting of the SFA - indications, techniques,

    International Nuclear Information System (INIS)

    Rieger, J.; Treitl, M.; Reiser, M.; Ruppert, V.

    2006-01-01

    Aggressive risk factor modification, change of eating habits, exercise programs, and forceful antiplatelet therapy are the most important tools for the treatment of PAOD in symptomatic patients suffering from intermittent claudication. There are however no guidelines for revascularization at this stage. Endovascular treatment has been increasingly utilized over the last decade and increasingly displaced vascular surgery. Amongst numerous endovascular techniques beside PTA, stents meanwhile play the most important role due to constant technical progress. Results regarding the rate of restenosis or patency rates still remain worse compared to other vascular beds. This paper gives a review over recent results, currently available stent techniques, and possible indications for the endovascular therapy of an artery, which has turned out to be the biggest ordeal for material and construction of stents. (orig.) [de

  2. Informationization nuclear apparatus communication technique

    International Nuclear Information System (INIS)

    Yu Tiqi; Fang Zongliang; Wen Qilin

    2006-01-01

    The paper explains the request of communication ability in nuclear technique application area. Based on the actuality of nuclear apparatus communication ability, and mainly combining with the development of communication technique, the authors analyzes the application trend of communication technique applying in nuclear apparatus, for the apparatus and system needing communication ability, they need selecting suitable communication means to make them accomplish the task immediately and effectively. (authors)

  3. Torque application technique and apparatus

    Science.gov (United States)

    Pineault, Raymond P.

    1993-11-01

    A tool which produces a measured torque is coupled to a bolt head or nut, located in a relatively inaccessible area, by apparatus which includes a wrench member affixed to an adaptor. The wrench member is sized and shaped to engage the fastener to be operated upon and the adaptor has a tubular construction with a tool engaging socket at one end. The adaptor is provided with an elongated slot which accommodates any wires which may pass through the fastener.

  4. Neutron logging reliability techniques and apparatus

    International Nuclear Information System (INIS)

    Johnstone, C.W.

    1975-01-01

    Apparatus and methods for verifying the validity of data derived at least in part by neutron logging of earth formations, and, where indicated, for affording neutron diffusion-corrected values of such data, are disclosed. (WHK)

  5. Neutron logging reliability techniques and apparatus

    International Nuclear Information System (INIS)

    Johnstone, C.W.

    1978-01-01

    This invention relates in general to neutron logging of earth formations, and in particular, to novel apparatus and procedures for determining the validity, or reliability, of data derived at least in part by logging neutron characteristics of earth formations and, if desired, for affording verifiably accurate indications of such data

  6. Neutron logging reliability techniques and apparatus

    International Nuclear Information System (INIS)

    Johnstone, C.W.

    1974-01-01

    This invention relates in general to neutron logging of earth formations, and in particular, to novel apparatus and procedures for determining the validity, or reliability, of data derived at least in part by logging neutron characteristics of earth formations and, if desired, for affording verifiably accurate indications of such data. (author)

  7. Centrifuge Techniques and Apparatus for Transport Experiments in Porous Media

    Energy Technology Data Exchange (ETDEWEB)

    Earl D. Mattson; Carl D. Paler; Robert W. Smith; Markus Flury

    2010-06-01

    This paper describes experimental approaches and apparatus that we have developed to study solute and colloid transport in porous media using Idaho National Laboratory's 2-m radius centrifuge. The ex-perimental techniques include water flux scaling with applied acceleration at the top of the column and sub-atmospheric pressure control at the column base, automation of data collection, and remote experimental con-trol over the internet. These apparatus include a constant displacement piston pump, a custom designed liquid fraction collector based on switching valve technology, and modified moisture monitoring equipment. Suc-cessful development of these experimental techniques and equipment is illustrated through application to transport of a conservative tracer through unsaturated sand column, with centrifugal acceleration up to 40 gs. Development of such experimental equipment that can withstand high accelerations enhances the centrifuge technique to conduct highly controlled unsaturated solute/colloid transport experiments and allows in-flight liquid sample collection of the effluent.

  8. Recent Progress in Electrical Insulation Techniques for HTS Power Apparatus

    Science.gov (United States)

    Hayakawa, Naoki; Kojima, Hiroki; Hanai, Masahiro; Okubo, Hitoshi

    This paper describes the electrical insulation techniques at cryogenic temperatures, i.e. Cryodielectrics, for HTS power apparatus, e.g. HTS power transmission cables, transformers, fault current limiters and SMES. Breakdown and partial discharge characteristics are discussed for different electrical insulation configurations of LN2, sub-cooled LN2, solid, vacuum and their composite insulation systems. Dynamic and static insulation performances with and without taking account of quench in HTS materials are also introduced.

  9. Dicty_cDB: SFA408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFA408 (Link to dictyBase) - - - Contig-U10972-1 SFA408P (Link... to Original site) SFA408F 509 SFA408Z 686 SFA408P 1195 - - Show SFA408 Library SF (Link to library) Clone ID SFA408 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...YLSXDQVESIIASIKGKVIQLSKDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYVVQHL ...KDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYV

  10. Method and apparatus for optimizing operation of a power generating plant using artificial intelligence techniques

    Science.gov (United States)

    Wroblewski, David [Mentor, OH; Katrompas, Alexander M [Concord, OH; Parikh, Neel J [Richmond Heights, OH

    2009-09-01

    A method and apparatus for optimizing the operation of a power generating plant using artificial intelligence techniques. One or more decisions D are determined for at least one consecutive time increment, where at least one of the decisions D is associated with a discrete variable for the operation of a power plant device in the power generating plant. In an illustrated embodiment, the power plant device is a soot cleaning device associated with a boiler.

  11. An integrated DEA-COLS-SFA algorithm for optimization and policy making of electricity distribution units

    International Nuclear Information System (INIS)

    Azadeh, A.; Ghaderi, S.F.; Omrani, H.; Eivazy, H.

    2009-01-01

    This paper presents an integrated data envelopment analysis (DEA)-corrected ordinary least squares (COLS)-stochastic frontier analysis (SFA)-principal component analysis (PCA)-numerical taxonomy (NT) algorithm for performance assessment, optimization and policy making of electricity distribution units. Previous studies have generally used input-output DEA models for benchmarking and evaluation of electricity distribution units. However, this study proposes an integrated flexible approach to measure the rank and choose the best version of the DEA method for optimization and policy making purposes. It covers both static and dynamic aspects of information environment due to involvement of SFA which is finally compared with the best DEA model through the Spearman correlation technique. The integrated approach would yield in improved ranking and optimization of electricity distribution systems. To illustrate the usability and reliability of the proposed algorithm, 38 electricity distribution units in Iran have been considered, ranked and optimized by the proposed algorithm of this study.

  12. The speed of progress in the apparatus handling technique in rhythmic gymnastics

    Directory of Open Access Journals (Sweden)

    Moskovljević Lidija

    2013-01-01

    Full Text Available Specificity of rhythmic gymnastics as a sport and as a teaching device are apparatus routines. Considering lack of researches, the aim of our study was to determine ages of maturity when the development in apparatus routines performance is greater. Development in essential rope, hoop and ball routine performance was examined two times per year, through four years experimental period. The evaluation is carried out three-member RG-expert committee on a scale of 1 to 10. A total of twenty-seven competitors, examined at ages seven to fourteen, participate in this study. Based on data, we can notice that speed of progress in apparatus handling technique was not equal during observing maturity period. There was not significant development in most of examined routines between seven to nine years of ages. Significant development in this period has been achieved only in two rope routines (Vij1 i Vij2R and one ball routine to (Lop2R. From eleven to twelve years of ages, significant development has been achieved for most of routines, except basic running with rope (Vij1 and hoop routine performed with weaker arm (Obr2L. At 12 to 13 years of ages, development of routines performance has not been statistically significant.

  13. SFA Adoption: Empirical Evidences from a Case Study

    Directory of Open Access Journals (Sweden)

    Silvio Cardinali

    2014-06-01

    Full Text Available Understanding how technology investments create business value is a research priority in today's technology-intensive world. Drawing on a literature review as well as a qualitative study, this research suggests that sales technology can support both: externally focused tasks towards managing customer relationships and internal administrative tasks. To unleash its real potential, sales technology should be designed to enable customer relationships rather than being perceived as a cost cutting tool. Today organisations are forced to constantly invent new ways of interacting with the customer to increase customer loyalty and to decrease the possibility of commoditization. This paper will focus on Sales Force Automation (SFA and its increasing importance. It will explore the purpose of SFA, its advantages and disadvantages, and its future impact on organisations through a qualitative research study: the authors investigated a small company operating in the business-to-business services sector to obtain practical feedback on the organisational and individual implications, the potential benefits and the problems related to adoption of an SFA system.

  14. Understanding Variation in Implementation of SFA in the i3 Scale-Up Project

    Science.gov (United States)

    Quint, Janet; Zhu, Pei; Doolittle, Fred

    2012-01-01

    The main confirmatory research question guiding the design of the impact evaluation is: "What is the impact of Success for All (SFA) on elementary school students' reading achievement, compared to students in non-SFA schools?" An answer to this question will determine the assessment of whether SFA is successful at turning around low-performing…

  15. A new crossed molecular beam apparatus using time-sliced ion velocity imaging technique

    International Nuclear Information System (INIS)

    Wu Guorong; Zhang Weiqing; Pan Huilin; Shuai Quan; Jiang Bo; Dai Dongxu; Yang Xueming

    2008-01-01

    A new crossed molecular beam apparatus has been constructed for investigating polyatomic chemical reactions using the time-sliced ion velocity map imaging technique. A unique design is adopted for one of the two beam sources and allows us to set up the molecular beam source either horizontally or vertically. This can be conveniently used to produce versatile atomic or radical beams from photodissociation and as well as electric discharge. Intensive H-atom beam source with high speed ratio was produced by photodissociation of the HI molecule and was reacted with the CD 4 molecule. Vibrational-state resolved HD product distribution was measured by detecting the CD 3 product. Preliminary results were also reported on the F+SiH 4 reaction using the discharged F atom beam. These results demonstrate that this new instrument is a powerful tool for investigating chemical dynamics of polyatomic reactions.

  16. Modified swelling pressure apparatus using vapor pressure technique for compacted bentonite

    International Nuclear Information System (INIS)

    Nishimura, Tomoyoshi

    2012-01-01

    Document available in extended abstract form only. bentonite. The compacted bentonite is found in unsaturated conditions before applying of swelling due to absorption. The behaviour of compacted bentonite is not consistent with the principle and concepts of classical, saturated soil mechanics. An unsaturated soil theoretical framework using soil water characteristic curve has been fairly established over the past several decades. The soil-water characteristic curve is a relationship between soil moisture and soil suction obtained by the axis translation technique, vapor pressure technique or osmotic suction control which is a key feature in unsaturated soil mechanics. The soil-water characteristic curve can be used for prediction of the shear strength, volume change and hydraulic conductivity. Cui et al. 2002 indicated soil-water characteristic curve of expansive clay soil in high soil suction ranges using osmotic suction technique. Tripathy et al. 2010 described the soil-water characteristic curve both using the axis translation technique and vapor pressure technique in the entire soil suction ranges. Nishimura and Koseki 2011 measured suction of bentonite applied high soil suction due vapor pressure using a chilled mirror dew point potentiometer (WP4-T of DECAGON Device). The bentonite with gravimetric water content of 18 % indicated soil suction of 2.8 MPa at least. It is predicted that suction efforts to swelling pressure and shear strength of unsaturated compacted bentonite. This study focuses on the influence of suction on both swelling pressure and shear strength of compacted bentonite. The soil-water characteristic curve (SWCC) tests were conducted for compacted bentonite using both axis-translation technique and vapor pressure technique. The SWCC had a range from 0 kPa to 296 MPa in suction. The compacted bentonite having two different soil suctions were prepared for swelling pressure tests. Newly swelling pressure testing apparatus was developed in order

  17. Are bio-absorbable stents the future of SFA treatment?

    Science.gov (United States)

    Peeters, P; Keirse, K; Verbist, J; Deloose, K; Bosiers, M

    2010-02-01

    Several limitations inherent to the implantation of a metallic device, such as the occurrence of in-stent re-stenosis, in an arterial lumen intuitively explain the interest for developing bio-absorbable stents. Two main types of bio-absorbable stents currently exist: polymer stents and metallic stents. To date, no studies with bio-absorbable stents have been conducted in the superficial femoral artery (SFA). Because of their strut thickness and lack of radial force, polymer stents are no good candidates for endovascular use. Absorbable metal stents (AMS) do have the potential to perform well for artery treatment, although current evidence from in-human coronary and infrapopliteal studies yield unsatisfactory results. Drastic technological improvements are mandatory before AMS can be considered for every day practice. Yet, it is our belief that further development of other metal and non-metal bio-absorbable stents, with or without drug-coating, may lead to the creation of the ultimate SFA stent.

  18. Apparatus and method for implementing power saving techniques when processing floating point values

    Science.gov (United States)

    Kim, Young Moon; Park, Sang Phill

    2017-10-03

    An apparatus and method are described for reducing power when reading and writing graphics data. For example, one embodiment of an apparatus comprises: a graphics processor unit (GPU) to process graphics data including floating point data; a set of registers, at least one of the registers of the set partitioned to store the floating point data; and encode/decode logic to reduce a number of binary 1 values being read from the at least one register by causing a specified set of bit positions within the floating point data to be read out as 0s rather than 1s.

  19. Method and apparatus for controlling LCL converters using asymmetric voltage cancellation techniques

    Science.gov (United States)

    Wu, Hunter; Sealy, Kylee Devro; Sharp, Bryan Thomas; Gilchrist, Aaron

    2016-01-26

    A method and apparatus for LCL resonant converter control utilizing Asymmetric Voltage Cancellation is described. The methods to determine the optimal trajectory of the control variables are discussed. Practical implementations of sensing load parameters are included. Simple PI, PID and fuzzy logic controllers are included with AVC for achieving good transient response characteristics with output current regulation.

  20. The impact of non-discretionary factors on DEA and SFA technical efficiency differences.

    Science.gov (United States)

    Kontodimopoulos, Nick; Papathanasiou, Nikolaos D; Flokou, Angeliki; Tountas, Yannis; Niakas, Dimitris

    2011-10-01

    The purpose of this study was to examine if factors of the external operating environment can explain differences in technical efficiency derived from Data Envelopment Analysis (DEA) and Stochastic Frontier Analysis (SFA). In a sample of 124 dialysis facilities, technical efficiency was compared according to ownership, region, years in operation and size. With second-stage Tobit regression, DEA and SFA efficiency was regressed against these environmental factors to determine their potential for predicting technical efficiency, as well as the efficiency differences between the two frontier methods. DEA expectedly generated lower mean efficiency scores than SFA (68.2% vs. 79.4%, P DEA-SFA efficiency differences was explained by environmental factors. This suggests that in addition to market instabilities, luck, and other related phenomena, decision-makers in their effort to determine optimal resource allocation, should point their attention to the potentially useful insight provided by environmental factors.

  1. A blanket design, apparatus, and fabrication techniques for the mass production of multilayer insulation blankets for the Superconducting Super Collider

    International Nuclear Information System (INIS)

    Gonczy, J.D.; Boroski, W.N.; Niemann, R.C.; Otavka, J.G.; Ruschman, M.K.; Schoo, C.J.

    1989-09-01

    The multilayer insulation (MLI) system for the Superconducting Super Collider (SSC) consists of full cryostat length assemblies of aluminized polyester film fabricated in the form of blankets and installed as blankets to the 4.5K cold mass and the 20K and 80K thermal radiation shields. Approximately 40,000 MLI blankets will be required in the 10,000 cryogenic devices comprising the SSC accelerator. Each blanket is nearly 17 meters long and 1.8 meters wide. This paper reports the blanket design, an apparatus, and the fabrication method used to mass produce pre-fabricated MLI blankets. Incorporated in the blanket design are techniques which automate quality control during installation of the MLI blankets in the SSC cryostat. The apparatus and blanket fabrication method insure consistency in the mass produced blankets by providing positive control of the dimensional parameters which contribute to the thermal performance of the MLI blanket. By virtue of the fabrication process, the MLI blankets have inherent features of dimensional stability three-dimensional uniformity, controlled layer density, layer-to-layer registration, interlayer cleanliness, and interlayer material to accommodate thermal contraction differences. 11 refs., 6 figs., 1 tab

  2. Custos operacionais eficientes das distribuidoras de energia elétrica: um estudo comparativo dos modelos DEA e SFA The cost efficiency of the Brazilian electricity distribution utilities: a comparative study with DEA and SFA models

    Directory of Open Access Journals (Sweden)

    Marcus Vinicius Pereira de Souza

    2010-12-01

    Full Text Available Este artigo apresenta medidas de eficiência para 40 distribuidoras de energia elétrica que operam no setor elétrico brasileiro. As medidas foram obtidas por modelos de análise envoltória de dados (DEA e modelos de fronteira estocástica (SFA, duas técnicas que podem mitigar a assimetria de informação e aprimorar a habilidade do agente regulador comparar os desempenhos das distribuidoras, requisitos fundamentais em esquemas de regulação incentivada. As duas abordagens são apresentadas e os resultados obtidos pelos diferentes modelos são comparados.This paper shows the efficiency measurements of 40 Brazilian electricity distribution companies. The efficiency scores are obtained using the data envelopment analysis (DEA and stochastic frontier analysis (SFA models, techniques that can reduce the information asymmetry and improve the regulator skills to compare the performance of the electricity companies, which are fundamental aspects of regulatory regimes. The two approaches are described, and the main results obtained from the different models are compared.

  3. Omega-6/Omega-3 and PUFA/SFA in Colossoma macropomum Grown in Roraima, Brazil

    Directory of Open Access Journals (Sweden)

    Antonio Alves Melho Filho

    2013-05-01

    Full Text Available In this study was evaluated the fatty acids composition of tambaqui (Colossoma macropomum fillet, fish species cultivated in Roraima State, Brazil. For the extraction of tambaqui oil was used Sohxlet device and then it was methylated. The oil  was identified using a gas chromatograph and were identified 24 acids and these were divided into characteristic groups such as: saturated fatty acids (SFA, monounsaturated fatty acids (MUFA, polyunsaturated fatty acids (PUFA and series fatty acids omega-6 and omega-3. The ratios obtained were PUFA/SFA and omega-6/omega-3. The results of chromatographic analysis were subjected to tests by variance ANOVA and multiple comparisons of Tukey at 5%. The ratios omega-6/omega-3 and PUFA/SFA showed values ​​of 8.58 and 0.75 respectively.

  4. Development of small specimen test techniques. Development of a remote controlled small punch testing apparatus

    International Nuclear Information System (INIS)

    Ohmi, Masao; Saito, Junichi; Ooka, Norikazu; Jitsukawa, Shiro; Hishinuma, Akimichi; Umino, Akira.

    1997-01-01

    An accelerator-driven deuterium-lithium (d-Li) stripping reaction-type neutron source, such as the International Fusion Materials Irradiation Facility (IFMIF) planned by the International Energy Agency is recognized as one of the most promising facility to obtain test environments of high-energy neutrons for fusion reactor materials development. The limitation on the available irradiation volume of the irradiation facility requires the development of the small specimen test techniques (SSTT). Application of SSTT to evaluate the degradation of various components in the light water reactor for the life extension is expected to be also quite beneficial. A remote-controlled testing machine for the Small Punch (SP) and miniaturized tensile tests was developed at the hot laboratory of the Japan Materials Testing Reactor (JMTR). The machine is designed for testing at temperatures ranging between 93 and 1,123 K to evaluate the temperature dependence of the strength of materials including the embrittlement at low temperatures and the softening at elevated temperatures. The tests are performed in a vacuum or in an inert gas environment. The machine has been installed in a hot cell and is being used for the round robin test program of the SP test method. The round robin test program is planned to identify the capability of the test method and to establish a standard test procedure. The configuration and the specifications of the test machine are introduced and the results of the SP tests are also shown. (author)

  5. First experience in international air transportation of RR SFA in Russian-made TUK-19 casks

    International Nuclear Information System (INIS)

    Kanashov, B.A.; Barinkov, O.P.; Dorofeev, A.N.; Komarov, S.V.; Smirnov, A.V.; Biro, L.; Budu, M.; Ciocanescu, M.

    2010-01-01

    Traditionally, spent fuel assemblies (SFA) have been transported across the Russian Federation by rail in special railcars. New conditions required SFA shipments by other conveyance, i.e. road, sea and even air transport. The air shipment of the VVR-S research reactor SNF in TUK-19 casks from Magurele, Romania in June 2009 was the first experience after new Russian and international regulations for the safe transport of radioactive material came into effect. The preparatory stage of the shipment focused on the issues associated with radiation and nuclear safety both during the loading and transport operations. The project covered development of a technology and equipment for SFA loading into TUK-19 casks and that for the air shipment. The SFAs were loaded into the TUK-19 casks with a specially designed transfer cask, and the SFA-containing packages were transported in specialized freight 20-foot ISO-containers. The safety of the loading and transport operations was ensured both by reliable engineering solutions, and selected conveyances and routes. The paper shows that the loading and the air shipment of the Romanian SFAs in TUK-19 casks does not contradict Romanian, Russian and international regulations for the safe transport of radioactive material. The outcomes of the SNF shipment from Romania confirmed correctness of the solutions and demonstrated high environmental safety. (author)

  6. Integrating SFA Technology into the Sales Curriculum: Helping Students Understand What, Why, and When

    Science.gov (United States)

    Jelinek, Ronald

    2018-01-01

    While sales force automation (SFA) and customer relationship management are important concepts in business-to-business selling, many instructors struggle to effectively integrate these topics into their curriculum. The research described in this article offers a role play and two coordinating sets of slides that aim to help students better…

  7. Prevalence of Avian Pathogenic Escherichia coli (APEC Clone Harboring sfa Gene in Brazil

    Directory of Open Access Journals (Sweden)

    Terezinha Knöbl

    2012-01-01

    Full Text Available Escherichia coli sfa+ strains isolated from poultry were serotyped and characterized by polymerase chain reaction (PCR and amplified fragment length polymorphism (AFLP. Isolates collected from 12 Brazilian poultry farms mostly belonged to serogroup O6, followed by serogroups O2, O8, O21, O46, O78, O88, O106, O111, and O143. Virulence genes associated were: iuc 90%, fim 86% neuS 60%, hly 34%, tsh 28%, crl/csg 26%, iss 26%, pap 18%, and 14% cnf. Strains from the same farm presented more than one genotypic pattern belonging to different profiles in AFLP. AFLP showed a clonal relation between Escherichia coli sfa+ serogroup O6. The virulence genes found in these strains reveal some similarity with extraintestinal E. coli (ExPEC, thus alerting for potential zoonotic risk.

  8. LLNL SFA OBER SBR FY17 Program Management and Performance Report: Subsurface Biogeochemistry of Actinides

    Energy Technology Data Exchange (ETDEWEB)

    Kersting, Annie B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-06-23

    A major scientific challenge in environmental sciences is to identify the dominant processes controlling actinide transport in the environment. It is estimated that currently, over 2200 metric tons of anthropogenic plutonium (Pu) has accumulated worldwide, a number that increases yearly with additional spent nuclear fuel (Ewing et al., 2010). Plutonium has been shown to migrate on the scale of kilometers, giving way to a critical concern that the fundamental biogeochemical processes that control its behavior in the subsurface are not well understood (Kersting et al. 1999; Novikov et al. 2006; Santschi et al. 2002). Neptunium (Np) is less prevalent in the environment; however, it is predicted to be a significant long-term dose contributor in high-level nuclear waste. Our focus on Np chemistry in this Science Plan is intended to help formulate a better understanding of Pu redox transformations in the environment and clarify the differences between the two long-lived actinides. The research approach of our Science Plan combines (1) Fundamental Mechanistic Studies that identify and quantify biogeochemical processes that control actinide behavior in solution and on solids, (2) Field Integration Studies that investigate the transport characteristics of Pu and test our conceptual understanding of actinide transport, and (3) Actinide Research Capabilities that allow us to achieve the objectives of this Scientific Focus Area (SFA) and provide new opportunities for advancing actinide environmental chemistry. These three Research Thrusts form the basis of our SFA Science Program.

  9. Experimental apparatus and analysis technique for studying the low Reynolds number hydrodynamic behavior of water-borne particulates

    International Nuclear Information System (INIS)

    Chase, R.R.P.; Tisue, G.T.

    1975-01-01

    A unique laboratory apparatus has been designed, constructed, and tested for analyzing the low Reynolds number hydrodynamic behavior of water-borne particulates. The system consists of an isothermal sedimentation chamber, collimated light sources, photographic optics, and monitoring devices. This apparatus is capable of providing dynamic information on water-borne particulates in the size range 2 μm to 700 μm, while simulating a realistic environment. Because of its flexibility, the equipment is being used to determine the kinematic behavior of gravitationally unstable organic mineral aggregates. The importance of organic mineral aggregates has been well established during the past decade. This material is believed to be a potential food source for marine biota at the lowest levels of the food chain. Organic mineral aggregates are also known to concentrate trace elements and other toxic substances and may be part of the control mechanism by which elemental concentrations are maintained in the water column. The benthic fluid mud layer and deep pelagic nepholoid layer consist, in part, of these sediments. Subsea petroleum reserves are thought to be the result of biogeochemical cycling of the organic-mineral complex. Undoubtedly, a fundamental study of these aggregates would be of value to many research interests

  10. Building scientific apparatus

    National Research Council Canada - National Science Library

    Moore, John H; Davis, Christopher C; Coplan, Michael A; Greer, Sandra C

    2009-01-01

    ... specification of the components of apparatus, many new to this edition. Data on the properties of materials and components used by manufacturers are included. Mechanical, optical, and electronic construction techniques carried out in the laboratory, as well as those let out to specialized shops, are also described. Step-by-step instruc...

  11. Training apparatus

    International Nuclear Information System (INIS)

    Monteith, W.D.

    1983-01-01

    Training apparatus for use in contamination surveillance uses a mathematical model of a hypothetical contamination source (e.g. nuclear, bacteriological or chemical explosion or leak) to determine from input data defining the contamination source, the contamination level at any location within a defined exercise area. The contamination level to be displayed by the apparatus is corrected to real time from a real time clock or may be displayed in response to a time input from a keyboard. In a preferred embodiment the location is defined by entering UTM grid reference coordinates using the keyboard. The mathematical model used by a microprocessor of the apparatus for simulation of contamination levels in the event of a nuclear explosion is described. (author)

  12. Radioimmunoassay apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Apparatus for performing a quantitative radioimmunoassay comprising: a substantially spherical bead for carrying an antibody and a gripper for gripping said bead, said gripper comprising an integrally formed unit having a single elongate handle portion and a plurality of resilient fingers arranged at the base of the handle so that when said bead is secured within said fingers, said bead may be freely rotated about any diametric axis of the bead. In particular the invention relates to an apparatus for a two site immunoradiometric assay for serum ferritin in human blood samples. (author)

  13. Encephalographic apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    An X-ray apparatus is described for determining the size and location of brain tumours by tomography during pneumoencephalography. The apparatus comprises an image recording device arranged opposite an X-ray source and a frame mounted on a tiltable patient table and rotatable with respect to the table. A patient support is arranged in the frame and is rotatable with respect to the frame. Air injected into the patients' spinal column travels up into the brain and displaces some of the cerebral fluid. Tomographic X-ray exposures are made of the air bubble which moves around in the brain cavities as the patient is rotated. (U.K.)

  14. TRANSFORMER APPARATUS

    Science.gov (United States)

    Wolfgang, F.; Nicol, J.

    1962-11-01

    Transformer apparatus is designed for measuring the amount of a paramagnetic substance dissolved or suspended in a diamagnetic liquid. The apparatus consists of a cluster of tubes, some of which are closed and have sealed within the diamagnetic substance without any of the paramagnetic material. The remaining tubes are open to flow of the mix- ture. Primary and secondary conductors are wrapped around the tubes in such a way as to cancel noise components and also to produce a differential signal on the secondaries based upon variations of the content of the paramagnetic material. (AEC)

  15. Radiotherapy apparatus

    International Nuclear Information System (INIS)

    Leung, P.M.; Webb, H.P.J.

    1985-01-01

    This invention relates to apparatus for applying intracavitary radiotherapy. In previously-known systems radioactive material is conveyed to a desired location within a patient by transporting a chain of balls pneumatically to and from an appropriately inserted applicator. According to this invention a ball chain for such a purpose comprises several radioactive balls separated by non-radioactive tracer balls of radiographically transparent material of lower density and surface hardness than the radioactive balls. The invention also extends to radiotherapy treatment apparatus comprising a storage, sorting and assembly system

  16. Radiography apparatus

    International Nuclear Information System (INIS)

    Sashin, D.; Sternglass, E.J.

    1982-01-01

    The apparatus of the present invention provides radiography apparatus wherein the use of a flat, generally rectangular beam or a fan-shaped beam of radiation in combination with a collimator, scintillator and device for optically coupling a self-scanning array of photodiodes to the scintillator means will permit production of images or image data with high contrast sensitivity and detail. It is contemplated that the self-scanning array of photodiodes may contain from about 60 to 2048, and preferably about 256 to 2048, individual photodiode elements per inch of object width, thereby permitting maximum data collection to produce a complete image or complete collection of image data

  17. Monitoring apparatus

    International Nuclear Information System (INIS)

    Keats, A.B.

    1981-01-01

    An improved monitoring apparatus for use with process plants, such as nuclear reactors, is described. System failure in the acquisition of data from the plant, owing to stuck signals, is avoided by arranging input signals from transducers in the plant in a test pattern. (U.K.)

  18. Prehensile apparatus

    Science.gov (United States)

    Smith, C.M.

    1993-10-12

    The present invention relates to an apparatus for handling a workpiece comprising a vessel that is longitudinally extensible and pressurizable, and a nonextensible and laterally flexible member on the vessel. The member constrains one side of the vessel to be nonextensible, causing the vessel to bend in the direction of the nonextensible member when pressurized. 8 figures.

  19. What is the best practice for benchmark regulation of electricity distribution? Comparison of DEA, SFA and StoNED methods

    International Nuclear Information System (INIS)

    Kuosmanen, Timo; Saastamoinen, Antti; Sipiläinen, Timo

    2013-01-01

    Electricity distribution is a natural local monopoly. In many countries, the regulators of this sector apply frontier methods such as data envelopment analysis (DEA) or stochastic frontier analysis (SFA) to estimate the efficient cost of operation. In Finland, a new StoNED method was adopted in 2012. This paper compares DEA, SFA and StoNED in the context of regulating electricity distribution. Using data from Finland, we compare the impacts of methodological choices on cost efficiency estimates and acceptable cost. While the efficiency estimates are highly correlated, the cost targets reveal major differences. In addition, we examine performance of the methods by Monte Carlo simulations. We calibrate the data generation process (DGP) to closely match the empirical data and the model specification of the regulator. We find that the StoNED estimator yields a root mean squared error (RMSE) of 4% with the sample size 100. Precision improves as the sample size increases. The DEA estimator yields an RMSE of approximately 10%, but performance deteriorates as the sample size increases. The SFA estimator has an RMSE of 144%. The poor performance of SFA is due to the wrong functional form and multicollinearity. - Highlights: • We compare DEA, SFA and StoNED methods in the context of regulation of electricity distribution. • Both empirical comparisons and Monte Carlo simulations are presented. • Choice of benchmarking method has a significant economic impact on the regulatory outcomes. • StoNED yields the most precise results in the Monte Carlo simulations. • Five lessons concerning heterogeneity, noise, frontier, simulations, and implementation

  20. Measuring the Efficiency of a Hospital based on the Econometric Stochastic Frontier Analysis (SFA) Method.

    Science.gov (United States)

    Rezaei, Satar; Zandian, Hamed; Baniasadi, Akram; Moghadam, Telma Zahirian; Delavari, Somayeh; Delavari, Sajad

    2016-02-01

    Hospitals are the most expensive health services provider in the world. Therefore, the evaluation of their performance can be used to reduce costs. The aim of this study was to determine the efficiency of the hospitals at the Kurdistan University of Medical Sciences using stochastic frontier analysis (SFA). This was a cross-sectional and retrospective study that assessed the performance of Kurdistan teaching hospitals (n = 12) between 2007 and 2013. The Stochastic Frontier Analysis method was used to achieve this aim. The numbers of active beds, nurses, physicians, and other staff members were considered as input variables, while the inpatient admission was considered as the output. The data were analyzed using Frontier 4.1 software. The mean technical efficiency of the hospitals we studied was 0.67. The results of the Cobb-Douglas production function showed that the maximum elasticity was related to the active beds and the elasticity of nurses was negative. Also, the return to scale was increasing. The results of this study indicated that the performances of the hospitals were not appropriate in terms of technical efficiency. In addition, there was a capacity enhancement of the output of the hospitals, compared with the most efficient hospitals studied, of about33%. It is suggested that the effect of various factors, such as the quality of health care and the patients' satisfaction, be considered in the future studies to assess hospitals' performances.

  1. EXTRACTION APPARATUS

    Science.gov (United States)

    Ballard, A.E.; Brigham, H.R.

    1958-10-28

    An apparatus whereby relatlvely volatile solvents may be contacted with volatile or non-volatile material without certaln attendant hazards is described. A suitable apparatus for handling relatively volatlle liqulds may be constructed comprising a tank, and a closure covering the tank and adapted to be securely attached to an external suppont. The closure is provided with a rigidly mounted motor-driven agitator. This agitator is connected from the driving motor lnto the lnterlor of the tank through a gland adapted to be cooled witb inert gas thereby eliminating possible hazard due to frictional heat. The closure is arranged so that the tank may be removed from it without materially dlsturbing the closure which, as described, carrles the motor driven agitator and other parts.

  2. Centrifuge apparatus

    Science.gov (United States)

    Sartory, Walter K.; Eveleigh, John W.

    1976-01-01

    A method and apparatus for operating a continuous flow blood separation centrifuge are provided. The hematocrit of the entrant whole blood is continuously maintained at an optimum constant value by the addition of plasma to the entrant blood. The hematocrit of the separated red cells is monitored to indicate the degree of separation taking place, thereby providing a basis for regulating the flow through the centrifuge.

  3. CASTING APPARATUS

    Science.gov (United States)

    Gray, C.F.; Thompson, R.H.

    1958-09-23

    An apparatus is described for casting small quantities of uranlum. It consists of a crucible having a hole in the bottom with a mold positioned below. A vertical rcd passes through the hole in the crucible and has at its upper end a piercing head adapted to break the oxide skin encasing a molten uranium body. An air tight cylinder surrounds the crucible and mold, and is arranged to be evacuated.

  4. Radiography apparatus

    International Nuclear Information System (INIS)

    Redmayne, I.G.B.

    1985-01-01

    Apparatus for the inspection of pipe welds comprises a radiation source for transmitting radiation, say as X-rays, through a pipe weld and a detector in a box arranged diametrically opposite the source, with respect to the pipe, for detecting the transmitted radiation and providing electrical signals which are processed to produce an image of the weld. The source and detector are mounted on a frame which is rotatable about an inner frame clamped to the pipe. (author)

  5. Overview of P.I.E. techniques for L.W.R. fuels at Saclay hot cells with special emphasis on new apparatus and on mechanical testing

    International Nuclear Information System (INIS)

    Blanc, J.Y.; Hardy, J.L.; Trotabas, M.

    1990-01-01

    This paper describes the state-of-the-art in the Saclay hot cells for examining L.W.R. fuels. First, we present the classical path followed by a fuel rod in the laboratory, to begin with non-destructive testing. This is completed by destructive examinations, such as free volume determination and fission gases analyses, density measurement and metallographies including X-rays diffraction and microprobe (EPMA/WDX). These two last techniques enable the identification of elements and chemical nature of compounds which are present. We also perform mechanical tests on metallic components, on clads and guide-tubes (tensile tests, creep, burst or fatigue tests by internal pressure). Another apparatus is devoted to the study of irradiated clad behaviour during LOCA-type transients. In the second chapter, a particular emphasis is given to the developments in progress, or planned in the near future. This includes: (a) The implementation of a new non-destructive testing bench to inspect more fuel rods simultaneously. (b) A new image analyzer to be applied e.g. to hydrides analysis in the clad, or to the inspection of safety test fuel bundles. (c) As for mechanical testing, we describe here the tensile tests on clads or on guide-tubes, performed on longitudinal samples or ring samples

  6. Performance Measurement Model for the Consumer Industry Listed on Indonesia Stock Exchange: DEA and SFA Approaches

    Directory of Open Access Journals (Sweden)

    T.Handono Eko Prabowo

    2014-08-01

    Full Text Available This  research  attempts  to  provide  performance  measurement  model  for  the  consumer industry listed on Indonesia Stock Exchange (IDX by  using the data envelopment analysis (DEA and the stochastic frontier analysis (SFA. There were 36 panel irms analyzed over the period of 2000-2005 or 216 pooled observations. The output variable was total sales and input variables were labor, inventory, ixed assets and capital. Z-variables are age of the irm, size  of  the  irm,  market  share  and  time  period.  Empirical  indings  reveal  that  the  average technical  eficiency  (mean  TE  for  consumer  industry  was  0.6630.  The  study  indicates  the existence of output slacks (output deicits and input slacks (input wastages in the consumer industry's  operation.  The  study  also  shows  that  the  joint  effect  of  four  z-variables  on  the technical  ineficiencies  of  the  consumer  industry  was  signiicant  although  the  individual effects of one or more variables might not be statistically signiicant. ";} // -->activate javascript

  7. THE GODFATHER DOCTRINE SECURITY FORCE ASSISTANCE (SFA) TRAINING - AN OFFER THE MARINE CORPS CAN’T REFUSE

    Science.gov (United States)

    2016-02-16

    experience training military advisors suggests that the commander’s exposure to military advising has a direct affect on who is nominated to advise... Advisor : CAPT Patrick J McCormick, USN 16 February 2016 DISTRIBUTION A. Approved for public release: distribution unlimited. 2 DISCLAIMER The...SFA AT) leader / senior advisor . He advised an Iraqi National Police (INP) Port of Entry Director near the Iraq / Syria Border and Afghan

  8. Radiography apparatus

    International Nuclear Information System (INIS)

    Vasseur, J.P.

    1976-01-01

    A novel apparatus for radiographic examination purposes comprising an x-ray source emitting a flat beam is described. Detectors are arranged in the plane of the beam in order each to pick up part of the beam. To avoid the Compton effect, each detector has associated with it an auxiliary detector which only receives the rays emitted by the Compton effect. An electrical circuit forms a predetermined linear combination of the signals respectively picked up by each detector and the associated auxiliary detector, this in order to prevent the errors which are due to the Compton effect when the beam passes through the body being analyzed

  9. A Low Concentration of Tacrolimus/Semifluorinated Alkane (SFA) Eyedrop Suppresses Intraocular Inflammation in Experimental Models of Uveitis.

    Science.gov (United States)

    De Majumdar, S; Subinya, M; Korward, J; Pettigrew, A; Scherer, D; Xu, H

    2017-01-01

    Corticosteroids remain the mainstay therapy for uveitis, a major cause of blindness in the working age population. However, a substantial number of patients cannot benefit from the therapy due to steroids resistance or intolerance. Tacrolimus has been used to treat refractory uveitis through systemic administration. The aim of this study was to evaluate the therapeutic potential of 0.03% tacrolimus eyedrop in mouse models of uveitis. 0.03% tacrolimus in perfluorobutylpentane (F4H5) (0.03% Tacrolimus/SFA) was formulated using a previously published protocol. Tacrolimus suspended in PBS (0.03% Tacrolimus/PBS) was used as a control. In addition, 0.1% dexamethasone (0.1% DXM) was used as a standard therapy control. Endotoxin-induced uveitis (EIU) and experimental autoimmune uveoretinitis (EAU) were induced in adult C57BL/6 mice using protocols described previously. Mice were treated with eyedrops three times/day immediately after EIU induction for 48 h or from day 14 to day 25 post-immunization (for EAU). Clinical and histological examinations were conducted at the end of the experiment. Pharmacokinetics study was conducted in mice with and without EIU. At different times after eyedrop treatment, ocular tissues were collected for tacrolimus measurement. The 0.03% Tacrolimus/SFA eyedrop treatment reduced the clinical scores and histological scores of intraocular inflammation in both EIU and EAU to the levels similar to 0.1% DXM eyedrop treatment. The 0.03% Tacrolimus/PBS did not show any suppressive effect in EIU and EAU. Pharmacokinetic studies showed that 15 min after topical administration of 0.03% Tacrolimus/SFA, low levels of tacrolimus were detected in the retina (48 ng/g tissue) and vitreous (2.5 ng/ml) in normal mouse eyes, and the levels were significantly higher in EIU eyes (102 ng/g tissue in the retina and 24 ng/ml in the vitreous). Tacrolimus remained detectable in intraocular tissues of EIU eyes 6 h after topical administration (68 ng/g retinal tissue, 10

  10. Comparative Effectiveness of Semantic Feature Analysis (SFA and Phonological Components Analysis (PCA for Anomia Treatment in Persian Speaking Patients With Aphasia

    Directory of Open Access Journals (Sweden)

    Zahra Sadeghi

    2017-09-01

    Discussion: While PCA is more effective for participants with phonological impairments, SFA is more effective for participants with semantic impairments. Therefore, a direct relationship between underlying functional deficit and response to specific treatment was established for all participants.

  11. Thermoforming apparatus

    International Nuclear Information System (INIS)

    Wallsten, H.I.

    1984-01-01

    Apparatus for manufacturing articles is disclosed in which a preheated sheet of thermoplastic material is intermittently fed to present successive preheated portions of the sheet in a work station having a forming tool for forming articles in each successive sheet portion and a stamping tool for co-operating with the forming tool to stamp the formed articles from the sheet. The forming tool has a plurality of forming dies which are movable successively and cyclically into the work station for forming articles in respective successive sheet portions. After each forming operation the stamping tool is brought into engagement with a resilient counter-surface on the forming die to stamp from the sheet the articles formed by that die

  12. Radiographic apparatus

    International Nuclear Information System (INIS)

    Dalton, B.L.

    1984-01-01

    This patent application describes a radiographic apparatus including an array of radiation sensors, a source of radiation for projecting a beam through a body and means for moving one of said source and array relative to the body and for producing an electrical signal representative of the movement of the other of said source and array needed to bring the array into register with the beam. Drive means are arranged to move the other of said source and array in response to the electrical signal. In one embodiment, the source is rotated by an amount measured by a grating and associated electronics. The required movement of the array to maintain registration is calculated and transmitted to a driver. Alternatively, a laser may be mounted with the same and the array driven so that the laser beam continuously impinges on a photocell mounted with the array. (author)

  13. Application of the zone-melting technique to metal chelate systems-VI A new apparatus for zone-melting chromatography.

    Science.gov (United States)

    Maeda, S; Kobayashi, H; Ueno, K

    1973-07-01

    An improved apparatus has been constructed for zone-melting chromatography. An essential feature of the apparatus is that the length of the molten zone can be kept constant during a zone-melting operation, by employing heating and cooling compartments which are separated from each other by double partition plates. Each compartment is heated or cooled with jets of hot or cold air. The apparatus is suitable for organic materials melting in the range between 40 degrees and 180 degrees . The distribution of metal ion along the column after zone melting of copper acetylacetonate in 2-methoxynaphthalene was a smooth curve. The plot of the position of maximum concentration, x(max), against the number of zone passes, n, gave a relationship in accordance with theoretical prediction.

  14. Purification apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Mortenson, C.W.

    1982-04-27

    An apparatus is provided for converting sea or other undrinkable waters to drinkable water without the use of driven or moving parts. Reliance upon gradient effects is made to effect the vaporization of, for example, sea water, followed by the condensation of the vapor to form distilled water. Gradient effects are achieved through the provision of differentials in the thermal conductivity, capillary activity, adsorptive, absorptive and/or pressure characteristics of particulate materials, or combinations of such physicals. For example, a column is packed with material graded as to its conductivity, the least thermally conductive material being nearest the cold or ambient water that is to be purified. In packing the column each successive layer of material has a greater thermal conductivity than the layer beneath it with the most conductive being at the top near the outlet arm of the column. The final outlet arm or tube is unheated or is at a temperature lower than that of the topmost conductive material so that vapor reaching the outlet tube gets condensed. This tube leads to a container kept in a cool place as, for example, buried in the ground, as, for instance, at the seashore deep enough to be cooled or to be surrounded by water, thus keeping the condensate cold. Pure water so collected is removed by such means as is desired. Other impure, volatile liquids may be similarly purified.

  15. Agreement of duplex ultrasonography vs. computed tomography angiography for evaluation of native and in-stent SFA re-stenosis—Findings from a randomized controlled trial

    International Nuclear Information System (INIS)

    Langenberger, Herbert; Schillinger, Martin; Plank, Christina; Sabeti, Schila; Dick, Petra; Cejna, Manfred; Lammer, Johannes; Minar, Erich; Loewe, Christian

    2012-01-01

    Background: Multidetector CT angiography (CTA) is a non-invasive imaging technique for evaluation of peripheral vascular disease. CTA might be particularly useful for assessment of intermediate- and long-term morphological outcome after endovascular treatment. Validation of CTA vs. the current imaging standard, colour Doppler ultrasonography (CDUS), for quantification of native and in-stent re-stenosis in the superficial femoral artery (SFA) is required. Methods: Seventy randomized patients who underwent stent implantation (n = 47) or balloon angioplasty (n = 23) underwent 6-month follow-up with CDUS and CTA. CTA was compared with CDUS in both sub-groups of patients in terms of binary re-stenosis (>50% lumen narrowing) and re-occlusion. Agreement between CTA and CDUS was assessed using Kappa (κ) statistics with 95% confidence intervals, and correlation coefficients. Results: Binary re-stenosis was detected in 16/70 (22.9%) patients by CTA and 17/70 (24.3%) patients by CDUS (κ = 0.88, 95% CI: 0.80–0.96). Re-stenosis rates after balloon angioplasty were 39.1% (9/23) on CTA and CDUS (κ = 0.82, 95% CI: 0.66–0.98), and after stent implantation 14.9% (7/47) on CTA and 17.0% (8/47) on CDUS (κ = 0.92, 95% CI: 0.84–1.00). Re-occlusions were detected in 3/70 (4.3%) patients by both CTA and CDUS (κ = 0.65; 95% CI 0.54–0.76). Significant correlations (r = 0.85, p < 0.001) were noted between degree of re-stenosis on CTA and peak velocity ratio on CDUS. The correlation coefficient was higher in patients after balloon angioplasty (r = 0.94, p < 0.001) than in patients after stent implantation (r = 0.71, p < 0.001). Conclusion: CTA and CDUS show excellent agreement for evaluation of native and in-stent re-stenosis after endovascular treatment of SFA obstructions. CTA is an appropriate non-invasive imaging modality for follow-up after endovascular therapy

  16. Mechanical properties of mammalian single smooth muscle cells. II. Evaluation of a modified technique for attachment of cells to the measurement apparatus

    NARCIS (Netherlands)

    J.J. Glerum (Jacobus); R. van Mastrigt (Ron)

    1990-01-01

    textabstractA method is described for attaching isolated single smooth muscle cells to an apparatus designed for measuring the longitudinal forces developed passively and actively by the cell upon straining, electrical or pharmacological stimulation. Primary attachment of the cell is based on its

  17. Semantic Feature Analysis (SFA in the Treatment of Naming Deficits: Evidence from a Malay Speaker with Non-Fluent Aphasia

    Directory of Open Access Journals (Sweden)

    Mohd Azmarul A Aziz

    2015-04-01

    Full Text Available Introduction Semantic Feature Analysis (SFA is a treatment for lexical retrieval impairment in which participants are cued by providing semantic information regarding concepts they have difficulty with in naming tasks in an effort to facilitate accurate lexical retrieval (Boyle & Coelho, 1995. People with aphasia are commonly found to have naming deficits and speech-language therapists (SLTs face difficulties in providing an effective treatment method to treat this deficit. This study aims to examine the use of SFA to address naming deficits for nouns and verbs in a Malay patient (KM with non-fluent aphasia. Methods The following tests were administered to the subject pre- and post- treatment: 1 Boston Diagnostic Aphasia Examination (BDAE; 2 Malay Object and Action Test (MOAT; and 3 A series of comprehension and production assessments in Malay. Subject was asked to name 101 and 50 pictures from MOAT. The stimuli were coloured photograph pictures. Treatment and probe (untrained stimuli were selected from pictures that a subject could not name, yielding 40 nouns and 30 verbs. From these, 20 stimuli were randomly chosen as probe items and 20 as treatment stimuli (nouns, 15 treatment and 15 probes (verbs. For the treatment study, single subject A-B-A design was implemented. Three baseline sessions were completed prior to treatment initiation naming for both probe and treatment pictures. Subject attended once-weekly therapy sessions over 8 months. Probes assessing generalizations to untrained pictures were presented at 4th, 8th, and 12th and so on until the end of the programme. Results Results showed that KM’s ability to name trained and untrained picture stimuli improved for both nouns and verbs. KM demonstrated steady improvement in the SFA treatment of trained nouns and verbs: from 5% baseline accuracy to over 90% accuracy at treatment end for nouns and from 0% baseline accuracy to 90% accuracy at treatment end for verbs. Generalizations to

  18. The ALPHA antihydrogen trapping apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Amole, C. [Department of Physics and Astronomy, York University, Toronto ON Canada, M3J 1P3 (Canada); Andresen, G.B. [Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Ashkezari, M.D. [Department of Physics, Simon Fraser University, Burnaby, BC Canada, V5A 1S6 (Canada); Baquero-Ruiz, M. [Department of Physics, University of California at Berkeley, Berkeley, CA 94720-7300 (United States); Bertsche, W. [Department of Physics, College of Science, Swansea University, Swansea SA2 8PP (United Kingdom); School of Physics and Astronomy, University of Manchester, Manchester M13 9PL (United Kingdom); The Cockcroft Institute, Warrington WA4 4AD (United Kingdom); Bowe, P.D. [Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); Butler, E. [Physics Department, CERN, CH-1211 Geneva 23 (Switzerland); Capra, A. [Department of Physics and Astronomy, York University, Toronto ON Canada, M3J 1P3 (Canada); Carpenter, P.T. [Department of Physics, Auburn University, Auburn, AL 36849-5311 (United States); Cesar, C.L. [Instituto de Física, Universidade Federal do Rio de Janeiro, Rio de Janeiro 21941-972 (Brazil); Chapman, S. [Department of Physics, University of California at Berkeley, Berkeley, CA 94720-7300 (United States); Charlton, M.; Deller, A.; Eriksson, S. [Department of Physics, College of Science, Swansea University, Swansea SA2 8PP (United Kingdom); Escallier, J. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Fajans, J. [Department of Physics, University of California at Berkeley, Berkeley, CA 94720-7300 (United States); Friesen, T. [Department of Physics and Astronomy, University of Calgary, Calgary AB, Canada, T2N 1N4 (Canada); Fujiwara, M.C.; Gill, D.R. [TRIUMF, 4004 Wesbrook Mall, Vancouver BC, Canada V6T 2A3 (Canada); Gutierrez, A. [Department of Physics and Astronomy, University of British Columbia, Vancouver BC, Canada V6T 1Z4 (Canada); and others

    2014-01-21

    The ALPHA collaboration, based at CERN, has recently succeeded in confining cold antihydrogen atoms in a magnetic minimum neutral atom trap and has performed the first study of a resonant transition of the anti-atoms. The ALPHA apparatus will be described herein, with emphasis on the structural aspects, diagnostic methods and techniques that have enabled antihydrogen trapping and experimentation to be achieved.

  19. The broad-host-range plasmid pSFA231 isolated from petroleum-contaminated sediment represents a new member of the PromA plasmid family.

    Science.gov (United States)

    Li, Xiaobin; Top, Eva M; Wang, Yafei; Brown, Celeste J; Yao, Fei; Yang, Shan; Jiang, Yong; Li, Hui

    2014-01-01

    A self-transmissible broad-host-range (BHR) plasmid pSFA231 was isolated from petroleum-contaminated sediment in Shen-fu wastewater irrigation zone, China, using the triparental mating exogenous plasmid capture method. Based on its complete sequence the plasmid has a size of 41.5 kb and codes for 50 putative open reading frames (orfs), 29 of which represent genes involved in replication, partitioning and transfer functions of the plasmid. Phylogenetic analysis grouped pSFA231 into the newly defined PromA plasmid family, which currently includes five members. Further comparative genomic analysis shows that pSFA231 shares the common backbone regions with the other PromA plasmids, i.e., genes involved in replication, maintenance and control, and conjugative transfer. Nevertheless, phylogenetic divergence was found in specific gene products. We propose to divide the PromA group into two subgroups, PromA-α (pMRAD02, pSB102) and PromA-β (pMOL98, pIPO2T, pSFA231, pTer331), based on the splits network analysis of the RepA protein. Interestingly, a cluster of hypothetical orfs located between parA and traA of pSFA231 shows high similarity with the corresponding regions on pMOL98, pIPO2T, and pTer331, suggesting these hypothetical orfs may represent "essential" plasmid backbone genes for the PromA-β subgroup. Alternatively, they may also be accessory genes that were first acquired and then stayed as the plasmid diverged. Our study increases the available collection of complete genome sequences of BHR plasmids, and since pSFA231 is the only characterized PromA plasmid from China, our findings also enhance our understanding of the genetic diversity of this plasmid group in different parts of the world.

  20. The broad-host-range plasmid pSFA231 isolated from petroleum-contaminated sediment represents a new member of the PromA plasmid family

    Directory of Open Access Journals (Sweden)

    Xiaobin eLi

    2015-01-01

    Full Text Available A self-transmissible broad-host-range (BHR plasmid pSFA231 was isolated from petroleum-contaminated sediment in Shen-fu wastewater irrigation zone, China, using the triparental mating exogenous plasmid capture method. Based on its complete sequence the plasmid has a size of 41.5 kb and codes for 50 putative open reading frames (orfs, 28 of which represent genes involved in replication, partitioning and transfer functions of the plasmid. Phylogenetic analysis grouped pSFA231 into the newly defined PromA plasmid family, which currently includes five members. Further comparative genomic analysis shows that pSFA231 shares the common backbone regions with the other PromA plasmids, i.e., genes involved in replication, maintenance and control, and conjugative transfer. Nevertheless, phylogenetic divergence was found in specific gene products. We propose to divide the PromA group into two subgroups, PromA-α (pMRAD02, pSB102 and PromA-β (pMOL98, pIPO2T, pSFA231, pTer331, based on the splits network analysis of the RepA protein. Interestingly, a cluster of hypothetical orfs located between parA and traA of pSFA231 shows high similarity with the corresponding regions on pMOL98, pIPO2T and pTer331, suggesting these hypothetical orfs may represent ‘‘essential’’ plasmid backbone genes for the PromA-β subgroup. Alternatively, they may also be accessory genes that were first acquired and then stayed as the plasmid diverged. Our study increases the available collection of complete genome sequences of BHR plasmids, and since pSFA231 is the only characterized PromA plasmid from China, our findings also enhance our understanding of the genetic diversity of this plasmid group in different parts of the world.

  1. Large Rotor Test Apparatus

    Data.gov (United States)

    Federal Laboratory Consortium — This test apparatus, when combined with the National Full-Scale Aerodynamics Complex, produces a thorough, full-scale test capability. The Large Rotor Test Apparatus...

  2. POSITIONING ANALYSIS OF ISLAMIC BANK vis-àvis CONVENTIONAL BANK IN INDONESIA USING PARAMETRIC SFA AND DFA METHODS15

    Directory of Open Access Journals (Sweden)

    Ir Ascarya

    2014-03-01

    Full Text Available This study will measure and compare the efficiency of Conventional and Islamic banks in Indonesia using parametric approach stochastic frontier approach (SFA and distribution free approach (DFA. These measurements will provide comprehensive and robust results of efficiency of individual bank compare to its peer group. The results using parametric SFA show that in 2002, conventional banks (0.79 were slightly more efficient than Islamic banks (0.77, while in 2003, the efficiency of Islamic banks improved to 0.84 and the efficiency of conventional banks worsen to 0.76, so that Islamic banks have become more efficient than conventional banks. Conventional and Islamic banks have been improving and converged to the highest level of efficiency (1.00 since 2004. The DFA results show that conventional banks (0.89 are only slightly more efficient than Islamic banks (0.87. Conventional public bank (0.93 is the most efficient, while Islamic regional bank (0.84 is the least efficient. Moreover, efficient banks (conventional and Islamic do not always have lower OCOI (operating costs divided by operating income, while banks with better OCOI usually are more profitable (have better return on assets or ROA. Therefore, technically, Islamic banks have shown their readiness to compete head to head with their conventional counterparts. However, other aspects, such as, number of networks and branches, service quality, convenience, products and services provided, human resources, and pricing, should have become the next priorities for improvements.JEL Classification : C10, C33, G21, G28Keywords : Islamic Banking, Efficiency, Stochastic Frontier Approach, Distribution Free Approach

  3. Gamma tomography apparatus

    International Nuclear Information System (INIS)

    Span, F.J.

    1988-01-01

    The patent concerns a gamma tomography apparatus for medical diagnosis. The apparatus comprises a gamma scintillation camera head and a suspension system for supporting and positioning the camera head with respect for the patient. Both total body scanning and single photon emission tomography can be carried out with the apparatus. (U.K.)

  4. ROLLER FILTRATION APPARATUS

    DEFF Research Database (Denmark)

    2017-01-01

    The present invention relates to the field of filtering, more precisely the present invention concerns an apparatus and a method for the separation of dry matter from a medium and the use of said apparatus. One embodiment discloses an apparatus for the separation of dry matter and liquid from a m...

  5. Pore roller filtration apparatus

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to the field of filtering, more precisely the present invention concerns an apparatus and a method for the separation of dry matter from a medium and the use of said apparatus. One embodiment discloses an apparatus for the separation of dry matter from a medium, comp...

  6. Gamma apparatuses for radiotherapy

    International Nuclear Information System (INIS)

    Sul'kin, A.G.

    1986-01-01

    Scientific and technical achievements in development and application of gamma therapeutic apparatuses for external and intracavity irradiations are generalized. Radiation-physical parameters of apparatuses providing usability of progressive methods in radiotherapy of onclogical patients are given. Optimization of main apparatus elements, ensurance of its operation reliability, reduction of errors of irradiation plan reproduction are considered. Attention is paid to radiation safety

  7. Multipactor discharge apparatus

    International Nuclear Information System (INIS)

    1976-01-01

    The invention deals with a multipactor discharge apparatus which can be used for tuning microwave organs such as magnetron oscillators and other cavity resonators. This apparatus is suitable for delivering an improved tuning effect in a resonation organ wherefrom the working frequency must be set. This apparatus is equipped with two multipactor discharge electrodes set in a configuration such to that a net current flows from one electrode to another. These electrodes are parallel and flat. The apparatus can be used in magnetron devices as well for continuous waves as for impulses

  8. Radiative Gasification Apparatus

    Data.gov (United States)

    Federal Laboratory Consortium — This apparatus, developed at EL, determines gasification rate (mass loss rate) of a horizontally oriented specimen exposed in a nitrogen environment to a controlled...

  9. Apparatus for Teaching Physics.

    Science.gov (United States)

    Gottlieb, Herbert H., Ed.

    1981-01-01

    Describes: (1) a variable inductor suitable for an inductance-capacitance bridge consisting of a fixed cylindrical solenoid and a moveable solenoid; (2) long-range apparatus for demonstrating falling bodies; and (3) an apparatus using two lasers to demonstrate ray optics. (SK)

  10. Pipework inspection apparatus

    International Nuclear Information System (INIS)

    Wrigglesworth, K.J.; Knowles, J.F.

    1987-01-01

    The patent concerns a pipework inspection apparatus, which is capable of negotiating bends in pipework. The apparatus comprises a TV camera system, which contains an optical section and an electronics section, which are connected by a flexible coupling. The system can be pulled or pushed along the bore of the pipework. (U.K.)

  11. Nuclear core baffling apparatus

    International Nuclear Information System (INIS)

    Cooper, F.W. Jr.; Silverblatt, B.L.; Knight, C.B.; Berringer, R.T.

    1979-01-01

    An apparatus for baffling the flow of reactor coolant fluid into and about the core of a nuclear reactor is described. The apparatus includes a plurality of longitudinally aligned baffle plates with mating surfaces that allow longitudinal growth with temperature increases while alleviating both leakage through the aligned plates and stresses on the components supporting the plates

  12. Fractionation and rectification apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Sauerwald, A

    1932-05-25

    Fractionation and rectifying apparatus with a distillation vessel and a stirring tube, drainage tubes leading from its coils to a central collecting tube, the drainage tubes being somewhat parallel and attached to the outer half of the stirring tube and partly on the inner half of the central collecting tube, whereby distillation and rectification can be effected in a single apparatus.

  13. Inulin supplementation reduces the negative effect of a high-fat diet rich in SFA on bone health of growing pigs.

    Science.gov (United States)

    Sobol, Monika; Raj, Stanisława; Skiba, Grzegorz

    2018-05-01

    Consumption of a high-fat diet, rich in SFA, causes deterioration of bone properties. Some studies suggest that feeding inulin to animals may increase mineral absorption and positively affect bone quality; however, these studies have been carried out only on rodents fed a standard diet. The primary objective of this study was to determine the effect of inulin on bone health of pigs (using it as an animal model for humans) fed a high-fat diet rich in SFA, having an unbalanced ratio of lysine:metabolisable energy. It was hypothesised that inulin reduces the negative effects of such a diet on bone health. At 50 d of age, twenty-one pigs were randomly allotted to three groups: the control (C) group fed a standard diet, and two experimental (T and TI) groups fed a high-fat diet rich in SFA. Moreover, TI pigs consumed an extra inulin supply (7 % of daily feed intake). After 10 weeks, whole-body bone mineral content (P=0·0054) and bone mineral density (P=0·0322) were higher in pigs of groups TI and C compared with those of group T. Femur bone mineral density was highest in pigs in group C, lower in group TI and lowest in group T (P=0·001). Femurs of pigs in groups TI and C had similar, but higher, maximum strength compared with femurs of pigs in group T (P=0·0082). In conclusion, consumption of a high-fat diet rich in SFA adversely affected bone health, but inulin supplementation in such a diet diminishes this negative effect.

  14. CASTING METHOD AND APPARATUS

    Science.gov (United States)

    Gray, C.F.; Thompson, R.H.

    1958-10-01

    An improved apparatus for the melting and casting of uranium is described. A vacuum chamber is positioned over the casting mold and connected thereto, and a rod to pierce the oxide skin of the molten uranium is fitted into the bottom of the melting chamber. The entire apparatus is surrounded by a jacket, and operations are conducted under a vacuum. The improvement in this apparatus lies in the fact that the top of the melting chamber is fitted with a plunger which allows squeezing of the oxide skin to force out any molten uranium remaining after the skin has been broken and the molten charge has been cast.

  15. Mirror plasma apparatus

    International Nuclear Information System (INIS)

    Moir, R.W.

    1981-01-01

    A mirror plasma apparatus which utilizes shielding by arc discharge to form a blanket plasma and lithium walls to reduce neutron damage to the wall of the apparatus. An embodiment involves a rotating liquid lithium blanket for a tandem mirror plasma apparatus wherein the first wall of the central mirror cell is made of liquid lithium which is spun with angular velocity great enough to keep the liquid lithium against the first material wall, a blanket plasma preventing the lithium vapor from contaminating the plasma

  16. Conduit grinding apparatus

    Science.gov (United States)

    Nachbar, Henry D.; Korytkowski, Alfred S.

    1991-01-01

    A grinding apparatus for grinding the interior portion of a valve stem receiving area of a valve. The apparatus comprises a faceplate, a plurality of cams mounted to an interior face of the faceplate, a locking bolt to lock the faceplate at a predetermined position on the valve, a movable grinder and a guide tube for positioning an optical viewer proximate the area to be grinded. The apparatus can either be rotated about the valve for grinding an area of the inner diameter of a valve stem receiving area or locked at a predetermined position to grind a specific point in the receiving area.

  17. Comparison of ankle-brachial index measured by an automated oscillometric apparatus with that by standard Doppler technique in vascular patients

    DEFF Research Database (Denmark)

    Korno, M.; Eldrup, N.; Sillesen, H.

    2009-01-01

    was calculated twice using both the methods on both legs. MATERIALS AND METHODS: We tested the automated oscillometric blood pressure device, CASMED 740, for measuring ankle and arm blood pressure and compared it with the current gold standard, the hand-held Doppler technique, by the Bland-Altman analysis....... RESULTS: Using the Doppler-derived ABI as the gold standard, the sensitivity and specificity of the oscillometric method for determining an ABI Udgivelsesdato: 2009/11...

  18. Profunda Anchor Technique for Ipsilateral Antegrade Approach in Endovascular Treatment of Superficial Femoral Artery Ostial Occlusion

    International Nuclear Information System (INIS)

    Pua, Uei

    2015-01-01

    Endovascular treatment of the superficial femoral artery (SFA) is challenging in the presence of flush ostial occlusion. One of the main challenges is the availability of access sites for intervention. Contralateral retrograde femoral access followed by cross-over and antegrade intervention while commonly used, may not be feasible in cases of altered iliac anatomy (e.g. kissing iliac stents). Ipsilateral antegrade intervention using common femoral artery (CFA) access in these instances while possible is typically challenging due to inadequate working length of the CFA for interrogation of the SFA ostium, compounded by the lack of sheath stability. The “profunda anchor” technique uses a buddy wire in the profunda femoris artery (PFA) to stabilize the sheath and allow catheter manipulation for antegrade intervention at the level of the SFA ostium. The PFA is further used as a conduit for deployment of closure device to avoid interference with the treated SFA

  19. Profunda Anchor Technique for Ipsilateral Antegrade Approach in Endovascular Treatment of Superficial Femoral Artery Ostial Occlusion

    Energy Technology Data Exchange (ETDEWEB)

    Pua, Uei, E-mail: druei@yahoo.com [Tan Tock Seng Hospital, Department of Diagnostic Radiology (Singapore)

    2015-04-15

    Endovascular treatment of the superficial femoral artery (SFA) is challenging in the presence of flush ostial occlusion. One of the main challenges is the availability of access sites for intervention. Contralateral retrograde femoral access followed by cross-over and antegrade intervention while commonly used, may not be feasible in cases of altered iliac anatomy (e.g. kissing iliac stents). Ipsilateral antegrade intervention using common femoral artery (CFA) access in these instances while possible is typically challenging due to inadequate working length of the CFA for interrogation of the SFA ostium, compounded by the lack of sheath stability. The “profunda anchor” technique uses a buddy wire in the profunda femoris artery (PFA) to stabilize the sheath and allow catheter manipulation for antegrade intervention at the level of the SFA ostium. The PFA is further used as a conduit for deployment of closure device to avoid interference with the treated SFA.

  20. Tomographic scanning apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Details are given of a tomographic scanning apparatus, with particular reference to a multiplexer slip ring means for receiving output from the detectors and enabling interfeed to the image reconstruction station. (U.K.)

  1. Tomographic scanning apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Details are presented of a tomographic scanning apparatus, its rotational assembly, and the control and circuit elements, with particular reference to the amplifier and multiplexing circuits enabling detector signal calibration. (U.K.)

  2. Tomographic scanning apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    This patent specification relates to a tomographic scanning apparatus using a fan beam and digital output signal, and particularly to the design of the gas-pressurized ionization detection system. (U.K.)

  3. Scintillation counting apparatus

    International Nuclear Information System (INIS)

    Noakes, J.E.

    1978-01-01

    Apparatus is described for the accurate measurement of radiation by means of scintillation counters and in particular for the liquid scintillation counting of both soft beta radiation and gamma radiation. Full constructional and operating details are given. (UK)

  4. Imaging Apparatus And Method

    NARCIS (Netherlands)

    Manohar, Srirang; van Leeuwen, A.G.J.M.

    2010-01-01

    A thermoacoustic imaging apparatus comprises an electromagnetic radiation source configured to irradiate a sample area and an acoustic signal detection probe arrangement for detecting acoustic signals. A radiation responsive acoustic signal generator is added outside the sample area. The detection

  5. IMAGING APPARATUS AND METHOD

    NARCIS (Netherlands)

    Manohar, Srirang; van Leeuwen, A.G.J.M.

    2008-01-01

    A thermoacoustic imaging apparatus comprises an electromagnetic radiation source configured to irradiate a sample area and an acoustic signal detection probe arrangement for detecting acoustic signals. A radiation responsive acoustic signal generator is added outside the sample area. The detection

  6. Thermal Acoustic Fatigue Apparatus

    Data.gov (United States)

    Federal Laboratory Consortium — The Thermal Acoustic Fatigue Apparatus (TAFA) is a progressive wave tube test facility that is used to test structures for dynamic response and sonic fatigue due to...

  7. Light shielding apparatus

    Science.gov (United States)

    Miller, Richard Dean; Thom, Robert Anthony

    2017-10-10

    A light shielding apparatus for blocking light from reaching an electronic device, the light shielding apparatus including left and right support assemblies, a cross member, and an opaque shroud. The support assemblies each include primary support structure, a mounting element for removably connecting the apparatus to the electronic device, and a support member depending from the primary support structure for retaining the apparatus in an upright orientation. The cross member couples the left and right support assemblies together and spaces them apart according to the size and shape of the electronic device. The shroud may be removably and adjustably connectable to the left and right support assemblies and configured to take a cylindrical dome shape so as to form a central space covered from above. The opaque shroud prevents light from entering the central space and contacting sensitive elements of the electronic device.

  8. Tomographic scanning apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    This patent specification describes a tomographic scanning apparatus, with particular reference to the adjustable fan beam and its collimator system, together with the facility for taking a conventional x-radiograph without moving the patient. (U.K.)

  9. Fuel pellet loading apparatus

    International Nuclear Information System (INIS)

    1980-01-01

    Apparatus is described for loading a predetermined amount of nuclear fuel pellets into nuclear fuel elements and particularly for the automatic loading of fuel pellets from within a sealed compartment. (author)

  10. Apparatus for drying sugar cubes

    NARCIS (Netherlands)

    Derckx, H.A.J.; Torringa, H.M.

    1999-01-01

    Device for drying sugar cubes containing a heating apparatus for heating and dehumidifying the sugar cubes, a conditioning apparatus for cooling off and possibly further dehumidifying the sugar cubes and a conveying apparatus for conveying the sugar cubes through the heating apparatus and the

  11. Test sample handling apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    A test sample handling apparatus using automatic scintillation counting for gamma detection, for use in such fields as radioimmunoassay, is described. The apparatus automatically and continuously counts large numbers of samples rapidly and efficiently by the simultaneous counting of two samples. By means of sequential ordering of non-sequential counting data, it is possible to obtain precisely ordered data while utilizing sample carrier holders having a minimum length. (U.K.)

  12. Radiation imaging apparatus

    International Nuclear Information System (INIS)

    1979-01-01

    This invention relates to a radiation imaging apparatus. It relates more particularly to apparatus of this general type which employs stationary X-ray source and detector arrays capable of acquiring multiple ultrafast scans per second to facilitate the dynamic study of moving human organs such as the beating heart. While the invention has many applications, it has particular utility in connection with computerized tomographic (CT) scanners. (Auth.)

  13. X-ray apparatus

    International Nuclear Information System (INIS)

    Tomita, Chuji.

    1980-01-01

    A principal object of the present invention is to provide an X-ray apparatus which is such that the distance between the surface of the patient's table and the floor on which the apparatus is installed is sufficiently small in the horizontal position of the patient's table of the roentgenographical pedestal and that the rotation of the pedestal from the horizontal position to a tilted position and further to the vertical position of the table can be carried out smoothly. (auth)

  14. Sludge recovery apparatus

    International Nuclear Information System (INIS)

    Marmo, A.R.

    1979-01-01

    An improved design of a sludge recovery apparatus used in the fabrication of nuclear fuel is described. This apparatus provides for automatic separation of sludge from the grinder coolant, drying of the sludge into a flowable powder and transfer of the dry powder to a salvage container. It can be constructed to comply with criticality-safe-geometry requirements and to obviate need for operating personnel in its immediate vicinity. (UK)

  15. Infrared microscope inspection apparatus

    Science.gov (United States)

    Forman, Steven E.; Caunt, James W.

    1985-02-26

    Apparatus and system for inspecting infrared transparents, such as an array of photovoltaic modules containing silicon solar cells, includes an infrared microscope, at least three sources of infrared light placed around and having their axes intersect the center of the object field and means for sending the reflected light through the microscope. The apparatus is adapted to be mounted on an X-Y translator positioned adjacent the object surface.

  16. Apparatus Development In Maros

    Directory of Open Access Journals (Sweden)

    H. Aras Solong

    2015-03-01

    Full Text Available ABSTRACT This study aims to identify and describe 1 Development of Administrative through education and training training promotion transfer and rotation and the application of demotion system non-title under Law No. 43 of 1999 on the development of career civil servants based merit system and work performance and Government Regulation No. 101 of 2000 on Education and Training Training for Civil Servants. 2 Revealing differences in work motivation based on the intensity of the education or training training using Herzbergs Two Factor Theory of extrinsic factors hygiene and intrinsic factors motivator that influence employees motivation Maros regency government in carrying out its duties and functions as members civil in public service. This study uses a quantitative approach to date collection techniques through a questionnaire Questionnaire. Informant are civil servants who occupied echelon II III. And IV while the analysis of the date used quantitative analysis to uncover the implementation of personnel development and employees motivation difference Maros region based on the intensity of the education or training training to get job satisfaction in the public service. The results of this study will reveal that 1 Development of Apparatus for improving the knowledge ability professionalism competence skills can work as a reformer change attitude eager to work motivated to do the work get satisfaction in work and getting justice in employment. 2 The difference in work motivation Maros local government employees affected by extrinsic factors hygiene and intrinsic factor motivator is the variable gain high salary H occupies the first ranking while serving the community satisfaction variables M occupy the last ranking. That is that the satisfaction of serving the people affected by the high salaries earned by the employees to do the job.

  17. Improved cold neutron radiographic apparatus and method

    International Nuclear Information System (INIS)

    1981-01-01

    An improved cold neutron radiography technique is described in which the neutron temperature is matched to the specific material to be analyzed. In addition to a beam source and detector the apparatus incorporates a cryogenic refrigerator which enables the moderator material to be cooled to a predetermined adjustable temperature below the Bragg edge temperature of the sample. (U.K.)

  18. Electroless plating apparatus for discrete microsized particles

    International Nuclear Information System (INIS)

    Mayer, A.

    1978-01-01

    Method and apparatus are disclosed for producing very uniform coatings of a desired material on discrete microsized particles by electroless techniques. Agglomeration or bridging of the particles during the deposition process is prevented by imparting a sufficiently random motion to the particles that they are not in contact with each other for a time sufficient for such to occur

  19. Analysis apparatus and method of analysis

    International Nuclear Information System (INIS)

    1976-01-01

    A continuous streaming method developed for the excution of immunoassays is described in this patent. In addition, a suitable apparatus for the method was developed whereby magnetic particles are automatically employed for the consecutive analysis of a series of liquid samples via the RIA technique

  20. Apparatus for ultrasonic nebulization

    International Nuclear Information System (INIS)

    Olson, K.W.; Haas, W.J. Jr.; Fassel, V.A.

    1978-01-01

    An improved apparatus is described for ultrasonic nebulization of liquid samples or suspensions in which the piezoelectric transducer is protected from chemical attack and erosion. The transducer is protected by being bonded to the inner surface of a glass plate which forms one end wall of a first hollow body provided with apparatus for circulating a fluid for cooling and stabilizing the transducer. The glass plate, which is one-half wavelength in thickness to provide an acoustically coupled outer nebulizing surface, seals an opening in a second hollow body which encloses an aerosol mixing chamber. The second body includes apparatus for delivering the sample solution to the nebulizing surface, a gas inlet for providing a flow of carrier gas for transporting the aerosol of the nebulized sample and an aerosol outlet

  1. Uranium dioxide calcining apparatus

    International Nuclear Information System (INIS)

    Cole, E.A.; Peterson, R.S.

    1978-01-01

    This invention relates to an improved continuous calcining apparatus for consistently and controllably producing from calcinable reactive solid compounds of uranium, such as ammonium diuranate, uranium dioxide (UO 2 ) having an oxygen to uranium ratio of less than 2.2. The apparatus comprises means at the outlet end of a calciner kiln for receiving hot UO 2 , means for cooling the UO 2 to a temperature of below 100 deg C and conveying the cooled UO 2 to storage or to subsequent UO 2 processing apparatus where it finally comes into contact with air, the means for receiving cooling and conveying being sealed to the outlet end of the calciner and being maintained full of UO 2 and so operable as to exclude atmospheric oxygen from coming into contact with any UO 2 which is at elevated temperatures where it would readily oxidize, without the use of extra hydrogen gas in said means. (author)

  2. Electroplating method and apparatus

    International Nuclear Information System (INIS)

    Looney, R.B.; Smith, W.E.L.

    1978-01-01

    Disclosed is an apparatus for high speed electroplating or anodizing tubular members such as nuclear reactor fuel elements. A loading arm positions the member on a base for subsequent support by one of two sets of electrical contacts. A carriage assembly positions electrodes into and around the member. Electrolyte is pumped between the electrodes and the member while electric current is applied. Programmed controls sequentially employ each of the two sets of contacts to expose all surfaces of the member to the electrolyte. The member is removed from the apparatus by an unloading arm

  3. Electroplating method and apparatus

    Science.gov (United States)

    Looney, Robert B.; Smith, William E. L.

    1978-06-20

    An apparatus for high speed electroplating or anodizing tubular members such as nuclear reactor fuel elements. A loading arm positions the member on a base for subsequent support by one of two sets of electrical contacts. A carriage assembly positions electrodes into and around the member. Electrolyte is pumped between the electrodes and the member while electric current is applied. Programmed controls sequentially employ each of the two sets of contacts to expose all surfaces of the member to the electrolyte. The member is removed from the apparatus by an unloading arm.

  4. Construction apparatus for thermochemical hydrogen production process

    Energy Technology Data Exchange (ETDEWEB)

    Kubo, S.; Nakajima, H.; Higashi, S.; Onuki, K.; Akino, S.S.N. [Japan Atomic Energy Research Inst., Ibaraki-ken (Japan). Nuclear Heat Utilization Engineering Lab

    2001-06-01

    Studies have been carried out at the Japan Atomic Energy Research Institute (JAERI) on hydrogen production through thermochemical processes such as water-splitting. These studies are classified with iodine-sulphur cycle studies using heat from high temperature gas-cooled reactors. An experimental apparatus was constructed with fluorine resin, glass and quartz. It can produce hydrogen at a rate of 50 litres per hour. Electricity provides the heat required for the operation. The closed chemical process requires special control techniques. The process flow diagram for the apparatus was designed based on the results of previous studies including one where hydrogen production was successfully achieved at a rate of one liter per hour for 48 hours. Experimental operations under atmospheric pressure will be carried out for the next four years to develop the process. The data will be used in the next research and development programs aimed at designing a bench-scale apparatus. 7 refs., 1 tab., 8 figs.

  5. Semiconductor apparatus and method of fabrication for a semiconductor apparatus

    NARCIS (Netherlands)

    2010-01-01

    The invention relates to a semiconductor apparatus (1) and a method of fabrication for a semiconductor apparatus (1), wherein the semiconductor apparatus (1) comprises a semiconductor layer (2) and a passivation layer (3), arranged on a surface of the semiconductor layer (2), for passivating the

  6. Tomographic scanning apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Details are given of a tomographic scanning apparatus, with particular reference to the means of adjusting the apparent gain of the signal processing means for receiving output signals from the detectors, to compensate for drift in the gain characteristics, including means for passing a reference signal. (U.K.)

  7. Positioning and locking apparatus

    Science.gov (United States)

    Hayward, M.L.; Harper, W.H.

    1985-06-19

    A positioning and locking apparatus including a fixture having a rotatable torque ring provided with a plurality of cam segments for automatically guiding a container into a desired location within the fixture. Rotation of the ring turns the container into a final position in pressure sealing relation against a hatch member.

  8. Electrolysis apparatus and method

    International Nuclear Information System (INIS)

    1975-01-01

    A procedure in which electrolysis is combined with radiolysis to improve the reaction yield is proposed for the production of hydrogen and oxygen from water. An apparatus for this procedure is disclosed. High-energy electric pulses are applied between the anode and kathode of an electrolytical cell in such a way that short-wave electromagnetic radiation is generated at the same time

  9. Mobile lighting apparatus

    Science.gov (United States)

    Roe, George Michael; Klebanoff, Leonard Elliott; Rea, Gerald W; Drake, Robert A; Johnson, Terry A; Wingert, Steven John; Damberger, Thomas A; Skradski, Thomas J; Radley, Christopher James; Oros, James M; Schuttinger, Paul G; Grupp, David J; Prey, Stephen Carl

    2013-05-14

    A mobile lighting apparatus includes a portable frame such as a moveable trailer or skid having a light tower thereon. The light tower is moveable from a stowed position to a deployed position. A hydrogen-powered fuel cell is located on the portable frame to provide electrical power to an array of the energy efficient lights located on the light tower.

  10. Apparatus for decomposing shale

    Energy Technology Data Exchange (ETDEWEB)

    Gislain, M

    1865-06-20

    The apparatus is designed to fulfill the three following conditions: (1) complete extraction of the mineral oil, by avoiding partial decomposition; (2) purification of the said oil from products formed in the decomposition of the shale; (3) breaking down of the said oil into more products of different density. The separation of the heavy and bituminous products is claimed.

  11. Apparatus for use in radioimmunoassays

    International Nuclear Information System (INIS)

    Chen, C-H.; Tsay, H-M.; Heyer, R.E.

    1979-01-01

    Apparatus for solid-phase antibody separation techniques used in radioimmunoassays is described in this invention. It consists of a rectangular prism tray with multiple wells protruding into its interior from one side. Near the base of the tray is an orifice used for creating evacuated condition within the structure. At the base of each well there is an orifice of such size and shape as to retain an aqueous liquid under given pressure conditions but permit the evacuation of this liquid at reduced pressure. The outlet of these orifices is in the shape of an inverted conical frustrum. Each of the wells contains an antibody coated disc of porous cellulose paper surrounded by a plastic support. The porous nature of the cellulose paper ensures contact between the antibody coating and the antigen. The use of antibody coated porous cellulose paper in combination with the vacuum operated apparatus simplifies the manipulative steps whilst still maintaining the sensitivity of the radioimmunoassay. It also obviates the need for aspiration and thus lessens the risk of contamination from one sample to another. (UK)

  12. BETA (Bitter Electromagnet Testing Apparatus)

    Science.gov (United States)

    Bates, Evan M.; Birmingham, William J.; Rivera, William F.; Romero-Talamas, Carlos A.

    2017-10-01

    The Bitter Electromagnet Testing Apparatus (BETA) is a 1-Tesla (T) prototype of the 10-T Adjustable Long Pulse High-Field Apparatus (ALPHA). These water-cooled resistive magnets use high DC currents to produce strong uniform magnetic fields. Presented here is the successful completion of the BETA project and experimental results validating analytical magnet designing methods developed at the Dusty Plasma Laboratory (DPL). BETA's final design specifications will be highlighted which include electromagnetic, thermal and stress analyses. The magnet core design will be explained which include: Bitter Arcs, helix starters, and clamping annuli. The final version of the magnet's vessel and cooling system are also presented, as well as the electrical system of BETA, which is composed of a unique solid-state breaker circuit. Experimental results presented will show the operation of BETA at 1 T. The results are compared to both analytical design methods and finite element analysis calculations. We also explore the steady state maximums and theoretical limits of BETA's design. The completion of BETA validates the design and manufacturing techniques that will be used in the succeeding magnet, ALPHA.

  13. Radioactive waste processing apparatus

    Science.gov (United States)

    Nelson, R.E.; Ziegler, A.A.; Serino, D.F.; Basnar, P.J.

    1985-08-30

    Apparatus for use in processing radioactive waste materials for shipment and storage in solid form in a container is disclosed. The container includes a top, and an opening in the top which is smaller than the outer circumference of the container. The apparatus includes an enclosure into which the container is placed, solution feed apparatus for adding a solution containing radioactive waste materials into the container through the container opening, and at least one rotatable blade for blending the solution with a fixing agent such as cement or the like as the solution is added into the container. The blade is constructed so that it can pass through the opening in the top of the container. The rotational axis of the blade is displaced from the center of the blade so that after the blade passes through the opening, the blade and container can be adjusted so that one edge of the blade is adjacent the cylindrical wall of the container, to insure thorough mixing. When the blade is inside the container, a substantially sealed chamber is formed to contain vapors created by the chemical action of the waste solution and fixant, and vapors emanating through the opening in the container. The chamber may be formed by placing a removable extension over the top of the container. The extension communicates with the apparatus so that such vapors are contained within the container, extension and solution feed apparatus. A portion of the chamber includes coolant which condenses the vapors. The resulting condensate is returned to the container by the force of gravity.

  14. Nuclear magnetic resonance apparatus

    International Nuclear Information System (INIS)

    Lambert, R.

    1991-01-01

    In order to include the effect of a magnetic object in a subject under investigation, Nuclear Magnetic Resonance (NMR) apparatus is operable at more than one radio frequency (RF) frequency. The apparatus allows normal practice as far as obtaining an NMR response or image from a given nuclear species is concerned, but, in addition, interrogates the nuclear spin system at a frequency which is different from the resonance frequency normally used for the given nuclear species, as determined from the applied magnetic field. The magnetic field close to a magnetised or magnetisable object is modified and the given nuclear species gives a response at the different frequency. Thus detection of a signal at the frequency indicates the presence of the chosen nuclei close to the magnetised or magnetisable object. Applications include validation of an object detection or automatic shape inspection system in the presence of magnetic impurities, and the detection of magnetic particles which affect measurement of liquid flow in a pipe. (author)

  15. Ion implantation apparatus

    International Nuclear Information System (INIS)

    Forneris, J.L.; Hicks, W.W.; Keller, J.H.; McKenna, C.M.; Siermarco, J.A.; Mueller, W.F.

    1981-01-01

    The invention relates to ion bombardment or implantation apparatus. It comprises an apparatus for bombarding a target with a beam of ions, including an arrangement for measuring the ion beam current and controlling the surface potential of the target. This comprises a Faraday cage formed, at least in part, by the target and by walls adjacent to, and electrically insulated from, the target and surrounding the beam. There is at least one electron source for supplying electrons to the interior of the Faraday cage and means within the cage for blocking direct rectilinear radiation from the source to the target. The target current is measured and combined with the wall currents to provide a measurement of the ion beam current. The quantity of electrons supplied to the interior of the cage can be varied to control the target current and thereby the target surface potential. (U.K.)

  16. Improvements in measuring apparatus

    International Nuclear Information System (INIS)

    Casey, W.

    1976-01-01

    Measuring apparatus is described that is suitable for gauging the wall profiles of downwardly extending channels in nuclear reactors, but which is equally applicable to channels such as pipe bores and conduits in other types of plant. The apparatus comprises a probe carrying a measuring transducer giving an electrical output. The probe support may be moved stepwise along the channel along a track between end members. An electrical conductor is provided for transmitting the electrical output of the transducer to an indicator located remote from the probe. The probe support may consist of a cable attached at one end to a winding drum, and incorporating an electrical conductor connected to the transducer. Channel engaging means are provided on the probe that permits free upward movement of the probe when the latter is suspended by the cable and moves into gripping engagement with the channel wall when the tension in the cable is relaxed. (U.K.)

  17. Wave disc engine apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Muller, Norbert; Piechna, Janusz; Sun, Guangwei; Parraga, Pablo-Francisco

    2018-01-02

    A wave disc engine apparatus is provided. A further aspect employs a constricted nozzle in a wave rotor channel. A further aspect provides a sharp bend between an inlet and an outlet in a fluid pathway of a wave rotor, with the bend being spaced away from a peripheral edge of the wave rotor. A radial wave rotor for generating electricity in an automotive vehicle is disclosed in yet another aspect.

  18. Medical radiological apparatus

    International Nuclear Information System (INIS)

    1980-01-01

    With the apparatus described, images can be obtained by rotation scanning and the image formation from a three dimensional image matrix is converted into an overall picture. Detectors for both X-ray radiation and γ radiation are present and these consist of a row of detector elements, from each of which a separate read-out can be obtained. Therefore both X-ray and γ ray images emitted from the examined object can be obtained. (Th.P.)

  19. Multicusp plasma containment apparatus

    International Nuclear Information System (INIS)

    Limpaecher, R.

    1980-01-01

    It has been discovered that plasma containment by a chamber having multi-pole magnetic cusp reflecting walls in combination with electronic injection for electrostatic containment provides the means for generating magnetic field free quiescent plasmas for practical application in ion-pumps, electronic switches, and the like. 1250 ''alnico v'' magnets 1/2 '' X 1/2 '' X 1 1/2 '' provide containment in one embodiment. Electromagnets embodying toroidal funneling extend the principle to fusion apparatus

  20. Apparatus for obtaining radiographs

    International Nuclear Information System (INIS)

    Frank, L.F.

    1977-01-01

    An apparatus for making x-ray pictures by imagewise exposing a cloud chamber containing a high atomic number gas mixed with a condensate vapor is described. The gas is under sufficiently high pressure to assure substantially complete absorption of the incident x-rays. Optical means are provided so that visible x-ray tracks are viewed from a direction aligned with the tracks

  1. Pyrolysis process and apparatus

    Science.gov (United States)

    Lee, Chang-Kuei

    1983-01-01

    This invention discloses a process and apparatus for pyrolyzing particulate coal by heating with a particulate solid heating media in a transport reactor. The invention tends to dampen fluctuations in the flow of heating media upstream of the pyrolysis zone, and by so doing forms a substantially continuous and substantially uniform annular column of heating media flowing downwardly along the inside diameter of the reactor. The invention is particularly useful for bituminous or agglomerative type coals.

  2. Thermal power measurement apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Thermal power measurements are important in nuclear power plants, fossil-fuel plants and other closed loop systems such as heat exchangers and chemical reactors. The main object of this invention is to determine the enthalpy of a fluid using only acoustically determined sound speed and correlating the speed with enthalpy. An enthalpy change is measured between two points in the fluid flow: the apparatus is described in detail. (U.K.)

  3. Air-cleaning apparatus

    International Nuclear Information System (INIS)

    Howard, A.G.

    1981-01-01

    An air-cleaning, heat-exchange apparatus includes a main housing portion connected by means of an air inlet fan to the kitchen exhaust stack of a restaurant. The apparatus includes a plurality of heat exchangers through which a heat-absorptive fluid is circulated, simultaneously, by means of a suitable fluid pump. These heat exchangers absorb heat from the hot exhaust gas, out of the exhaust stack of the restaurant, which flows over and through these heat exchangers and transfers this heat to the circulating fluid which communicates with remote heat exchangers. These remote heat exchangers further transfer this heat to a stream of air, such as that from a cold-air return duct for supplementing the conventional heating system of the restaurant. Due to the fact that such hot exhaust gas is heavily grease laden , grease will be deposited on virtually all internal surfaces of the apparatus which this exhaust gas contacts. Consequently, means are provided for spraying these contacted internal surfaces , as well as the hot exhaust gas itself, with a detergent solution in which the grease is soluble, thereby removing grease buildup from these internal surfaces

  4. Dosimeter charging apparatus

    International Nuclear Information System (INIS)

    Reuter, F.A.; Moorman, Ch.J.

    1985-01-01

    An apparatus for charging a dosimeter which has a capacitor connected between first and second electrodes and a movable electrode in a chamber electrically connected to the first electrode. The movable electrode deflects varying amounts depending upon the charge present on said capacitor. The charger apparatus includes first and second charger electrodes couplable to the first and second dosimeter electrodes. To charge the dosimeter, it is urged downwardly into a charging socket on the charger apparatus. The second dosimeter electrode, which is the dosimeter housing, is electrically coupled to the second charger electrode through a conductive ring which is urged upwardly by a spring. As the dosimeter is urged into the socket, the ring moves downwardly, in contact with the second charger electrode. As the dosimeter is further urged downwardly, the first dosimeter electrode and first charger electrode contact one another, and an insulator post carrying the first and second charger electrodes is urged downwardly. Downward movement of the post effects the application of a charging potential between the first and second charger electrodes. After the charging potential has been applied, the dosimeter is moved further into the charging socket against the force of a relatively heavy biasing spring until the dosimeter reaches a mechanical stop in the charging socket

  5. Water intake fish diversion apparatus

    International Nuclear Information System (INIS)

    Taft, E.P. III; Cook, T.C.

    1995-01-01

    A fish diversion apparatus uses a plane screen to divert fish for variety of types of water intakes in order to protect fish from injury and death. The apparatus permits selection of a relatively small screen angle, for example ten degrees, to minimize fish injury. The apparatus permits selection of a high water velocity, for example ten feet per second, to maximize power generation efficiency. The apparatus is especially suitable retrofit to existing water intakes. The apparatus is modular to allow use plural modules in parallel to adjust for water flow conditions. The apparatus has a floor, two opposite side walls, and a roof which define a water flow passage and a plane screen within the passage. The screen is oriented to divert fish into a fish bypass which carries fish to a safe discharge location. The dimensions of the floor, walls, and roof are selected to define the dimensions of the passage and to permit selection of the screen angle. The floor is bi-level with a level upstream of the screen and a level beneath screen selected to provide a uniform flow distribution through the screen. The apparatus may include separation walls to provide a water flow channel between the apparatus and the water intake. Lead walls may be used to adjust water flow conditions into the apparatus. The apparatus features stoplog guides near its upstream and downstream ends to permit the water flow passage to be dewatered. 3 figs

  6. Thermal stir welding apparatus

    Science.gov (United States)

    Ding, R. Jeffrey (Inventor)

    2011-01-01

    A welding method and apparatus are provided for forming a weld joint between first and second elements of a workpiece. The method includes heating the first and second elements to form an interface of material in a plasticized or melted state interface between the elements. The interface material is then allowed to cool to a plasticized state if previously in a melted state. The interface material, while in the plasticized state, is then mixed, for example, using a grinding/extruding process, to remove any dendritic-type weld microstructures introduced into the interface material during the heating process.

  7. Magnetic resonance imaging apparatus

    International Nuclear Information System (INIS)

    Ehnholm, G.J.

    1991-01-01

    This patent describes an electron spin resonance enhanced magnetic resonance (MR) imaging (ESREMRI) apparatus able to generate a primary magnetic field during periods of nuclear spin transition excitation and magnetic resonance signal detection. This allows the generation of ESREMRI images of a subject. A primary magnetic field of a second and higher value generated during periods of nuclear spin transition excitation and magnetic resonance signal detection can be used to generate conventional MR images of a subject. The ESREMRI and native MR images so generated may be combined, (or superimposed). (author)

  8. Improvements in radiological apparatus

    International Nuclear Information System (INIS)

    Grady, J.K.

    1985-01-01

    Improvements in radiological apparatus are described which allow better unilateral access to the patient. A base mounts ring supports for rotation about an axis and a table for supporting a subject is fitted to the ring support. An X-ray tube and receptor are held on opposite ends of a two-limbed carriage and radiation axis. The carriage is mounted on a sliding arm carried on the ring support and extending parallel to the rotational axis of the support. The carriage also pivots on the arm about an axis perpendicular to the rotational axis and to the radiation axis. (author)

  9. Tomographic scanning apparatus

    International Nuclear Information System (INIS)

    Abele, M.

    1983-01-01

    A computerized tomographic scanning apparatus suitable for diagnosis and for improving target identification in stereotactic neurosurgery is described. It consists of a base, a source of penetrating energy, a detector which produces scanning signals and detector positioning means. A frame with top and bottom arms secures the detector and source to the top and bottom arms respectively. A drive mechanism rotates the frame about an axis along which the frame may also be moved. Finally, the detector may be moved relative to the bottom arm in a direction contrary to the rotation of the frame. (U.K.)

  10. Control rod testing apparatus

    International Nuclear Information System (INIS)

    Gaunt, R.R.; Ashman, C.M.

    1987-01-01

    A control rod testing apparatus is described comprising: a first guide means having a vertical cylindrical opening for grossly guiding a control rod; a second guide means having a vertical cylindrical opening for grossly guiding a control rod. The first and second guide means are supported at axially spaced locations with the openings coaxial; and a substantially cylindrical subassembly having a vertical cylindrical opening therethrough. The subassembly is trapped coaxial with and between the first and second guide means, and the subassembly radially floats with respect to the first and second guide means

  11. Apparatus for chemical synthesis

    Science.gov (United States)

    Kong, Peter C [Idaho Falls, ID; Herring, J Stephen [Idaho Falls, ID; Grandy, Jon D [Idaho Falls, ID

    2011-05-10

    A method and apparatus for forming a chemical hydride is described and which includes a pseudo-plasma-electrolysis reactor which is operable to receive a solution capable of forming a chemical hydride and which further includes a cathode and a movable anode, and wherein the anode is moved into and out of fluidic, ohmic electrical contact with the solution capable of forming a chemical hydride and which further, when energized produces an oxygen plasma which facilitates the formation of a chemical hydride in the solution.

  12. The ATHENA Antihydrogen Apparatus

    CERN Document Server

    Amoretti, M; Bonomi, G; Bouchta, A; Bowe, P; Carraro, C; Charlton, M; Collier, M; Doser, Michael; Filippini, V; Fine, K S; Fontana, A; Fujiwara, M C; Funakoshi, R; Genova, P; Glauser, A; Grögler, D; Hangst, Jeffrey S; Hayano, R S; Higaki, H; Holzscheiter, Michael H; Joffrain, W; Jørgensen, L V; Lagomarsino, V; Landua, Rolf; Cesar, C L; Lindelöf, D; Lodi-Rizzini, E; Macri, M; Madsen, N; Manuzio, D; Manuzio, G; Marchesotti, M; Montagna, P; Pruys, H S; Regenfus, C; Riedler, P; Rochet, J; Rotondi, A; Rouleau, G; Testera, G; Van der Werf, D P; Variola, A; Watson, T L; Yamazaki, T; Yamazaki, Y

    2004-01-01

    The ATHENA apparatus that recently produced and detected the first cold antihydrogen atoms is described. Its main features, which are described herein, are: an external positron accumulator, making it possible to accumulate large numbers of positrons; a separate antiproton catching trap, optimizing the catching, colling and handling of antiprotons: a unique high resolution antihydrogen annihilation detector, allowing a clear determination that antihydrogen has been produced; an open, modular design making variations in the experimental approach possible and a "nested" Penning trap situated in a cryogenic, 3T magnetic field environment used for the mixing of the antiprotons and positrons.

  13. Isotope diagnostics apparatus

    International Nuclear Information System (INIS)

    Herrschaft, H.

    1976-01-01

    The invention relates to a measuring probe for an isotope diagnostics apparatus to determine the distribution of radioactive substances in a body by measuring the radiation emanating from this body by means of a multiplicity of measuring probes directed simultaneously towards areas of measuring surfae and carried in guidances of a holding block. The measuring results of the individual probes are recorded separately, thus allowing the possibility of being evaluated separately, too. Measuring probes of this kind are used in multi-channel measuring objects and are useful particularly for determining the regional cerebral blood flow. (orig./ORU) [de

  14. X-ray apparatus

    International Nuclear Information System (INIS)

    Grady, J.K.

    1985-01-01

    X-ray apparatus is described which has a shutter between the X-ray source and the patient. The shutter controls the level of radiation to which the patient is exposed instead of merely discontinuing the electric power supplied to the source. When the shutter is opened a radiation sensor senses the level of X-radiation. When a preset quantity of X-radiation has been measured an exposure control closes the shutter. Instead of using the radiation sensor, the integrated power supplied to the anode of the X-ray source may be measured. (author)

  15. Remote docking apparatus

    International Nuclear Information System (INIS)

    Dent, T.H.; Sumpman, W.C.; Wilhelm, J.J.

    1981-01-01

    The remote docking apparatus comprises a support plate with locking devices mounted thereon. The locking devices are capable of being inserted into tubular members for suspending the support plate therefrom. A vertical member is attached to the support plate with an attachment mechanism attached to the vertical member. A remote access manipulator is capable of being attached to the attachment mechanism so that the vertical member can position the remote access manipulator so that the remote access manipulator can be initially attached to the tubular members in a well defined manner

  16. Borehole sealing method and apparatus

    International Nuclear Information System (INIS)

    Hartley, J.N.; Jansen, G. Jr.

    1977-01-01

    A method and apparatus is described for sealing boreholes in the earth. The borehole is blocked at the sealing level, and a sealing apparatus capable of melting rock and earth is positioned in the borehole just above seal level. The apparatus is heated to rock-melting temperature and powdered rock or other sealing material is transported down the borehole to the apparatus where it is melted, pooling on the mechanical block and allowed to cool and solidify, sealing the hole. Any length of the borehole can be sealed by slowly raising the apparatus in the borehole while continuously supplying powdered rock to the apparatus to be melted and added to the top of the column of molten and cooling rock, forming a continuous borehole seal. The sealing apparatus consists of a heater capable of melting rock, including means for supplying power to the heater, means for transporting powdered rock down the borehole to the heater, means for cooling the apparatus and means for positioning the apparatus in the borehole. 5 claims, 1 figure

  17. Apparatus for gamma ray radiography

    International Nuclear Information System (INIS)

    Kobayashi, Masatoshi; Enomoto, Shigemasa; Oga, Hiroshi

    1979-01-01

    This is the standard of Japan Non-Destructive Inspection Society, NDIS 1101-79, which stipulates on the design, construction and testing method of the apparatuses for gamma ray radiography used for taking industrial radiograms. The gamma ray apparatuses stipulated in this standard are those containing sealed radioactive isotopes exceeding 100 μCi, which emit gamma ray. The gamma ray apparatuses are classified into three groups according to their movability. The general design conditions, the irradiation dose rate and the sealed radiation sources for the gamma ray apparatuses are stipulated. The construction of the gamma ray apparatuses must be in accordance with the notification No. 52 of the Ministry of Labor, and safety devices and collimators must be equipped. The main bodies of the gamma ray apparatuses must pass the vibration test, penetration test, impact test and shielding efficiency test. The method of each test is described. The attached equipments must be also tested. The tests according to this standard are carried out by the makers of the apparatuses. The test records must be made when the apparatuses have passed the tests, and the test certificates are attached. The limit of guarantee by the endurance test must be clearly shown. The items to be shown on the apparatuses are stipulated. (Kako, I.)

  18. An extraordinary tabletop speed of light apparatus

    Science.gov (United States)

    Pegna, Guido

    2017-09-01

    A compact, low-cost, pre-aligned apparatus of the modulation type is described. The apparatus allows accurate determination of the speed of light in free propagation with an accuracy on the order of one part in 104. Due to the 433.92 MHz radio frequency (rf) modulation of its laser diode, determination of the speed of light is possible within a sub-meter measuring base and in small volumes (some cm3) of transparent solids or liquids. No oscilloscope is necessary, while the required function generators, power supplies, and optical components are incorporated into the design of the apparatus and its receiver can slide along the optical bench while maintaining alignment with the laser beam. Measurement of the velocity factor of coaxial cables is also easily performed. The apparatus detects the phase difference between the rf modulation of the laser diode by further modulating the rf signal with an audio frequency signal; the phase difference between these signals is then observed as the loudness of the audio signal. In this way, the positions at which the minima of the audio signal are found determine where the rf signals are completely out of phase. This phase detection method yields a much increased sensitivity with respect to the display of coincidence of two signals of questionable arrival time and somewhat distorted shape on an oscilloscope. The displaying technique is also particularly suitable for large audiences as well as in unattended exhibits in museums and science centers. In addition, the apparatus can be set up in less than one minute.

  19. Isotope separation apparatus

    International Nuclear Information System (INIS)

    Lyon, R.K.; Eisner, P.N.; Thomas, W.R.I.

    1983-01-01

    This application discloses a method for and an apparatus in which isotopes of an element in a compared are separated from each other while that compound, i.e., including a mixture of such isotopes, flows along a predetermined path. The apparatus includes a flow tube having a beginning and an end. The mixture of isotopes is introduced into the flow tube at a first introduction point between the beginning and the end thereof to flow the mixture toward the end thereof. A laser irradiates the flow tube dissociating compounds of a preselected one of said isotopes thereby converting the mixture in an isotopically selective manner. The dissociation products are removed from the tube at a first removal point between the first introduction point and the end. The dissociation product removed at the the first removal point are reconverted back into the comound thereby providing a first stage enriched compound. This first stage enriched compound is reintroduced into the flow tube at a second introduction point between the beginning thereof and the first introduction point. Further product is removed from the flow tube at a second removal point between the second introduction point and the first introduction point. The second introduction point is chosen so that the isotope composition of the first stage enriched compound is approximately the same as that of the compound in the flow tube

  20. Apparatus for fuel replacement

    International Nuclear Information System (INIS)

    Imada, Takahiko.

    1974-01-01

    Object: To support a telescope mast such that no deforming load is applied to it even during massive vibration, it is held fixed at the time of fuel replacement to permit satisfactory remote control operation by automatic operation. Structure: The body of the fuel replacement apparatus is provided with telescope mast fixing means comprising a slide base supported for reciprocal movement with respect to a telescope mast, an operating arm pivoted at the slide base, a wrist member mounted on the free end of the operating arm and an engagement member for restricting the slide base and operating arm at the time of loading and unloading the fuel. When loading and unloading the fuel, the slide base and operating arm are restrained by the engagement member to reliably restrict the vibration of the telescope mast. When the fuel replacement apparatus is moved, the means provided on the operating arm is smoothly displaced to follow the swing (vibration) of the telescope mast to prevent the deforming load from being applied to the support portion or other areas. The wrist member supports the telescope mast such that it can be rotated while restraining movement in the axial direction, and it is provided with revolution drive means for rotating the telescope mast under remote control. (Kamimura, M.)

  1. Radiographic scanner apparatus

    International Nuclear Information System (INIS)

    Wake, R.H.

    1980-01-01

    The preferred embodiment of this invention includes a hardware system, or processing means, which operates faster than software. Moreover the computer needed is less expensive and smaller. Radiographic scanner apparatus is described for measuring the intensity of radiation after passage through a planar region and for reconstructing a representation of the attenuation of radiation by the medium. There is a source which can be rotated, and detectors, the output from which forms a data line. The detectors are disposed opposite the planar region from the source to produce a succession of data lines corresponding to the succession of angular orientations of the source. There is a convolver means for convolving each of these data lines, with a filter function, and a means of processing the convolved data lines to create the representation of the radiation attenuation in the planar region. There is also apparatus to generate a succession of data lines indicating radiation attenuation along a determinable path with convolver means. (U.K.)

  2. Apparatus for gamma radiography

    International Nuclear Information System (INIS)

    1983-06-01

    The aim of the present standard is to fix the rules for the construction of gamma radiography instrumentation without prejudice to the present regulations. These apparatus have to be fitted with only sealed sources conformable to the experimental standard M 61-002. The present standard agrees with the international standard ISO 3999 of 1977 dealing with the same subject. Nevertheless, it is different on the three main following points: it does not accept the same limits of absorbed dose rates in the air calculated on the external surface of projectors; it precribes tightness, bending, crushing and tensile tests for some components of the gamma radiography it prescribes tests of endurance and resistance to breaking for the locking systems of the gamma radiography apparatus. The present standard also specifies the following points: symbols and indications to put on projectors and on the source-holder; identification of the source contained in the projector; and, accompanying documents. The regulation references are given in annexe [fr

  3. Fuel exchanging apparatus

    International Nuclear Information System (INIS)

    Imada, Takahiko; Sato, Hideo.

    1975-01-01

    Object: To provide a centripetal device, which has an initial spring force greater than a frictional force in an oscillating direction of a telescope mast, on a mast fixing device mounted on a body of fuel exchanging apparatus so that the telescope mast may be secured quickly returning to a predetermined initial position. Structure: When the body of fuel exchanging apparatus is stopped at a predetermined position, a tension spring, which has an initial spring force greater than a frictional force in an oscillating direction of the telescope mast, causes a lug to be forced by means of a push rod to position a sliding base plate to its original position. At the same time, a device of similar structure causes an operating arm to be positioned to the original position, and a lock pin urged by a cylinder is inserted into a through hole in the sliding base plate and operating arm so that the telescope mast may be fixed and retained. (Hanada, M.)

  4. No evidence of differential effects of SFA, MUFA or PUFA on post-ingestive satiety and energy intake: a randomised trial of fatty acid saturation

    LENUS (Irish Health Repository)

    Strik, Caroline M

    2010-05-24

    Abstract Background High fat diets have long been associated with weight gain and obesity, and the weak satiety response elicited in response to dietary lipids is likely to play a role. Suppression of appetite and food intake has consistently been shown to be diminished with high fat relative to either high protein or carbohydrate meals. There is however some evidence that the satiating capacity of lipids may be modulated when physicochemical properties are altered, but studies investigating the effect of lipid saturation on appetite have generated inconsistent findings. This study investigated the effects of changes in fatty acid saturation on post-ingestive satiety and energy intake. Methods High-fat (HF) test breakfasts (2.0 MJ) containing 26 g lipid were given to 18 healthy, lean men in a 3 treatment randomised cross-over design, each treatment separated by a washout of at least 3 days. The breakfasts were high in saturated (SFA, 65% of total fat), polyunsaturated (PUFA, 76%) or monounsaturated (MUFA, 76%) fatty acids, and comprised 2 savoury muffins. Participants rated appetite sensations using visual analogue scales (VAS) to assess palatability immediately following the meals, and hunger and fullness prior to the HF breakfast and throughout the day. Energy intake was measured by covert weighing of a lunch meal which was served 3.5 h after the breakfast, and from which the participants ate ad libitum. Results There was no difference in VAS ratings of pleasantness, visual appearance, smell, taste, aftertaste and overall palatability between the 3 high-fat test breakfasts. However, there was also no differential effect of the 3 treatments on ratings of hunger, fullness, satisfaction or prospective food consumption during the 3.5 h following the breakfast meal and over the full 6 h experiment. Energy and macronutrient intake at lunch also did not differ between treatments (mean, sem; SFA: 5275.9 ± 286.5 kJ; PUFA: 5227.7 ± 403.9 kJ; MUFA: 5215.6 ± 329.5 kJ; P

  5. Microelectromechanical acceleration-sensing apparatus

    Science.gov (United States)

    Lee, Robb M [Albuquerque, NM; Shul, Randy J [Albuquerque, NM; Polosky, Marc A [Albuquerque, NM; Hoke, Darren A [Albuquerque, NM; Vernon, George E [Rio Rancho, NM

    2006-12-12

    An acceleration-sensing apparatus is disclosed which includes a moveable shuttle (i.e. a suspended mass) and a latch for capturing and holding the shuttle when an acceleration event is sensed above a predetermined threshold level. The acceleration-sensing apparatus provides a switch closure upon sensing the acceleration event and remains latched in place thereafter. Examples of the acceleration-sensing apparatus are provided which are responsive to an acceleration component in a single direction (i.e. a single-sided device) or to two oppositely-directed acceleration components (i.e. a dual-sided device). A two-stage acceleration-sensing apparatus is also disclosed which can sense two acceleration events separated in time. The acceleration-sensing apparatus of the present invention has applications, for example, in an automotive airbag deployment system.

  6. Nuclear reactor control apparatus

    International Nuclear Information System (INIS)

    Sridhar, B.N.

    1983-01-01

    Nuclear reactor safety rod release apparatus comprises a ring which carries detents normally positioned in an annular recess in outer side of the rod, the ring being held against the lower end of a drive shaft by magnetic force exerted by a solenoid carried by the drive shaft. When the solenoid is de-energized, the detent-carrying ring drops until the detents contact a cam surface associated with the lower end of the drive shaft, at which point the detents are cammed out of the recess in the safety rod to release the rod from the drive shaft. In preferred embodiments of the invention, an additional latch is provided to release a lower portion of a safety rod under conditions that may interfere with movement of the entire rod

  7. Multichannel Thomson scattering apparatus

    International Nuclear Information System (INIS)

    Bretz, N.; Dimock, D.; Foote, V.; Johnson, D.; Long, D.; Tolnas, E.

    1977-07-01

    A Thomson scattering apparatus for measuring the electron temperature and density along a 90 cm diameter of the PLT plasma has been built. A wide angle objective images the 3 mm x 900 mm ruby laser beam onto an image dissector which rearranges the 300 : 1 image to 20 : 1 forming the input slit of a spectrometer. The stigmatic spectrometer provides 20 wavelength elements of approximately 70 A each. A micro-channel-plate image intensifier optically coupled to a cooled SIT tube provides detection with single frame linearity and 1000 : 1 dynamic range. Spatial profiles of N/sub e/ and T/sub e/ in the range 10 13 - 10 14 cm -3 and 0.05 - 3 keV have an accuracy of 30 √10 13 /N/sub e/ (cm -3 ) percent per 1.2 cm element

  8. Apparatus for stereotactic surgery

    International Nuclear Information System (INIS)

    Koslow, M.A.M.

    1982-01-01

    Apparatus for stereotactic surgery consisting of a probe and a computerized tomographic scanning system is described. The scanning system comprises a display and means for reconstructing cross-sectional images on the display using data from partial circumferential scans of source and detectors. It operates on the data with an algorithm that provides the difference between the local values of the linear attenuation coefficient and average of these values within a circle centered at each reconstruction point. The scanning system includes a means of maintaining the frames of reference of the probe and scanning system rigid with respect to one another. The position of the probe, which may be a cryogenic probe, with respect to the actual anatomical structure of the body, particularly a human head, may thus be viewed by the surgeon. (author)

  9. Radiation imaging apparatus

    International Nuclear Information System (INIS)

    Cooperstein, G.; Lanza, R.C.; Sohval, A.R.

    1980-01-01

    Radiation imaging apparatus especially suited for use in a computerized tomographic (CT) scanner is specified. It employs a fixed array of discrete X-ray sources, each being a cold cathode diode having an impedance in excess of about 100 ohms and an adjacent fixed array of closely packed radiation detectors to produce images of rapidly moving body organs such as the beating heart. The X-ray source is pulsed by a 120 to 130 kv pulse of 150 to 160 ns duration, derived from an unregulated DC source, of output voltage 15 to 30 kv. Each X-ray source may comprise a cold cathode pulse or may be constituted by a pair of annular cathodes having radially extending anodes therebetween. (author)

  10. Radiation measuring apparatus

    International Nuclear Information System (INIS)

    Schmid, C.J.

    1983-01-01

    A colorimeter in which a light source, a collimating lens and a band pass filter are supported by a housing that is movable with respect to a stationary beam dividing assembly in a direction at least substantially transverse to the optical axis of the light from the source. The assembly separates the incoming collimated and filtered light into a sample beam and a reference beam which are directed back toward the housing in directions parallel to the optical axis. The movement of the housing toward or away from the sample produces an increase or decrease in the intensity of the light illuminating the sample and a corresponding decrease or increase in the intensity of the light at the reference detector. The arrangement is such that the apparatus may be readily adjusted to obtain accurate colorimeter readings even for samples having abnormally high or low density characteristics

  11. Apparatus for extracting petroleum

    Energy Technology Data Exchange (ETDEWEB)

    Coogan, J

    1921-01-18

    An apparatus for extracting petroleum from petroleum bearing sand or shale is described comprising a container for liquids, the container being divided into a plurality of compartments, an agitator mounted within the container and below the liquid level and having its forward end opening into one of the compartments, means for delivering sand or shale to the forward end of the agitator, means for subjecting the sand or shale to the action of a solvent for the petroleum while the sand or shale is being agitated and is submerged, the first-mentioned compartment being adapted to receive the extracted petroleum and means for removing the treated sand or shale from adjacent the rear end of the agitator.

  12. Radiation shielding apparatus

    International Nuclear Information System (INIS)

    McCullagh, R.J.

    1977-01-01

    The disclosure pertains to a clamping apparatus having a stud capturing portion and a stud facing portion bolted together so as to compressively support a radiation-proof sheet material, such as lead sheeting, there-in-between. The interior wall covering material, such as panelling or wall board, is secured to the external surface of the stud facing portion. No nails are required to support the radiation-proof sheeting material, thereby minimizing accidental leakage due to harmful radiation passing through openings inadvertently disposed in the radiation-proof sheeting in the conventional nail securing supporting thereof. A pair of radiation-proof tracks capture the free ends of the stud capturing portion and the stud facing portion

  13. Radioactive waste treatment apparatus

    International Nuclear Information System (INIS)

    Abrams, R.F.; Chellis, J.G.

    1983-01-01

    Radioactive waste treatment apparatus is disclosed in which the waste is burned in a controlled combustion process, the ash residue from the combustion process is removed and buried, the gaseous effluent is treated in a scrubbing solution the pH of which is maintained constant by adding an alkaline compound to the solution while concurrently extracting a portion of the scrubbing solution, called the blowdown stream. The blowdown stream is fed to the incinerator where it is evaporated and the combustibles in the blowdown stream burned and the gaseous residue sent to the scrubbing solution. Gases left after the scrubbing process are treated to remove iodides and are filtered and passed into the atmosphere

  14. Capacitive gauging apparatus

    International Nuclear Information System (INIS)

    Walton, H.

    1985-01-01

    Apparatus for gauging physical dimensions of solid or tubular bodies (e.g. a nuclear fuel pellet) comprises a capacitive transducer having electrodes forming diametrically arranged pairs of capacitors and means for connecting the pairs, preferably sequentially, in an arm of a four arm electrical network. For circumferential scanning of a solid body along its length, the body is moved along a path of travel through head assembly including the transducer by means of plungers with the axis of the body being coincident with the axis of the transducer. As the body moves through the transducer the diametrically arranged pairs of capacitors scan the surface to result in a surface profile of the body. For scanning the bore of a pipe or tube the transducer is inserted as a probe and moved along the bore of the pipe or tube, means being provided for maintaining the probe coaxial with the pipe or tube. (author)

  15. Nuclear fusion apparatus

    International Nuclear Information System (INIS)

    Takizawa, Teruhiro.

    1975-01-01

    Object: To provide a nuclear fusion apparatus which can make a disorderly magnetic field due to shell current as small as possible, thereby enhancing efficiency. Structure: On each divided end of each shell is integrally projected an auxiliary shell which has thick greater than the other portion of shell. These auxiliary shells are made of a material of high electric conductivity, and the shape of the auxiliary shells may properly be selected so that electric resistance of the auxiliary shell at the divided end of the shell to the shell current may be made smaller than the electric resistance of intermediate of the shell to the shell current. With this, the shell current is concentrated on the auxiliary shell at the divided end of the shell to form an adjacent reciprocating current between it and the shell current opposite the auxiliary shell, thus reducing the disorderly magnetic field. (Yoshihara, H.)

  16. Reactor head shielding apparatus

    International Nuclear Information System (INIS)

    Schukei, G.E.; Roebelen, G.J.

    1992-01-01

    This patent describes a nuclear reactor head shielding apparatus for mounting on spaced reactor head lifting members radially inwardly of the head bolts. It comprises a frame of sections for mounting on the lifting members and extending around the top central area of the head, mounting means for so mounting the frame sections, including downwardly projecting members on the frame sections and complementary upwardly open recessed members for fastening to the lifting members for receiving the downwardly projecting members when the frame sections are lowered thereto with lead shielding supported thereby on means for hanging lead shielding on the frame to minimize radiation exposure or personnel working with the head bolts or in the vicinity thereof

  17. Foil changing apparatus

    International Nuclear Information System (INIS)

    Crist, C.E.; Ives, H.C.; Leifeste, G.T.; Miller, R.B.

    1988-01-01

    A self-contained foil changer apparatus for replenishing foil material across the path of a high energy particle beam is described comprising: a cylindrical hermetically sealed housing comprising an end plate having an aperture defining a beam passageway therethrough; foil supply means disposed inside the housing for storing a foil web and supporting a portion of the web across the beam passageway to form a plane perpendicular to the beam path; a barrel assembly disposed inside the housing; web control means extending through the housing and operably connected to the foil supply means for selectively advancing the foil web to replenish a portion across the beam passageway; and barrel control means extending through the housing and operably connected to the barrel assembly for selectively moving the barrel to and from the advanced and retracted positions

  18. Spine immobilization apparatus

    Science.gov (United States)

    Lambson, K. H.; Vykukal, H. C. (Inventor)

    1981-01-01

    The apparatus makes use of a normally flat, flexible bladder filled with beads or micro-balloons that form a rigid mass when the pressure within the bladder is decreased below ambient through the use of a suction pump so that the bladder can be conformed to the torso of the victim and provide the desired restraint. The bladder is strapped to the victim prior to being rigidified by an arrangement of straps which avoid the stomach area. The bladder is adapted to be secured to a rigid support, i.e., a rescue chair, so as to enable removal of a victim after the bladder has been made rigid. A double sealing connector is used to connect the bladder to the suction pump and a control valve is employed to vary the pressure within the bladder so as to soften and harden the bladder as desired.

  19. Apparatus for proton radiography

    International Nuclear Information System (INIS)

    Martin, R.L.

    1976-01-01

    An apparatus for effecting diagnostic proton radiography of patients in hospitals comprises a source of negative hydrogen ions, a synchrotron for accelerating the negative hydrogen ions to a predetermined energy, a plurality of stations for stripping extraction of a radiography beam of protons, means for sweeping the extracted beam to cover a target, and means for measuring the residual range, residual energy, or percentage transmission of protons that pass through the target. The combination of information identifying the position of the beam with information about particles traversing the subject and the back absorber is performed with the aid of a computer to provide a proton radiograph of the subject. In an alternate embodiment of the invention, a back absorber comprises a plurality of scintillators which are coupled to detectors. 10 claims, 7 drawing figures

  20. Radioactive gas solidification apparatus

    International Nuclear Information System (INIS)

    Kobayashi, Yoshihiro; Seki, Eiji; Yabu, Tomohiko; Matsunaga, Hiroyuki.

    1990-01-01

    Handling of a solidification container from the completion for the solidifying processing to the storage of radioactive gases by a remote control equipment such as a manipulator requires a great cost and is difficult to realize. In a radioactive gas solidification device for injection and solidification in accumulated layers of sputtered metals by glow discharge, radiation shieldings are disposed surrounding the entire container, and cooling water is supplied to a cooling vessel formed between the container and the shielding materials. The shielding materials are divided into upper and lower shielding materials, so that solidification container can be taken out from the shielding materials. As a result, the solidification container after the solidification of radioactive gases can be handled with ease. Further, after-heat can be removed effectively from the ion injection electrode upon solidifying treatment upon storage, to attain a radioactive gas solidifying processing apparatus which is safe, economical and highly reliable. (N.H.)

  1. Induction melter apparatus

    Science.gov (United States)

    Roach, Jay A [Idaho Falls, ID; Richardson, John G [Idaho Falls, ID; Raivo, Brian D [Idaho Falls, ID; Soelberg, Nicholas R [Idaho Falls, ID

    2008-06-17

    Apparatus and methods of operation are provided for a cold-crucible-induction melter for vitrifying waste wherein a single induction power supply may be used to effect a selected thermal distribution by independently energizing at least two inductors. Also, a bottom drain assembly may be heated by an inductor and may include an electrically resistive heater. The bottom drain assembly may be cooled to solidify molten material passing therethrough to prevent discharge of molten material therefrom. Configurations are provided wherein the induction flux skin depth substantially corresponds with the central longitudinal axis of the crucible. Further, the drain tube may be positioned within the induction flux skin depth in relation to material within the crucible or may be substantially aligned with a direction of flow of molten material within the crucible. An improved head design including four shells forming thermal radiation shields and at least two gas-cooled plenums is also disclosed.

  2. Submersible energy storage apparatus

    International Nuclear Information System (INIS)

    Mccartney, J.F.; Rowe, R.A.

    1980-01-01

    A submersible energy storage apparatus for an electrical power source is provided which includes an electrolysis unit feed water gas collection assembly and a fuel cell. The electrolysis unit feed water gas collection assembly includes a hydrogen container and an oxygen container wherein each container has a gas outlet and is capable of containing feed water as well as hydrogen and oxygen gases respectively. An electrolysis cell is provided which has a hydrogen outlet, an oxygen outlet and a feed water inlet. The hydrogen outlet is located in the hydrogen container, the oxygen outlet is located in the oxygen container, and the feed water inlet is located in one of the containers. Each of the containers has an opening to the submersible environment so as to be pressure responsive thereto. A barrier device is provided in association with the opening in each container for isolating the feed water in the container from water in the submersible environment. The fuel cell is operatively connected to the hydrogen and oxygen containers, and the electrical power source is operatively connected to the electrolysis cell. With this arrangement the electrolysis cell is capable of utilizing power from the power source during low electrical energy demand, and the fuel cell is capable of utilizing the hydrogen and oxygen gases for generating electricity during high demand periods

  3. Belt conveyor apparatus

    Science.gov (United States)

    Oakley, David J.; Bogart, Rex L.

    1987-01-01

    A belt conveyor apparatus according to this invention defines a conveyance path including a first pulley and at least a second pulley. An endless belt member is adapted for continuous travel about the pulleys and comprises a lower portion which engages the pulleys and an integral upper portion adapted to receive objects therein at a first location on said conveyance path and transport the objects to a second location for discharge. The upper belt portion includes an opposed pair of longitudinally disposed crest-like members, biased towards each other in a substantially abutting relationship. The crest-like members define therebetween a continuous, normally biased closed, channel along the upper belt portion. Means are disposed at the first and second locations and operatively associated with the belt member for urging the normally biased together crest-like members apart in order to provide access to the continuous channel whereby objects can be received into, or discharged from the channel. Motors are in communication with the conveyance path for effecting the travel of the endless belt member about the conveyance path. The conveyance path can be configured to include travel through two or more elevations and one or more directional changes in order to convey objects above, below and/or around existing structures.

  4. Nuclear fusion apparatus

    International Nuclear Information System (INIS)

    Nagata, Daizaburo; Yamada, Masao.

    1974-01-01

    Object: To provide a nuclear fusion apparatus in which a magnetic limiter is disposed within a vacuum vessel, said magnetic limiter being supported in such a manner so as to not to exert mechanical action upon said vacuum vessel, thereby minimizing a force applied to the vacuum vessel to easily manufacture the vacuum vessel. Structure: The magnetic limiter disposed within the vacuum vessel is connected to one end of a supporting post which extends through the wall of the vacuum vessel through a seal portion, the other end of the supporting post being secured to a structure such as a house outside the vacuum vessel. The seal portion comprises a bellows of high spring elasticity mounted on the vacuum vessel and a seal element comprised of an electric insulator such as ceramic for connecting the bellows to the supporting post, the supporting post extending through the wall of the vacuum vessel in vacuum-tight fashion, the force applied to the magnetic limiter exerting no influence upon the vacuum vessel. (Kamimura, M.)

  5. Computed tomography apparatus

    International Nuclear Information System (INIS)

    Fairbairn, I.A.

    1984-01-01

    In fan-beam computed tomography apparatus, timing reference pulses, normally occurring at intervals t, for data transfer and reset of approx. 500 integrators in the signal path from the detector array, are generated from the scan displacement, e.g. using a graticule and optical sensor to relate the measurement paths geometrically to the body section. Sometimes, a slow scan rate is required to provide a time-averaged density image, e.g. for planning irradiation therapy, and then the sensed impulses will occur at extended intervals and can cause integrator overload. An improvement is described which provides a pulse generator which responds to a reduced scan rate by generating a succession of further transfer and reset pulses at intervals approximately equal to t starting a time t after each timing reference pulse. Then, using an adding device and RAM, all the transferred signals integrated in the interval t' between two successive slow scan reference pulses are accumulated in order to form a corresponding measurement signal. (author)

  6. Apparatus for diffusion separation

    International Nuclear Information System (INIS)

    Nierenberg, W.A.

    1976-01-01

    A diffuser separator apparatus is described which comprises a plurality of flow channels in a single stage. Each of said channels has an inlet port and an outlet port and a constant cross sectional area between said ports. At least a portion of the defining surface of each of said channels is a diffusion separation membrane, and each of said channels is a different cross sectional area. Means are provided for connecting said channels in series so that each successive channel of said series has a smaller cross sectional area than the previous channel of said series. Also provided are a source of gaseous mixture, individual means for flowing said gaseous mixture to the inlet port of each of said channels, gas receiving and analyzing means, individual means for flowing gas passing from each of said outlet ports and means for flowing gas passing through said membranes to said receiving and analyzing means, and individual means for connecting the outlet port of each channel with the inlet port of the channel having the next smaller cross sectional area

  7. Plastic waste disposal apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Kito, S

    1972-05-01

    A test plant plastic incinerator was constructed by the Takuma Boiler Manufacturing Co. for Sekisui Chemical Industries, and the use of a continuous feed spreader was found to be most effective for prevention of black smoke, and the use of a venturi scrubber proved to be effective for elimination of hydrogen chloride gas. The incinerator was designed for combustion of polyvinyl chloride exclusively, but it is also applicable for combustion of other plastics. When burning polyethylene, polypropylene, or polystyrene, (those plastics which do not produce toxic gases), the incinerator requires no scrubber for the combustion gas. The system may or may not have a pretreatment apparatus. For an incinerator with a pretreatment system, the flow chart comprises a pit, a supply crane, a vibration feeder, a metal eliminator, a rotation shredder, a continuous screw feeder with a quantitative supply hopper, a pretreatment chamber (300 C dry distillation), a quantitative supply hopper, and the incinerator. The incinerator is a flat non-grid type combustion chamber with an oil burner and many air nozzles. From the incinerator, ashes are sent by an ash conveyor to an ash bunker. The combustion gas goes to the boiler, and the water supplied the boiler water pump creates steam. The heat from the gas is sent back to the pretreatment system through a heat exchanger. The gas then goes to a venturi scrubber and goes out from a stack.

  8. Radiographic examination apparatus

    International Nuclear Information System (INIS)

    Beetham, S.; Hogg, J.

    1983-01-01

    Tube examination apparatus has a head actuated by fluid pressure, for centralising a radioactive source. Preferably the source is shielded during transport from its storage unit to the head. A body attached to a drive-wire has hollow shield-parts which define a radiation window therebetween, and closure shield-parts which have the source located therebetween and which are a sliding fit. A spring biases the closure shields towards a first position relative to the body in which the source is enclosed. When the body moves along a guide in the head, the closure shield engages an abutment surface which arrests the closure shields. Further movement of the body to engage an abutment surface causes relative movement between the shield parts to a second position relative to the body in which the source is exposed at the window. Retraction of the body along the guide allows the spring to restore the closure shield parts to the first position. (U.K.)

  9. Sample-taking apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Tanov, Y I; Ismailov, R A; Orazov, A

    1980-10-07

    The invention refers to the equipment for testing water-bearing levels in loose rocks. Its purpose is to simultaneously remove with the rock sample a separate fluid sample from the assigned interval. The sample-taking apparatus contains a core lifter which can be submerged into the casting string with housing and front endpiece in the form of a rod with a piston which covers the cavity of the core lifter, as well as mechanism for fixing and moving the endpiece within the core lifter cavity. The device differs from the known similar devices because the upper part of the housing of the core lifter is equipped with a filter and mobile casting which covers the filter. In this case the casing is connected to the endpiece rod and the endpiece is installed with the possibility of movement which is limited with fixing in the upper position and in the extreme upper position it divides the core lifter cavity into two parts, filter settling tank and core-receiving cavity.

  10. Medical radiographic apparatus

    International Nuclear Information System (INIS)

    Fetter, R.W.

    1980-01-01

    An invention is described which relates to computer-assisted tomography. The apparatus provides for investigating a cross-section slice of a patient's body and includes a source of fan-shaped distribution of penetrating radiation and a means for locating the source, in relation to the patient's body so that the radiation is directed towards a slice of the body. The source can be rotated about the patient's body and radiation detected by a number of detectors situated in an arc around the body. The number, and thus the cost, of detectors can be reduced by putting the ring of detectors between the x-ray source and the patient's body. This presents a problem in that if the detectors are on the same side of the body as the source and if no steps are taken to the contrary, the detectors will interupt the radiation so that it does not pass through the patient's body. This invention overcomes that problem. (OT)

  11. Controlled nuclear fusion apparatus

    International Nuclear Information System (INIS)

    Bussard, R.W.; Coppi, B.

    1982-01-01

    A fusion power generating device is disclosed having a relatively small and inexpensive core region which may be contained within an energy absorbing blanket region. The fusion power core region contains apparatus of the toroidal type for confining a high density plasma. The fusion power core is removable from the blanket region and may be disposed and/or recycled for subsequent use within the same blanket region. Thermonuclear ignition of the plasma is obtained by feeding neutral fusible gas into the plasma in a controlled manner such that charged particle heating produced by the fusion reaction is utilized to bootstrap the device to a region of high temperatures and high densities wherein charged particle heating is sufficient to overcome radiation and thermal conductivity losses. The high density plasma produces a large radiation and particle flux on the first wall of the plasma core region thereby necessitating replacement of the core from the blanket region from time to time. A series of potentially disposable and replaceable central core regions are disclosed for a large-scale economical electrical power generating plant

  12. Radioactive waste material melter apparatus

    Science.gov (United States)

    Newman, D.F.; Ross, W.A.

    1990-04-24

    An apparatus for preparing metallic radioactive waste material for storage is disclosed. The radioactive waste material is placed in a radiation shielded enclosure. The waste material is then melted with a plasma torch and cast into a plurality of successive horizontal layers in a mold to form a radioactive ingot in the shape of a spent nuclear fuel rod storage canister. The apparatus comprises a radiation shielded enclosure having an opening adapted for receiving a conventional transfer cask within which radioactive waste material is transferred to the apparatus. A plasma torch is mounted within the enclosure. A mold is also received within the enclosure for receiving the melted waste material and cooling it to form an ingot. The enclosure is preferably constructed in at least two parts to enable easy transport of the apparatus from one nuclear site to another. 8 figs.

  13. Radiographic film cassette unloading apparatus

    International Nuclear Information System (INIS)

    Stievenart, E.F.; Plessers, H.S.; Neujens, G.J.

    1980-01-01

    Apparatus for unloading cassettes, containing exposed radiographic films, has means for unfastening the cassettes, an inclined pathway for gravity feeding and rotating feed members (rollers or belts) to propel the films into the processor. (UK)

  14. INFLATE: INFlate Landing Apparatus Technology

    Science.gov (United States)

    Koryanov, V. V. K.; Da-Poian, V. D. P.

    2018-02-01

    Our project, named INFLATE (INFlatable Landing Apparatus Technology), aims at reducing space landing risks and constraints and so optimizing space missions (reducing cost, mass, and risk and in the same time improving performance).

  15. Tandem mirror plasma confinement apparatus

    International Nuclear Information System (INIS)

    Fowler, T.K.

    1978-01-01

    Apparatus and method are described for confining a plasma in a center mirror cell by use of two end mirror cells as positively charged end stoppers to minimize leakage of positive particles from the ends of the center mirror cell

  16. Tandem mirror plasma confinement apparatus

    Science.gov (United States)

    Fowler, T. Kenneth

    1978-11-14

    Apparatus and method for confining a plasma in a center mirror cell by use of two end mirror cells as positively charged end stoppers to minimize leakage of positive particles from the ends of the center mirror cell.

  17. Radioactive waste material melter apparatus

    International Nuclear Information System (INIS)

    Newman, D.F.; Ross, W.A.

    1990-01-01

    An apparatus for preparing metallic radioactive waste material for storage is disclosed. The radioactive waste material is placed in a radiation shielded enclosure. The waste material is then melted with a plasma torch and cast into a plurality of successive horizontal layers in a mold to form a radioactive ingot in the shape of a spent nuclear fuel rod storage canister. The apparatus comprises a radiation shielded enclosure having an opening adapted for receiving a conventional transfer cask within which radioactive waste material is transferred to the apparatus. A plasma torch is mounted within the enclosure. A mold is also received within the enclosure for receiving the melted waste material and cooling it to form an ingot. The enclosure is preferably constructed in at least two parts to enable easy transport of the apparatus from one nuclear site to another. 8 figs

  18. Apparatus for washing out halogens

    Energy Technology Data Exchange (ETDEWEB)

    Pier, M; Hahn, J; Kroenig, W

    1941-03-26

    An apparatus is described for washing out of halogens and the like or liquid halogen compounds from the products, which are formed on pressure hydrogenation or splitting of carbon-containing material in the presence of halogens or halogen compounds, consisting of a washing apparatus installed between the reaction vessel and the hot separator, which is inclined in relatively small space for steam regulation and contains, with the steam, arranged baffles, especially spirals.

  19. Nuclear magnetic resonance method and apparatus

    International Nuclear Information System (INIS)

    Young, I.R.

    1983-01-01

    In a method of investigating the distribution of a quantity in a chosen region of a body (E) by nuclear magnetic resonance techniques movement of the body during the investigation is monitored by probes (A, B C) (C extends orthogonally to A and B) attached to the body and responsive to magnetic fields applied to the body during the investigation. An apparatus for carrying out the method is also described. If movement is detected, due compensation may be made during processing of the collected data, or the latter may be re-ascertained after appropriate adjustment e.g. a change in the RF excitation frequency. (author)

  20. Optical fiber stripper positioning apparatus

    Science.gov (United States)

    Fyfe, Richard W.; Sanchez, Jr., Amadeo

    1990-01-01

    An optical fiber positioning apparatus for an optical fiber stripping device is disclosed which is capable of providing precise axial alignment between an optical fiber to be stripped of its outer jacket and the cutting blades of a stripping device. The apparatus includes a first bore having a width approximately equal to the diameter of an unstripped optical fiber and a counter bore axially aligned with the first bore and dimensioned to precisely receive a portion of the stripping device in axial alignment with notched cutting blades within the stripping device to thereby axially align the notched cutting blades of the stripping device with the axis of the optical fiber to permit the notched cutting blades to sever the jacket on the optical fiber without damaging the cladding on the optical fiber. In a preferred embodiment, the apparatus further includes a fiber stop which permits determination of the length of jacket to be removed from the optical fiber.

  1. The Conservation Ideological State Apparatus

    Directory of Open Access Journals (Sweden)

    Jared D Margulies

    2018-01-01

    Full Text Available This article considers Louis Althusser's theory of the ideological state apparatuses (ISAs for advancing political ecology scholarship on the functioning of the state in violent environments. I reflect on a series of events in which a state forest department in South India attempted to recast violent conflicts between themselves and local communities over access to natural resources and a protected area as a debate over human-wildlife conflicts. Through the example of conservation as ideology in Wayanad, Kerala, I show how the ISAs articulate the functioning of ideology within the state apparatuses in order for us to understand the larger mechanics of the state apparatus and the reproduction of the relations of production necessary for the reproduction of capitalism. Revisiting the ISAs as a theoretical framework for studies in political ecology and conservation is timely given the resurgence of militarised conservation tactics, the emancipatory aims of Althusser's theory, and political ecology's turn towards praxis.

  2. Apparatus for filtering radioactive fluids

    International Nuclear Information System (INIS)

    Gischel, E.H.

    1975-01-01

    Apparatus is provided for filtering radioactive particles from the cooling and/or auxiliary process water of a nuclear reactor, or nuclear fuel processing plant, or other installations wherein radioactive fluid systems are known to exist. The apparatus affords disposal of the captured particles in a manner which minimizes the exposure of operating personnel to radioactivity. The apparatus comprises a housing adapted to contain a removable filter cartridge assembly, a valve normally closing the lower end of the housing, an upwardly-open shipping cask located below the valve, and an elongated operating rod assembly projecting upwardly from the filter cartridge assembly and through the upper end of the housing to enable a workman to dismount the filter cartridge assembly from its housing and to lower the filter cartridge assembly through the valve and into the cask from a remote location above the housing. (U.S.)

  3. Apparatus for control of mercury

    Science.gov (United States)

    Downs, William; Bailey, Ralph T.

    2001-01-01

    A method and apparatus for reducing mercury in industrial gases such as the flue gas produced by the combustion of fossil fuels such as coal adds hydrogen sulfide to the flue gas in or just before a scrubber of the industrial process which contains the wet scrubber. The method and apparatus of the present invention is applicable to installations employing either wet or dry scrubber flue gas desulfurization systems. The present invention uses kraft green liquor as a source for hydrogen sulfide and/or the injection of mineral acids into the green liquor to release vaporous hydrogen sulfide in order to form mercury sulfide solids.

  4. Apparatus for blending small particles

    International Nuclear Information System (INIS)

    Bradley, R.A.; Reese, C.R.; Sease, J.D.

    1975-01-01

    An apparatus is described for blending small particles and uniformly loading the blended particles in a receptacle. Measured volumes of various particles are simultaneously fed into a funnel to accomplish radial blending and then directed onto the apex of a conical splitter which collects the blended particles in a multiplicity of equal subvolumes. Thereafter the apparatus sequentially discharges the subvolumes for loading in a receptacle. A system for blending nuclear fuel particles and loading them into fuel rod molds is described in a preferred embodiment

  5. Apparatus for controlling fluidized beds

    Science.gov (United States)

    Rehmat, A.G.; Patel, J.G.

    1987-05-12

    An apparatus and process are disclosed for control and maintenance of fluidized beds under non-steady state conditions. An ash removal conduit is provided for removing solid particulates from a fluidized bed separate from an ash discharge conduit in the lower portion of the grate supporting such a bed. The apparatus and process of this invention is particularly suitable for use in ash agglomerating fluidized beds and provides control of the fluidized bed before ash agglomeration is initiated and during upset conditions resulting in stable, sinter-free fluidized bed maintenance. 2 figs.

  6. Nuclear fuel pellet loading apparatus

    International Nuclear Information System (INIS)

    Gerkey, K.S.

    1979-01-01

    An automatic apparatus for loading a predetermined amount of nuclear fuel pellets into a nuclear fuel element to be used in a nuclear reactor is described. The apparatus consists of a vibratory bed capable of supporting corrugated trays containing rows of nuclear fuel pellets and arranged in alignment with the open ends of several nuclear fuel elements. A sweep mechanism is arranged above the trays and serves to sweep the rows of fuel pellets onto the vibratory bed and into the fuel element. A length detecting system, in conjunction with a pellet stopping mechanism, is also provided to assure that a predetermined amount of nuclear fuel pellets are loaded into each fuel element

  7. APPARATUS FOR ELECTRON BEAM HEATING CONTROL

    Science.gov (United States)

    Jones, W.H.; Reece, J.B.

    1962-09-18

    An improved electron beam welding or melting apparatus is designed which utilizes a high voltage rectifier operating below its temperature saturation region to decrease variations in electron beam current which normally result from the gas generated in such apparatus. (AEC)

  8. Waste Water Treatment Apparatus and Methods

    Science.gov (United States)

    Littman, Howard (Inventor); Plawsky, Joel L. (Inventor); Paccione, John D. (Inventor)

    2014-01-01

    An improved draft tube spout fluid bed (DTSFB) mixing, handling, conveying, and treating apparatus and systems, and methods for operating are provided. The apparatus and systems can accept particulate material and pneumatically or hydraulically conveying the material to mix and/or treat the material. In addition to conveying apparatus, a collection and separation apparatus adapted to receive the conveyed particulate material is also provided. The collection apparatus may include an impaction plate against which the conveyed material is directed to improve mixing and/or treatment. The improved apparatus are characterized by means of controlling the operation of the pneumatic or hydraulic transfer to enhance the mixing and/or reacting by controlling the flow of fluids, for example, air, into and out of the apparatus. The disclosed apparatus may be used to mix particulate material, for example, mortar; react fluids with particulate material; coat particulate material, or simply convey particulate material.

  9. Cluster Implantation and Deposition Apparatus

    DEFF Research Database (Denmark)

    Hanif, Muhammad; Popok, Vladimir

    2015-01-01

    In the current report, a design and capabilities of a cluster implantation and deposition apparatus (CIDA) involving two different cluster sources are described. The clusters produced from gas precursors (Ar, N etc.) by PuCluS-2 can be used to study cluster ion implantation in order to develop...

  10. X-ray examination apparatus

    NARCIS (Netherlands)

    2000-01-01

    The invention relates to an X-ray apparatus which includes an adjustable X-ray filter. In order to adjust an intensity profile of the X-ray beam, an X-ray absorbing liquid is transported to filter elements of the X-ray filter. Such transport is susceptible to gravitational forces which lead to an

  11. X-ray examination apparatus

    International Nuclear Information System (INIS)

    Bernstein, S.; Griswa, P.J.; Halter, P. Jr.; Kidd, H.J.

    1980-01-01

    Apparatus for x-ray cardiovascular examination and which can also be used for general purpose examination is described. An advantage of the system is that there is no mechanical connection between the image intensifier and source to interfere with the medical examiner or emergency procedures. (U.K.)

  12. A FILTRATION METHOD AND APPARATUS

    DEFF Research Database (Denmark)

    2003-01-01

    The present invention concerns a method and an apparatus for separating dry matter from liquid, comprising providing an enclosed separation environment capable of being pressure regulated, and in said enclosed separation environment contacting at least one filter with a suspension accumulating dr...

  13. Nuclear fuel rod loading apparatus

    International Nuclear Information System (INIS)

    King, H.B.

    1981-01-01

    A nuclear fuel loading apparatus, incorporating a microprocessor control unit, is described which automatically loads nuclear fuel pellets into dual fuel rods with a minimum of manual involvement and in a manner and sequence to ensure quality control and accuracy. (U.K.)

  14. Apparatus for measuring fluid flow

    Science.gov (United States)

    Smith, J.E.; Thomas, D.G.

    Flow measuring apparatus includes a support loop having strain gages mounted thereon and a drag means which is attached to one end of the support loop and which bends the sides of the support loop and induces strains in the strain gages when a flow stream impacts thereon.

  15. Support of nuclear fusion apparatus

    International Nuclear Information System (INIS)

    Watarai, Tetsuo; Ito, Yutaka.

    1975-01-01

    Object: To integrally form a bed for a body for supporting a vacuum container, coil and the like and a bed for a current transformer for supporting the current transformer prior to installation thereof on the floor thereby facilitating assembly and installation. Structure: To provide a base common to a current transformer bed and a body bed without direct installation thereof on the floor. Prior to installation of the current transformer bed and body bed, they are fastened to the base by means of bolts and welded integrally, and the thus formed base is fixed to the floor by means of anchor bolts. Since the current transformer bed and the body bed are formed integrally through the common base, apparatus may easily be carried in and disassembling and re-assembling of apparatus become unnecessary when installed. Further, since the positional relation of the current transformer bed and body bed does not depend on accuracy at the time of installation but depends on accuracy when apparatus manufactured, the toroidal type nuclear fusion apparatus of good accuracy may be obtained. (Yoshihara, H.)

  16. Front lighted optical tooling method and apparatus

    International Nuclear Information System (INIS)

    Stone, W. J.

    1985-01-01

    An optical tooling method and apparatus uses a front lighted shadowgraphic technique to enhance visual contrast of reflected light. The apparatus includes an optical assembly including a fiducial mark, such as cross hairs, reflecting polarized light with a first polarization, a polarizing element backing the fiducial mark and a reflective surface backing the polarizing element for reflecting polarized light bypassing the fiducial mark and traveling through the polarizing element. The light reflected by the reflecting surface is directed through a second pass of the polarizing element toward the frontal direction with a polarization differing from the polarization of the light reflected by the fiducial mark. When used as a tooling target, the optical assembly may be mounted directly to a reference surface or may be secured in a mounting, such as a magnetic mounting. The optical assembly may also be mounted in a plane defining structure and used as a spherometer in conjunction with an optical depth measuring instrument. A method of measuring a radius of curvature of an unknown surface includes positioning the spherometer on a surface between the surface and a depth measuring optical instrument. As the spherometer is frontally illuminated, the distance from the depth measuring instrument to the fiducial mark and the underlying surface are alternately measured and the difference in these measurements is used as the sagittal height to calculate a radius of curvature

  17. Method and apparatus for analyzing ionizable materials

    International Nuclear Information System (INIS)

    Ehrlich, B.J.; Hall, R.C.; Thiede, P.W.

    1979-01-01

    An apparatus and method are described for analyzing a solution of ionizable compounds in a liquid. The solution is irradiated with electromagnetic radiation to ionize the compounds and the electrical conductivity of the solution is measured. The radiation may be X-rays, ultra-violet, infra-red or microwaves. The solution may be split into two streams, only one of which is irradiated, the other being used as a reference by comparing conductivities of the two streams. The liquid must be nonionizable and is preferably a polar solvent. The invention provides an analysis technique useful in liquid chromatography and in gas chromatography after dissolving the eluted gases in a suitable solvent. Electrical conductivity measurements performed on the irradiated eluent provide a quantitative indication of the ionizable materials existing within the eluent stream and a qualitative indication of the purity of the eluent stream. (author)

  18. Nuclear magnetic resonance method and apparatus

    International Nuclear Information System (INIS)

    Burl, M.; Young, I.R.

    1984-01-01

    A method and apparatus for determining the rate of flow of a liquid in a selected region of a body by nuclear magnetic resonance techniques are described. The method includes a sequence of applying a first magnetic pulse effective to excite nuclear magnetic resonance of a chosen nucleus within the liquid preferentially in a slice of the body which includes the selected region. A period of time (tsub(D)) is waited and then a second magnetic pulse is applied which is effective to excite nuclear magnetic resonance of the nuclei preferentially in the slice, and the free induction decay signal is measured. The whole sequence is repeated for different values of the period of time (tsub(D)). The variation in the value of the measured signal with tsub(D) is then related to the rate of flow of the liquid through the slice. (author)

  19. Construction of shallow land simulation apparatuses

    International Nuclear Information System (INIS)

    Yamamoto, Tadatoshi; Ohtsuka, Yoshiro; Takebe, Shinichi; Ohnuki, Toshihiko; Ogawa, Hiromichi; Harada, Yoshikane; Saitoh, Kazuaki; Wadachi, Yoshiki

    1984-07-01

    Shallow land simulation apparatuses in which natural soil can be used as testing soil have been constructed to investigate the migration characteristics of radionuclides in a disposal site. These apparatuses consist of aerated zone apparatus and aquifer zone one. In the aerated zone apparatus, aerated soil upon ground water level is contained in the soil column (d: 30cm x h: 120cm). In the aquifer zone apparatus, aquifer soil laying ground water level is contained in the soil vessel (b: 90cm x l: 270cm x h: 45cm). This report describes the outline of shallow land simulation apparatuses : function of apparatuses and specification of devices, analysis of obstructions, safety rules, analysis of accidents and operation manual. (author)

  20. Variable frequency microwave heating apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Bible, D.W.; Lauf, R.J.; Johnson, A.C.; Thigpen, L.T.

    1999-10-05

    A variable frequency microwave heating apparatus (10) designed to allow modulation of the frequency of the microwaves introduced into a multi-mode microwave cavity (34) for testing or other selected applications. The variable frequency microwave heating apparatus (10) includes a microwave signal generator (12) and a high-power microwave amplifier (20) or a high-power microwave oscillator (14). A power supply (22) is provided for operation of the high-power microwave oscillator (14) or microwave amplifier (20). A directional coupler (24) is provided for detecting the direction and amplitude of signals incident upon and reflected from the microwave cavity (34). A first power meter (30) is provided for measuring the power delivered to the microwave furnace (32). A second power meter (26) detects the magnitude of reflected power. Reflected power is dissipated in the reflected power load (28).

  1. Radiation scatter apparatus and method

    International Nuclear Information System (INIS)

    Molbert, J. L.; Riddle, E. R.

    1985-01-01

    A radiation scatter gauge includes multiple detector locations for developing separate and independent sets of data from which multiple physical characteristics of a thin material and underlying substrate may be determined. In an illustrated embodiment, the apparatus and method of the invention are directed to determining characteristics of resurfaced pavement by nondestructive testing. More particularly, the density and thickness of a thin asphalt overlay and the density of the underlying pavement may be determined

  2. Nuclear reactor vessel inspection apparatus

    International Nuclear Information System (INIS)

    Blackstone, E.G.; Lofy, R.A.; Williams, L.P.

    1979-01-01

    Apparatus for the in situ inspection of a nuclear reactor vessel to detect the location and character of flaws in the walls of the vessel, in the welds joining the various sections of the vessel, in the welds joining attachments such as nozzles, elbows and the like to the reactor vessel and in such attachments wherein an inspection head carrying one or more ultrasonic transducers follows predetermined paths in scanning the various reactor sections, welds and attachments

  3. Vibration damping method and apparatus

    Science.gov (United States)

    Redmond, James M.; Barney, Patrick S.; Parker, Gordon G.; Smith, David A.

    1999-01-01

    The present invention provides vibration damping method and apparatus that can damp vibration in more than one direction without requiring disassembly, that can accommodate varying tool dimensions without requiring re-tuning, and that does not interfere with tool tip operations and cooling. The present invention provides active dampening by generating bending moments internal to a structure such as a boring bar to dampen vibration thereof.

  4. Apparatus for making molten silicon

    Science.gov (United States)

    Levin, Harry (Inventor)

    1988-01-01

    A reactor apparatus (10) adapted for continuously producing molten, solar grade purity elemental silicon by thermal reaction of a suitable precursor gas, such as silane (SiH.sub.4), is disclosed. The reactor apparatus (10) includes an elongated reactor body (32) having graphite or carbon walls which are heated to a temperature exceeding the melting temperature of silicon. The precursor gas enters the reactor body (32) through an efficiently cooled inlet tube assembly (22) and a relatively thin carbon or graphite septum (44). The septum (44), being in contact on one side with the cooled inlet (22) and the heated interior of the reactor (32) on the other side, provides a sharp temperature gradient for the precursor gas entering the reactor (32) and renders the operation of the inlet tube assembly (22) substantially free of clogging. The precursor gas flows in the reactor (32) in a substantially smooth, substantially axial manner. Liquid silicon formed in the initial stages of the thermal reaction reacts with the graphite or carbon walls to provide a silicon carbide coating on the walls. The silicon carbide coated reactor is highly adapted for prolonged use for production of highly pure solar grade silicon. Liquid silicon (20) produced in the reactor apparatus (10) may be used directly in a Czochralski or other crystal shaping equipment.

  5. The Apparatus of Digital Archaeology

    Directory of Open Access Journals (Sweden)

    Jeremy Huggett

    2017-06-01

    Full Text Available Digital Archaeology is predicated upon an ever-changing set of apparatuses – technological, methodological, software, hardware, material, immaterial – which in their own ways and to varying degrees shape the nature of Digital Archaeology. Our attention, however, is perhaps inevitably more closely focused on research questions, choice of data, and the kinds of analyses and outputs. In the process we tend to overlook the effects the tools themselves have on the archaeology we do beyond the immediate consequences of the digital. This article introduces cognitive artefacts as a means of addressing the apparatus more directly within the context of the developing archaeological digital ecosystem. It argues that a critical appreciation of our computational cognitive artefacts is key to understanding their effects on both our own cognition and on the creation of archaeological knowledge. In the process, it defines a form of cognitive digital archaeology in terms of four distinct methods for extracting cognition from the digital apparatus layer by layer.

  6. A general contact mechanical formulation of multilayered structures and its application to deconvolute thickness/mechanical properties of glue used in surface force apparatus.

    Science.gov (United States)

    Math, Souvik; Horn, Roger; Jayaram, Vikram; Biswas, Sanjay Kumar

    2007-04-15

    Currently data obtained from surface force apparatus experiments are convoluted with the mechanical response of glue of unknown thickness, used to bond mica sheets to the substrates. This paper describes a formulation to precisely deconvolute out the forces between the mica sheets by determining the thickness of glue, knowing the mechanical properties of the glue. The formulation consists of a general solution based on the noniterative Hankel transform of the Laplace equation. The generality is achieved by treating all the layers except the one in contact as an effective lumped system consisting of a set of springs in series, where each spring represents a layer. The solution is validated by nanoindentation of trilayer systems consisting of layers with widely diverse mechanical properties, some differing from each other by three orders of magnitude. SFA experiments are done with carefully metered slabs of glue. The proposed method is validated by comparing the actual glue thicknesses with those determined using the present analysis.

  7. Frequency of Fimbrial Virulence Genes (fim, pap, sfa in Escherichia Coli Isolated from the Patients with Urinary Tract Infections from selective hospitals of Tehran, Boroujerd and Sanandej City in 2015-2016

    Directory of Open Access Journals (Sweden)

    mohsen mirzaee

    2017-02-01

    Full Text Available Introduction: Urinary tract infection (UTI caused by E coli is one of the most common diseases in community. Colonization of E. coli and its attachment to the uroepithelium are mediated by adhesions such as P, Fim and S fimbriae. The present study was aimed to evaluate the prevalence of fimbrial virulence genes in Escherichia coli (E. coli isolates from the patients with urinary tract infection in Tehran, Boroujerd and Sanandaj cities, Iran. Methods: In this descriptive cross sectional study, 150 clinical isolates of uropathogenic E.coli were collected from the patients with urinary tract infection. All bacterial isolates were identified by standard biochemical laboratory methods; the fim, pap and sfa genes were detected using the PCR and Multiplex-PCR methods. Results: One hundred forty-five (96.66% isolates were positive for fim gene, one hundred forty (93.33% isolates were positive for pap gene and seven (4.66 isolates were positive for sfa gene. Whole of the isolates were possessed at least one of the three virulence genes. Six (4% isolates were positive for all genes. Conclusion: The findings of this study showed the high frequency of fim and P fimbriae among uropathogenic E.coli isolates from the patients with urinary tract infection. Because of the higher prevalence of UTI in the presence of these genes, detection of the genes in urine samples may help in more suspicious and rapid management of UTI.

  8. Apparatus and method for nuclear magnetic resonance scanning and mapping

    International Nuclear Information System (INIS)

    Damadian, R.V.

    1983-01-01

    An improved apparatus and method is disclosed for analyzing the chemical and structural composition of a specimen including whole-body specimens which may include, for example, living mammals, utilizing nuclear magnetic resonance (NMR) techniques. A magnetic field space necessary to obtain an NMR signal characteristic of the chemical structure of the specimen is focused to provide a resonance domain of selectable size, which may then be moved in a pattern with respect to the specimen to scan the specimen

  9. Transmural coil embolization—alternative technique for management of arterial perforation during subintimal angioplasty

    Directory of Open Access Journals (Sweden)

    Karthikeyan Damodharan

    2016-01-01

    Full Text Available Subintimal angioplasty of lower limb arterial occlusion carries a relatively higher risk of vessel perforation compared to transluminal angioplasty. Vessel perforation is a potentially life threatening complication which requires prompt recognition and management. They are usually managed by endovascular techniques such as low-pressure balloon tamponade, covered stents, and coil embolization of the ruptured artery. We describe a technique of treating vessel perforation following balloon angioplasty. Patient developed a large perforation of the proximal superficial femoral artery (SFA after balloon inflation during subintimal angioplasty of complete SFA occlusion. Following failure of balloon tamponade in sealing the perforation, we successfully treated it by deploying an embolization coil at the site of perforation through the vessel wall followed by balloon tamponade. Our technique could be a useful relatively inexpensive alternative treatment option in the management of vessel perforation compared to covered stents.

  10. Apparatuses And Systems For Embedded Thermoelectric Generators

    KAUST Repository

    Hussain, Muhammad M.

    2013-08-08

    An apparatus and a system for embedded thermoelectric generators are disclosed. In one embodiment, the apparatus is embedded in an interface where the ambient temperatures on two sides of the interface are different. In one embodiment, the apparatus is fabricated with the interface in integrity as a unitary piece. In one embodiment, the apparatus includes a first thermoelectric material embedded through the interface. The apparatus further includes a second thermoelectric material embedded through the interface. The first thermoelectric material is electrically coupled to the second thermoelectric material. In one embodiment, the apparatus further includes an output structure coupled to the first thermoelectric material and the second thermoelectric material and configured to output a voltage.

  11. Apparatuses And Systems For Embedded Thermoelectric Generators

    KAUST Repository

    Hussain, Muhammad M.; Inayat, Salman Bin; Smith, Casey Eben

    2013-01-01

    An apparatus and a system for embedded thermoelectric generators are disclosed. In one embodiment, the apparatus is embedded in an interface where the ambient temperatures on two sides of the interface are different. In one embodiment, the apparatus is fabricated with the interface in integrity as a unitary piece. In one embodiment, the apparatus includes a first thermoelectric material embedded through the interface. The apparatus further includes a second thermoelectric material embedded through the interface. The first thermoelectric material is electrically coupled to the second thermoelectric material. In one embodiment, the apparatus further includes an output structure coupled to the first thermoelectric material and the second thermoelectric material and configured to output a voltage.

  12. Apparatus for producing laser targets

    International Nuclear Information System (INIS)

    Jarboe, T.R.; Baker, W.R.

    1975-01-01

    This patent relates to an apparatus and method for producing deuterium targets or pellets of 25u to 75u diameter. The pellets are sliced from a continuously spun solid deuterium thread at a rate of up to 10 pellets/second. The pellets after being sliced from the continuous thread of deuterium are collimated and directed to a point of use, such as a laser activated combustion or explosion chamber wherein the pellets are imploded by laser energy or laser produced target plasmas for neutral beam injection

  13. X-ray photographic apparatus

    International Nuclear Information System (INIS)

    1977-01-01

    The X-ray photographic system is designed for medical applications. Two detectors are used for surveys in different planes, and produce electrical signals which are supplied to a comparator. The electron beams are examined according to a system of reference time steps. The apparatus includes a light source and a photo-detector and enables a reference signal to be produced against which the detected signals are compared. The beam source is formed from an electron gun, an extractor electrode and an anode; beam then passes through a collimator. (G.C.)

  14. Apparatus for measuring radioactive emissions

    International Nuclear Information System (INIS)

    Bohme, R.C.; Lazerson, M.M.

    1984-01-01

    Apparatus for measuring radioactive emissions from moving radioactive material comprises at least one radiation detector in a housing serving as a first radiation shield and in which at least one groove is formed to expose at least a portion of a receptor surface of the detector. The groove extends transverse to the direction of movement of the material over the detector. A second radiation shield may be located between at least a portion of the first shield and the detector. The material of the second shield is inherently less contaminated and emits secondary excitation radiation of lower energy than the first material. (author)

  15. Strip casting apparatus and method

    Science.gov (United States)

    Williams, R.S.; Baker, D.F.

    1988-09-20

    Strip casting apparatus including a molten-metal-holding container and a nozzle to deposit molten metal onto a moving chill drum to directly cast continuous metallic strip. The nozzle body includes a slot bounded between a back and a front lip. The slot width exceeds about 20 times the gap distance between the nozzle and the chill drum surface. Preferably, the slot width exceeds 0.5 inch. This method of strip casting minimizes pressure drop, insuring better metal-to-chill-drum contact which promotes heat transfer and results in a better quality metallic strip. 6 figs.

  16. Specifications for surface reaction analysis apparatus

    International Nuclear Information System (INIS)

    Teraoka, Yuden; Yoshigoe, Akitaka

    2001-03-01

    A surface reaction analysis apparatus was installed at the JAERI soft x-ray beamline in the SPring-8 as an experimental end-station for the study of surface chemistry. The apparatus is devoted to the study concerning the influence of translational kinetic energy of incident molecules to chemical reactions on solid surfaces with gas molecules. In order to achieve the research purpose, reactive molecular scattering experiments and photoemission spectroscopic measurements using synchrotron radiation are performed in that apparatus via a supersonic molecular beam generator, an electron energy analyzer and a quadrupole mass analyzer. The detail specifications for the apparatus are described in this report. (author)

  17. An automatic refolding apparatus for preparative-scale protein production.

    Directory of Open Access Journals (Sweden)

    Yanye Feng

    Full Text Available Protein refolding is an important process to recover active recombinant proteins from inclusion bodies. Refolding by simple dilution, dialysis and on-column refolding methods are the most common techniques reported in the literature. However, the refolding process is time-consuming and laborious due to the variability of the behavior of each protein and requires a great deal of trial-and-error to achieve success. Hence, there is a need for automation to make the whole process as convenient as possible. In this study, we invented an automatic apparatus that integrated three refolding techniques: varying dilution, dialysis and on-column refolding. We demonstrated the effectiveness of this technology by varying the flow rates of the dilution buffer into the denatured protein and testing different refolding methods. We carried out different refolding methods on this apparatus: a combination of dilution and dialysis for human stromal cell-derived factor 1 (SDF-1/CXCL12 and thioredoxin fused-human artemin protein (Trx-ARTN; dilution refolding for thioredoxin fused-human insulin-like growth factor I protein (Trx-IGF1 and enhanced fluorescent protein (EGFP; and on-column refolding for bovine serum albumin (BSA. The protein refolding processes of these five proteins were preliminarily optimized using the slowly descending denaturants (or additives method. Using this strategy of decreasing denaturants concentration, the efficiency of protein refolding was found to produce higher quantities of native protein. The standard refolding apparatus configuration can support different operations for different applications; it is not limited to simple dilution, dialysis and on-column refolding techniques. Refolding by slowly decreasing denaturants concentration, followed by concentration or purification on-column, may be a useful strategy for rapid and efficient recovery of active proteins from inclusion bodies. An automatic refolding apparatus employing this

  18. Self-propelled pulse X-ray apparatus Sirena-1

    International Nuclear Information System (INIS)

    Danil'chenko, N.T.; Ershov, L.S.; Il'chenko, A.V.; Krasil'nikov, S.B.; Kristalinskij, A.L.; Lozovoj, L.N.; Markov, S.N.; Morgovskij, L.Ya.

    1984-01-01

    The structure and specifications of a self-propelled pulse X-ray apparatus ''Sirena-1'' for testing oilt and gas pipelines welded joints are described. The apparatus is designed on the base of pulse X-ray apparatus MIRA. Apparatus control is realized by means of the 137 Cs source or manual control desk. The apparatus ensures perfect control sensitivity

  19. Nuclear fuel rod loading apparatus

    International Nuclear Information System (INIS)

    King, H.B.; Macivergan, R.; Mckenzie, G.W.

    1980-01-01

    An apparatus incorporating a microprocessor control is provided for automatically loading nuclear fuel pellets into fuel rods commonly used in nuclear reactor cores. The apparatus comprises a split ''v'' trough for assembling segments of fuel pellets in rows and a shuttle to receive the fuel pellets from the split ''v'' trough when the two sides of the split ''v'' trough are opened. The pellets are weighed while in the shuttle, and the shuttle then moves the pellets into alignment with a fuel rod. A guide bushing is provided to assist the transfer of the pellets into the fuel rod. A rod carousel which holds a plurality of fuel rods presents the proper rod to the guide bushing at the appropriate stage in the loading sequence. The bushing advances to engage the fuel rod, and the shuttle advances to engage the guide bushing. The pellets are then loaded into the fuel rod by a motor operated push rod. The guide bushing includes a photocell utilized in conjunction with the push rod to measure the length of the row of fuel pellets inserted in the fuel rod

  20. Diseases of the branquial apparatus

    International Nuclear Information System (INIS)

    Perez-Candela, V.; Wiehoff, A.; Avial, R.

    2000-01-01

    To correlate ht embryologic and radiologic findings in the branchial apparatus or system with the anomalies that can occur. We reviewed the cases of branchial anomalies examined over the past 6 years, finding periparotid cysts at the first branchial cleft (n=2), cysts (n=13) and fistulas (n=4) at the second, and cysts (n=2) and thymopharyngeal cysts (n=3) at the third. The studies included ultrasound, computed tomography, magnetic resonance imaging and fistulography. All the patients underwent surgery, with histological confirmation. Knowledge of the embryology of the branchial apparatus or system helps in the understanding of anomalies, which appear as cervical cystic masses, mainly located along the anterior border of the sternocleidomastoid (SCM) muscle, or as fistulas running from the exterior to the pharyngeal lumen at the level of the tonsillar fossa, sometimes forming sinuses, that is fistulas that are blind at either the external or internal end. The most common anomalies arise from the second branchial cleft and are easily diagnosed in the presence of a cystic mass located to one side of the SCM muscle, behind the submandibular gland and occupying the carotid space. (Author) 14 refs

  1. Fuel cell catholyte regenerating apparatus

    International Nuclear Information System (INIS)

    Struthers, R. C.

    1985-01-01

    A catholyte regenerating apparatus for a fuel cell having a cathode section containing a catholyte solution and wherein fuel cell reaction reduces the catholyte to gas and water. The apparatus includes means to conduct partically reduced water diluted catholyte from the fuel cell and means to conduct the gas from the fuel cell to a mixing means. An absorption tower containing a volume of gas absorbing liquid solvent receives the mixed together gas and diluted catholyte from the mixing means within the absorption column, the gas is absorbed by the solvent and the gas ladened solvent and diluted catholyte are commingled. A liquid transfer means conducts gas ladened commingled. A liquid transfer means conducts gas ladened commingled solvent and electrolyte from the absorption column to an air supply means wherein air is added and commingled therewith and a stoichiometric volume of oxygen from the air is absorbed thereby. A second liquid transfer means conducts the gas ladened commingled solvent and diluted catholyte into a catalyst column wherein the oxygen and gas react to reconstitute the catholyte from which the gas was generated wna wherein the reconstituted diluted catholyte is separated from the solvent. Recirculating means conducts the solvent from the catalyst column back into the absorption column and liquid conducting means conducts the reconstituted catholyte to a holding tank preparatory for catholyte to a holding tank preparatory for recirculation through the cathode section of the fuel cell

  2. Conveyor with rotary airlock apparatus

    Science.gov (United States)

    Kronbert, J.W.

    1993-01-01

    This invention is comprised of an apparatus for transferring objects from a first region to a second region, the first and second regions having differing atmospheric environments. The apparatus includes a shell having an entrance and an exit, a conveyer belt running through the shell from the entrance to the exit, and a horizontally mounted `revolving door` with at least four vanes revolving about its axis. The inner surface of the shell and the top surface of the conveyer belt act as opposing walls of the `revolving door`. The conveyer belt dips as it passes under but against the revolving vanes so as not to interfere with them but to engage at least two of the vanes and define thereby a moving chamber. Preferably, the conveyer belt has ridges or grooves on its surface that engage the edges of the vanes and act to rotate the vane assembly. Conduits are provided that communicate with the interior of the shell and allow the adjustment of the atmosphere of the moving chamber or recovery of constituents of the atmosphere of the first region from the moving chamber before they escape to the second region.

  3. Nuclear reactor core servicing apparatus

    International Nuclear Information System (INIS)

    Andrea, C.

    1977-01-01

    Disclosed is an improved core servicing apparatus for a nuclear reactor of the type having a reactor vessel, a vessel head having a head penetration therethrough, a removable plug adapted to fit in the head penetration, and a core of the type having an array of elongated assemblies. The improved core servicing apparatus comprises a plurality of support columns suspended from the removable plug and extending downward toward the nuclear core, rigid support means carried by each of the support columns, and a plurality of servicing means for each of the support columns for servicing a plurality of assemblies. Each of the plurality of servicing means for each of the support columns is fixedly supported in a fixed array from the rigid support means. Means are provided for rotating the rigid support means and servicing means between condensed and expanded positions. When in the condensed position, the rigid support means and servicing means lie completely within the coextensive boundaries of the plug, and when in the expanded position, some of the rigid support means and servicing means lie without the coextensive boundaries of the plug

  4. Apparatus for incinerating hazardous waste

    Science.gov (United States)

    Chang, R.C.W.

    1994-12-20

    An apparatus is described for incinerating wastes, including an incinerator having a combustion chamber, a fluid-tight shell enclosing the combustion chamber, an afterburner, an off-gas particulate removal system and an emergency off-gas cooling system. The region between the inner surface of the shell and the outer surface of the combustion chamber forms a cavity. Air is supplied to the cavity and heated as it passes over the outer surface of the combustion chamber. Heated air is drawn from the cavity and mixed with fuel for input into the combustion chamber. The pressure in the cavity is maintained at least approximately 2.5 cm WC higher than the pressure in the combustion chamber. Gases cannot leak from the combustion chamber since the pressure outside the chamber (inside the cavity) is higher than the pressure inside the chamber. The apparatus can be used to treat any combustible wastes, including biological wastes, toxic materials, low level radioactive wastes, and mixed hazardous and low level transuranic wastes. 1 figure.

  5. Pipe and hose decontamination apparatus

    International Nuclear Information System (INIS)

    Fowler, D.E.

    1985-01-01

    A pipe and hose decontamination apparatus is disclosed using freshly filtered high pressure Freon solvent in an integrated closed loop to remove radioactive particles or other contaminants from items having a long cylindrical geometry such as hoses, pipes, cables and the like. The pipe and hose decontamination apparatus comprises a chamber capable of accomodating a long cylindrical work piece to be decontaminated. The chamber has a downward sloped bottom draining to a solvent holding tank. An entrance zone, a cleaning zone and an exit drying zone are defined within the chamber by removable partitions having slotted rubber gaskets in their centers. The entrance and exit drying zones contain a horizontally mounted cylindrical housing which supports in combination a plurality of slotted rubber gaskets and circular brushes to initiate mechanical decontamination. Solvent is delivered at high pressure to a spray ring located in the cleaning zone having a plurality of nozzles surrounding the work piece. The solvent drains into a solvent holding tank located below the nozzles and means are provided for circulating the solvent to and from a solvent cleaning, distilling and filter unit

  6. Method And Apparatus For Evaluatin Of High Temperature Superconductors

    Science.gov (United States)

    Fishman, Ilya M.; Kino, Gordon S.

    1996-11-12

    A technique for evaluation of high-T.sub.c superconducting films and single crystals is based on measurement of temperature dependence of differential optical reflectivity of high-T.sub.c materials. In the claimed method, specific parameters of the superconducting transition such as the critical temperature, anisotropy of the differential optical reflectivity response, and the part of the optical losses related to sample quality are measured. The apparatus for performing this technique includes pump and probe sources, cooling means for sweeping sample temperature across the critical temperature and polarization controller for controlling a state of polarization of a probe light beam.

  7. Apparatus and method for gelling liquefied gasses

    Science.gov (United States)

    Elliott, Adam (Inventor); DiSalvo, Roberto (Inventor); Shepherd, Phillip (Inventor); Kosier, Ryan (Inventor)

    2011-01-01

    A method and apparatus for gelling liquid propane and other liquefied gasses includes a temperature controlled churn mixer, vacuum pump, liquefied gas transfer tank, and means for measuring amount of material entering the mixer. The apparatus and method are particularly useful for the production of high quality rocket fuels and propellants.

  8. Apparatus Named after Our Academic Ancestors, III

    Science.gov (United States)

    Greenslade, Thomas B., Jr.

    2014-01-01

    My academic ancestors in physics have called on me once more to tell you about the apparatus that they devised, and that many of you have used in your demonstrations and labs. This article is about apparatus named after François Arago, Heinrich Helmholtz, Leon Foucault, and James Watt.

  9. Radiation therapy apparatus having retractable beam stopper

    International Nuclear Information System (INIS)

    Coad, G.L.

    1983-01-01

    This invention relates to a radiation therapy apparatus which utilized a linear translation mechanism for positioning a beam stopper. An apparatus is described wherein the beam stopper is pivotally attached to the therapy machine with an associated drive motor in such a way that the beam stopper retracts linearly

  10. Method and apparatus for producing microspherical particles

    International Nuclear Information System (INIS)

    Egli, W.; Bailey, W.H.; Leary, D.F.; Lansley, R.J.

    1979-01-01

    This invention relates generally to a method and apparatus for producing microspherical particles and more particularly to a method and apparatus which are particularly useful in connection with the sol-gel process for the production of nuclear fuel kernels. (U.K.)

  11. The Acoustical Apparatus of Rudolph Koenig.

    Science.gov (United States)

    Greenslade, Thomas B., Jr.

    1992-01-01

    Discusses the history of Rudolph Koenig's contribution to the development of acoustical apparatus. Contributions include the clock fork to determine absolute acoustic frequencies, a forerunner of the oscilloscope called the manometric flame, and an acoustic interference apparatus used in the Fourier synthesis of musical sounds. (MDH)

  12. 47 CFR 32.2311 - Station apparatus.

    Science.gov (United States)

    2010-10-01

    ... FOR TELECOMMUNICATIONS COMPANIES Instructions for Balance Sheet Accounts § 32.2311 Station apparatus... company shall prepare a list of station apparatus which shall be used as its list of disposition units for... technicians, and others, shall be included in Account 2114, Tools and other work equipment, Account 2220...

  13. SCANNING AND TRACKING MONITORING APPARATUS AND METHOD

    DEFF Research Database (Denmark)

    2017-01-01

    Disclosed is a scanning monitoring apparatus for medical imaging, the scanning monitoring apparatus comprising a controller unit and a display, wherein the controller unit during a scanning session is configured to obtain tracking data (102) of a subject in a medical scanner, obtain scanner data ...

  14. Apparatus for separating solids from a liquid

    NARCIS (Netherlands)

    Rem, P.C.; Berkhout, S.P.M.

    2007-01-01

    The invention relates to an apparatus and a method for separating a material stream consisting of several materials. The materials to be separated have different densities or density ranges, so that the material of the highest density can be discharged through a screen of the apparatus, while the

  15. Metering apparatus and tariffs for electricity supply

    International Nuclear Information System (INIS)

    1990-01-01

    Conference papers presented cover system economies and tariff structure with papers on pricing of electricity and new metering technologies. Other topics reviewed include metering apparatus design, electronic metering apparatus and solid phase metering technology. Meter data retrieval, bulk supply metering, test equipment and maintenance, and legal requirements and standards are discussed. (author)

  16. APPARATUS FOR THE PRODUCTION OF LITHIUM METAL

    Science.gov (United States)

    Baker, P.S.; Duncan, F.R.; Greene, H.B.

    1961-08-22

    Methods and apparatus for the production of high-purity lithium from lithium halides are described. The apparatus is provided for continuously contacting a molten lithium halide with molten barium, thereby forming lithium metal and a barium halide, establishing separate layers of these reaction products and unreacted barium and lithium halide, and continuously withdrawing lithium and barium halide from the reaction zone. (AEC)

  17. Method and apparatus for dismantling mechanical anchors

    Energy Technology Data Exchange (ETDEWEB)

    Dubovskiy, Yu P; Chendev, F S; Gritsayuk, B I; Gubin, N I; Osipov, S P

    1982-01-01

    This apparatus is designed to reduce the amount of labor required to dismantle mechanical anchors while at the same time lowering expenditures for lumber. Longwall beams and timber skips are used to support the cap and any fractured rock faces. The apparatus itself has grooves, vertical guides, and a drive system to position the longwall beams.

  18. Method of magnetic separation and apparatus therefore

    Science.gov (United States)

    Oder, Robin R. (Inventor)

    1991-01-01

    An apparatus for magnetically separating and collecting particulate matter fractions of a raw sample according to relative magnetic susceptibilities of each fraction so collected is disclosed. The separation apparatus includes a splitter which is used in conjunction with a magnetic separator for achieving the desired fractionation.

  19. low-cost apparatus from locally available materials for teaching

    African Journals Online (AJOL)

    unesco

    twofold: i) to design and produce appropriate low cost apparatus from locally .... How are the low-cost and manufactured apparatus compared in terms of cost and efficiency? ... BASIC TOOLS FOR THE LOW COST APPARATUS PRODUCTION.

  20. Multileaf collimator and related apparatus

    International Nuclear Information System (INIS)

    Brown, K.J.

    1989-01-01

    In radiotherapy apparatus using a multileaf collimator, the adjustment positions of the individual leaves can be determined optically by means of a video camera which observes the leaves via a radiation transparent mirror in the beam path. In order to overcome problems of low contrast and varying object brightness, the improvement comprises adding retroreflectors to the collimator leaves whose positions are known relative to the inner edge of the respective leaf. The retroreflectors can extend along the length of the leaf or they can be small. For setting up, corresponding manually adjustable optical diaphragm leaves can be used to project an optical simulation of the treatment area onto the patient, retroreflectors being similarly located relative to the shadow-casting edge of the leaves. (author)

  1. Modeling of column apparatus processes

    CERN Document Server

    Boyadjiev, Christo; Boyadjiev, Boyan; Popova-Krumova, Petya

    2016-01-01

    This book presents a new approach for the modeling of chemical and interphase mass transfer processes in industrial column apparatuses, using convection-diffusion and average-concentration models. The convection-diffusion type models are used for a qualitative analysis of the processes and to assess the main, small and slight physical effects, and then reject the slight effects. As a result, the process mechanism can be identified. It also introduces average concentration models for quantitative analysis, which use the average values of the velocity and concentration over the cross-sectional area of the column. The new models are used to analyze different processes (simple and complex chemical reactions, absorption, adsorption and catalytic reactions), and make it possible to model the processes of gas purification with sulfur dioxide, which form the basis of several patents.

  2. Isotope separation method and apparatus

    International Nuclear Information System (INIS)

    Lyon, R.K.; Eisner, P.N.; Thomas, W.R.L.

    1980-01-01

    A method and apparatus are specified for separating a mixture of isotopes present in a compound, preferably a gaseous compound, into two or more parts in each of which the abundances of the isotopes differ from the natural abundances of the isotopes in the compound. The invention particularly relates to carrying out a laser induced, isotopically selective conversion of gaseous molecules in such a manner as to achieve more than one stage of isotope separation along the length of the laser beam. As an example, the invention is applied to the separation of the isotopes of uranium in UF 6 , in which either the U-235 or U-238 isotope is selectively excited by means of irradiation from an infrared laser, and the selectively excited isotope converted into a product that can be recovered from UF 6 by one of a variety of methods that are described. (U.K.)

  3. Molecular separation method and apparatus

    International Nuclear Information System (INIS)

    Villa-Aleman, E.

    1996-01-01

    A method and apparatus are disclosed for separating a gaseous mixture of chemically identical but physically different molecules based on their polarities. The gaseous mixture of molecules is introduced in discrete quantities into the proximal end of a porous glass molecular sieve. The molecular sieve is exposed to microwaves to excite the molecules to a higher energy state from a lower energy state, those having a higher dipole moment being excited more than those with a lower energy state. The temperature of the sieve kept cold by a flow of liquid nitrogen through a cooling jacket so that the heat generated by the molecules colliding with the material is transferred away from the material. The molecules thus alternate between a higher energy state and a lower one, with the portion of molecules having the higher dipole moment favored over the others. The former portion can then be extracted separately from the distal end of the molecular sieve. 2 figs

  4. Dental X-ray apparatus

    International Nuclear Information System (INIS)

    Weiss, M.E.

    1980-01-01

    Intra-oral X-ray apparatus which reduces the number of exposures necessary to obtain panoramic dental radiographs is described in detail. It comprises an electron gun, a tubular target carrier projecting from the gun along the beam axis and carrying at its distal end a target surrounded by a shield of X-ray opaque material. This shield extends forward and laterally of the target and has surfaces which define a wedge or cone-shaped radiation pattern delimited vertically by the root tips of the patient's teeth. A film holder is located externally of the patient's mouth. A disposable member can fit on the target carrier to depress the patient's tongue out of the radiation pattern and to further shield the roof of the mouth. The electron beam can be magnetically deflected to change the X-ray beam direction. (author)

  5. Dental X-ray apparatus

    International Nuclear Information System (INIS)

    Weiss, M.E.

    1980-01-01

    Intra-oral dental X-ray apparatus for panoramic dental radiography is described in detail. It comprises an electron gun having an elongated tubular target carrier extending into the patient's mouth. The carrier supports an inclined target for direction of an X-ray pattern towards a film positioned externally of the patient's mouth. Image definition is improved by a focusing anode which focuses the electron beam into a sharp spot (0.05 to 0.10 mm diameter) on the target. The potential on the focusing anode is adjustable to vary the size of the spot. An X-ray transmitting ceramic (oxides of Be, Al and Si) window is positioned adjacent to the front face of the target. The electron beam can be magnetically deflected to change the X-ray beam direction. (author)

  6. Automatic gamma spectrometry analytical apparatus

    International Nuclear Information System (INIS)

    Lamargot, J.-P.; Wanin, Maurice.

    1980-01-01

    This invention falls within the area of quantitative or semi-quantitative analysis by gamma spectrometry and particularly refers to a device for bringing the samples into the counting position. The purpose of this invention is precisely to provide an automatic apparatus specifically adapted to the analysis of hard gamma radiations. To this effect, the invention relates to a gamma spectrometry analytical device comprising a lead containment, a detector of which the sensitive part is located inside the containment and additionally comprising a transfer system for bringing the analyzed samples in succession to a counting position inside the containment above the detector. A feed compartment enables the samples to be brought in turn one by one on to the transfer system through a duct connecting the compartment to the transfer system. Sequential systems for the coordinated forward feed of the samples in the compartment and the transfer system complete this device [fr

  7. Nuclear magnetic resonance diagnostic apparatus

    International Nuclear Information System (INIS)

    Sugimoto, H.

    1985-01-01

    Nuclear magnetic resonance diagnostic apparatus including a coil for generating a gradient field in a plane perpendicular to a static magnetic field, means for controlling the operation of the coil to rotationally shift in angular steps the gradient direction of the gradient field at an angle pitch of some multiple of the unit index angle through a plurality of rotations to assume all the shift positions of the gradient direction, a rough image reconstructor for reconstructing a rough tomographic image on the basis of nuclear magnetic resonance signals acquired during a rotation of the second gradient magnetic field, a rough image display for depicting the rough tomographic image, a final image reconstructor for reconstructing a final tomographic image on the basis of all nuclear magnetic resonance signals corresponding to all of the expected rotation shift positions acquired during a plurality of rotations and a final image display for depicting the final tomographic image

  8. Spheromak type plasma experiment apparatus

    International Nuclear Information System (INIS)

    Odagiri, Kiyoyuki; Miyauchi, Yasuyuki; Oomura, Hiroshi

    1985-01-01

    The fusion power reactor which is expected to be the most promising energy has been developed for several plasma confinement systems. Under these circumstances, Spheromak configuration has recently attracted attention because of its simple structure and efficient plasma confinement. This apparatus was ordered by the Engineering Department of University of Tokyo for basic studies of the Spheromak plasma confinement technologies. This forms Spheromak plasma according to the induction discharge system which injects this plasma with magnetic energy generated by a toroidal current in the plasma and discharges the current through the electrical feed through. Toroidal current is induced by the poloidal coil in the vessel. We worked together with the researchers of University of Tokyo to conduct experiments and confirmed the formation and confinement of Spheromak plasma in the initial test. (author)

  9. Apparatuses to support photovoltaic modules

    Science.gov (United States)

    Ciasulli, John; Jones, Jason

    2017-08-22

    Methods and apparatuses to support photovoltaic ("PV") modules are described. A saddle bracket has a mounting surface to support one or more PV modules over a tube, a gusset coupled to the mounting surface, and a mounting feature coupled to the gusset to couple to the tube. A grounding washer has a first portion to couple to a support; and a second portion coupled to the first portion to provide a ground path to a PV module. A PV system has a saddle bracket; a PV module over the saddle bracket; and a grounding washer coupled to the saddle bracket and the PV module. Saddle brackets can be coupled to a torque tube at predetermined locations. PV modules can be coupled to the saddle brackets.

  10. Apparatus for sampling hazardous media

    International Nuclear Information System (INIS)

    Gardner, J.F.; Showalter, T.W.

    1984-01-01

    An apparatus for sampling a hazardous medium, such as radioactive or chemical waste, selectively collects a predetermined quantity of the medium in a recess of an end-over-end rotatable valving member. This collected quantity is deposited in a receiving receptacle located in a cavity while the receiving receptacle is in a sealed relationship with a recess to prevent dusting of the sampled media outside the receiving receptacle. The receiving receptacle is removably fitted within a vehicle body which is, in turn, slidably movable upon a track within a transport tube. The receiving receptacle is transported in the vehicle body from its sample receiving position within a container for the hazardous medium to a sample retrieval position outside the medium container. The receiving receptacle may then be removed from the vehicle body, capped and taken to a laboratory for chemical analysis. (author)

  11. Hermetic Seal Leak Detection Apparatus

    Science.gov (United States)

    Kelley, Anthony R. (Inventor)

    2013-01-01

    The present invention is a hermetic seal leak detection apparatus, which can be used to test for hermetic seal leaks in instruments and containers. A vacuum tight chamber is created around the unit being tested to minimize gas space outside of the hermetic seal. A vacuum inducing device is then used to increase the gas chamber volume inside the device, so that a slight vacuum is pulled on the unit being tested. The pressure in the unit being tested will stabilize. If the stabilized pressure reads close to a known good seal calibration, there is not a leak in the seal. If the stabilized pressure reads closer to a known bad seal calibration value, there is a leak in the seal. The speed of the plunger can be varied and by evaluating the resulting pressure change rates and final values, the leak rate/size can be accurately calculated.

  12. X-ray tomographic apparatus

    International Nuclear Information System (INIS)

    Walters, R.G.

    1982-01-01

    Apparatus is claimed for constructing a representation of the variation of attenuation of penetrating radiation in a planar slice of an object positioned in a scan circle. It comprises means for generating sets of data, each set representing a characteristic of the attenuation of a fan-shaped swath of paths of radiation passing through the scan circle. Each swath has an apex at one of a plurality of angular positions around the scan circle. The angular positions of the apices span an arc of between 180 and 360 degrees. There is a means operatively connected to the generating means for convolving each set of data and means for transforming the convolved sets of data into the representation

  13. Emergency cooling apparatus for reactor

    International Nuclear Information System (INIS)

    Sakaguchi, S.

    1975-01-01

    A nuclear reactor is described which has the core surrounded by coolant and an inert cover gas all sealed within a container, an emergency cooling apparatus employing a detector that will detect cover gas or coolant, particularly liquid sodium, leaking from the container of the reactor, to release a heat exchange material that is inert to the coolant, which heat exchange material is cooled during operation of the reactor. The heat exchange material may be liquid niitrogen or a combination of spheres and liquid nitrogen, for example, and is introduced so as to contact the coolant that has leaked from the container quickly so as to rapidly cool the coolant to prevent or extinguish combustion. (Official Gazette)

  14. The Main Technological Characteristics of Apparatus for Industrial Radiochemical Processes, in Particular Ethylene Polymerization; Caracteristique techniques fondamentals des appareils pour l'application industrielle de reactions chimiques sous rayonnement (notamment la polymerisation de l'ethylene ); Osnovnye tekhnologicheskie kharakteristiki apparatov dlya provedeniya radiatsionno-khimi-cheskikh protsessov (v chastnosti, dlya polimerizatsii ehtilena) v promyshlennom masshtabe; Principales caracteristicas tecnologicas de los aparatos para la aplicacion industrial de reacciones radioquimicas

    Energy Technology Data Exchange (ETDEWEB)

    Syrkus, N P; Breger, A K; Weinstein, B I [Karpov Physicochemical Institute, Moscow, USSR (Russian Federation)

    1960-07-15

    The paper gives a general review of some of the main technological features of apparatus, for instance spherical apparatus, for industrial radiochemical processes. A method is proposed for estimating the effectiveness of apparatus of any given construction by comparing it with the output of an infinitely large apparatus having the same radiation source. An account is given of the technological features of an apparatus for radio-polymerizing ethylene at 200 atmospheres and 25{sup o}C{sup 1} with a rodshaped gamma-radiation source (Co{sup 60}) of variable activity. This apparatus can be designed to suit the mean dose rate which the power efficiency of the apparatus allows. It is shown that the yield, Q, of the apparatus is, other things being equal, a constant ration of the power, W{sub 0}, of the gamma-radiation of the apparatus. In the apparatus reviewed, Q {approx} W{sub 0}{sup 0,5}. (author) [French] Le memoire contient un expose general des caracteristiques techniques essentielles des appareils, par exemple d'un appareil du type spherique, pour l'application industrielle de reactions chimiques sous rayonnement. Le memoire propose une methode pour evaluer l'efficacite d'appareils de tous types en comparant la productivite de chaque modele avec celle d'un appareil infiniment grand, alimente par une source de rayonnement identique. Le memoire indique le calcul des caracteristiques techniques de l'appareil destine a la polymerisation sous rayonnement de l'ethylene (pression : 200 atmospheres, temperature: 25{sup o}C{sup 2} avec une source allongee de rayonnement gamma Co{sup 60} pour diverses activites. Un appareil de ce type peut etre calcule selon les valeurs moyennes de l'intensite des doses, determinees selon la valeur du coefficient d'efficacite totale energetique de l'appareil. On constate que la productivite (Q) de l'appareil, toutes choses egales d'ailleurs, est puissance de l'intensite (W{sub 0}) du rayonnement gamma de l'appareil. Pour l'appareil considere

  15. [Development of electroforming apparatus for coronal restoration].

    Science.gov (United States)

    Watanabe, M; Sawada, T; Ukiya, M

    1989-03-01

    As dental technologies become highly developed, techniques have been more diversified. From as aspect of prosthodontic practice, both esthetic and functional requirements are emphasized for coronal restoration and consequently, these should be considered in the routine procedure. In fabrication of coronal restorations, metal, porcelain and resin are commonly used, and there exists the various disadvantages for metal cast method due to complicated processes by using different dental materials. Therefore, an electroforming apparatus was developed by us to replace the conventional procedure by a cathode rotary system. It was applied for coronal restorations to allow an electroforming directly on a working model. An experiment was successfully conducted to apply for a veneer crown on abutment tooth of upper central incisor on plaster model. The results were obtained as follows, 1. It was become possible to construct a metal framework by the electroforming. 2. Metal framework can be constructed on the same working model without a duplication of it. 3. The combined system for cathode rotation and liquid circulation could shorten the electroposition time, and allows a high current density extending to 50 A/dm2.

  16. Process and apparatus for cracking petroleum, etc

    Energy Technology Data Exchange (ETDEWEB)

    1931-04-25

    Process for catalytic cracking of petroleum and similar material at normal pressure, characterized by the oil vaporized in a vaporizer being treated in a first catalyst-chamber and in a separator attached to it, light constituents being separated, and then its being run into a second apparatus-group (vaporizer, catalyst-chamber, and separator), further groups following in series, whereby the catalyst works in a separate catalyst apparatus with ever-increasing activity time on the always lesser but always more difficult to crack material, so that in the whole apparatus a methodical cracking process is effected.

  17. Apparatus for concentrating by dual temperature exchange

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1975-01-01

    Improvements in an apparatus for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. The first fluid is a vaporizable liquid and the auxiliary fluid a gas, the apparatus having means for cascading the auxiliary fluid and the feed fluid in vapor and preferably also in liquid form. The apparatus also contains new combinations of means for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations of the system. The reactants in the example given are hydrogen sulfide gas and liquid water

  18. Electro-Optical Sensing Apparatus and Method for Characterizing Free-Space Electromagnetic Radiation

    Science.gov (United States)

    Zhang, Xi-Cheng; Libelo, Louis Francis; Wu, Qi

    1999-09-14

    Apparatus and methods for characterizing free-space electromagnetic energy, and in particular, apparatus/method suitable for real-time two-dimensional far-infrared imaging applications are presented. The sensing technique is based on a non-linear coupling between a low-frequency electric field and a laser beam in an electro-optic crystal. In addition to a practical counter-propagating sensing technique, a co-linear approach is described which provides longer radiated field--optical beam interaction length, thereby making imaging applications practical.

  19. Dental X-ray apparatus

    International Nuclear Information System (INIS)

    Weiss, M.E.

    1980-01-01

    Intra-oral dental X-ray apparatus for panoramic radiography is described in detail. It comprises a tubular target carrier supporting at its distal end a target with an inclined forward face. Image definition is improved by positioning in the path of the X-rays a window of X-ray transmitting ceramic material, e.g. 90% oxide of Be, or Al, 7% Si0 2 . The target carrier forms a probe which can be positioned in the patient's mouth. X-rays are directed forwardly and laterally of the target to an X-ray film positioned externally. The probe is provided with a detachable sleeve having V-form arms of X-ray opaque material which serve to depress the tongue out of the radiation path and also shield the roof of the mouth and other regions of the head from the X-ray pattern. A cylindrical lead shield defines the X-ray beam angle. (author)

  20. Hanging drop crystal growth apparatus

    Science.gov (United States)

    Naumann, Robert J. (Inventor); Witherow, William K. (Inventor); Carter, Daniel C. (Inventor); Bugg, Charles E. (Inventor); Suddath, Fred L. (Inventor)

    1990-01-01

    This invention relates generally to control systems for controlling crystal growth, and more particularly to such a system which uses a beam of light refracted by the fluid in which crystals are growing to detect concentration of solutes in the liquid. In a hanging drop apparatus, a laser beam is directed onto drop which refracts the laser light into primary and secondary bows, respectively, which in turn fall upon linear diode detector arrays. As concentration of solutes in drop increases due to solvent removal, these bows move farther apart on the arrays, with the relative separation being detected by arrays and used by a computer to adjust solvent vapor transport from the drop. A forward scattering detector is used to detect crystal nucleation in drop, and a humidity detector is used, in one embodiment, to detect relative humidity in the enclosure wherein drop is suspended. The novelty of this invention lies in utilizing angular variance of light refracted from drop to infer, by a computer algorithm, concentration of solutes therein. Additional novelty is believed to lie in using a forward scattering detector to detect nucleating crystallites in drop.

  1. Bi-planal angiographic apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Angiography apparatus has an L-arm rotatable about a vertical axis and a U-arm mounted on the upstanding section of the L-arm for rotation about a horizontal axis. An x-ray source is at one end of the U-arm and image receptors including an image intensifier and a first film changer are at the other end to enable making posterior-anterior and anterior-posterior x-ray views at various angles relative to a patient who is located on the isocenter which is the intersection of the horizontal, vertical and x-ray beam axis. A second film changer for making lateral generally isocentric views is mounted within the U-arm on a stand that is movable along the horizontal U-arm axis to allow obtaining various distances between the image plane of the film and another x-ray source. The lateral changer is on a mechanism for shifting it vertically and longitudinally a limited amount and for rotating it with a motor so this changer will stay level until the U-arm has been tilted through a pre-determined angle. After this angle is reached motorized rotation is discontinued and the lateral changer is allowed to rotate with the U-arm. (Auth.)

  2. Isotope separation apparatus and method

    International Nuclear Information System (INIS)

    Cotter, T.P.

    1982-01-01

    The invention relates to a method and apparatus for laser isotope separation by photodeflection. A molecular beam comprising at least two isotopes to be separated intersects, preferable substantially perpendicular to one broad side of the molecular beam, with a laser beam traveling in a first direction. The laser beam is reflected back through the molecular beam, preferably in a second direction essentially opposite to the first direction. The laser beam comprises pi-pulses of a selected wavelength which excite unexcited molecules, or cause stimulated emission of excited molecules of one of the isotopes. Excitation caused by first direction pi-pulses moves molecules of the isotope excited thereby in the first direction. Stimulated emission of excited molecules of the isotope is brought about by returning pi-pulses traveling in the second direction. Stimulated emission moves emitting molecules in a direction opposite to the photon emitted. Because emitted photons travel in the second direction, emitting molecules move in the first direction. Substantial molecular movement is accomplished by a large number of pi-pulse-molecule interactions. A beam corer collects the molecules in the resulting enriched divergent portions of the beam

  3. Isotope separation apparatus and method

    International Nuclear Information System (INIS)

    Feldman, B. J.

    1985-01-01

    The invention relates to an improved method and apparatus for laser isotope separation by photodeflection. A molecular beam comprising at least two isotopes to be separated intersects, preferably substantially perpendicular to one broad side of the molecular beam, with a laser beam traveling in a first direction. The laser beam is reflected back through the molecular beam, preferably in a second direction essentially opposite to the first direction. Because the molecules in the beam occupy various degenerate energy levels, if the laser beam comprises chirped pulses comprising selected wavelengths, the laser beam will very efficiently excite substantially all unexcited molecules and will cause stimulated emission of substantially all excited molecules of a selected one of the isotopes in the beam which such pulses encounter. Excitation caused by first direction chirped pulses moves molecules of the isotope excited thereby in the first direction. Stimulated emission of excited molecules of the isotope is brought about by returning chirped pulses traveling in the second direction. Stimulated emission moves emitting molecules in a direction opposite to the photon emitted. Because emitted photons travel in the second direction, emitting molecules move in the first direction. Substantial molecular movement of essentially all the molecules containing the one isotope is accomplished by a large number of chirped pulse-molecule interactions. A beam corer collects the molecules in the resulting enriched divergent portions of the beam

  4. Multi-gel casting apparatus for vertical polyacrylamide gels with in-built solution flow system and liquid level detectors.

    Science.gov (United States)

    Maurye, Praveen; Basu, Arpita; Bandyopadhyay, Tapas Kumar; Biswas, Jayanta Kumar; Mohanty, Bimal Prasana

    2017-08-01

    PAGE is the most widely used technique for the separation and biochemical analysis of biomolecules. The ever growing field of proteomics and genomics necessitates the analysis of many proteins and nucleic acid samples to understand further about the structure and function of cells. Simultaneous analysis of multiple protein samples often requires casting of many PAGE gels. Several variants of multi-gel casting/electrophoresis apparatuses are frequently used in research laboratories. Requirement of supplementary gels to match the growing demand for analyzing additional protein samples sometimes become a cause of concern. Available apparatuses are not amenable to and therefore, not recommended for any modification to accommodate additional gel casting units other than what is prescribed by the manufacturer. A novel apparatus is described here for casting multiple PAGE gels comprising four detachable components that provide enhanced practicability and performance of the apparatus. This newly modified apparatus promises to be a reliable source for making multiple gels in less time without hassle. Synchronized functioning of unique components broaden the possibilities of developing inexpensive, safe, and time-saving multi-gel casting apparatus. This apparatus can be easily fabricated and modified to accommodate desired number of gel casting units. The estimated cost (∼$300) for fabrication of the main apparatus is very competitive and effortless assembly procedure can be completed within ∼30 min. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Method and apparatus for measuring electromagnetic radiation

    Science.gov (United States)

    Been, J. F. (Inventor)

    1973-01-01

    An apparatus and method are described in which the capacitance of a semiconductor junction subjected to an electromagnetic radiation field is utilized to indicate the intensity or strength of the radiation.

  6. Disquisition and technical alteration about TL apparatus

    International Nuclear Information System (INIS)

    Wang Guangxiang; Li Mingliang

    2002-01-01

    The author simply introduces the disadvantage of TL apparatus controlled by single chip. The project uses the PC computer to replace single chip control. So it must be changed the interface and made up a software with Chinese

  7. Apparatus, system, and method for traffic monitoring

    KAUST Repository

    Claudel, Christian G.; Mousa, Mustafa; Abdulaal, Mohammed

    2016-01-01

    An apparatus, system, and method for traffic monitory can have a Lagrangian inertial measurement unit. The Lagrangian inertial measurement unit can have a processor, an accelerometer, a gyroscope, and/or a wireless transmitter. The processor can

  8. 42 CFR 84.74 - Apparatus containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Apparatus containers; minimum requirements. 84.74...-Contained Breathing Apparatus § 84.74 Apparatus containers; minimum requirements. (a) Apparatus may be equipped with a substantial, durable container bearing markings which show the applicant's name, the type...

  9. Report upon inquiry into radiation apparatus

    International Nuclear Information System (INIS)

    1984-10-01

    In this report the committee has provided its assessment of the need and justification for the law to provide for the control of the provision of radiation apparatus, the planning needs for the provision of diagnostic and therapeutic facilities, the location of such facilities, the appropriateness or otherwise of existing legislation, the necessity for any further legislative needs and the criteria governing the provision of such radiation apparatus

  10. Apparatus, System, And Method For Roadway Monitoring

    KAUST Repository

    Claudel, Christian G.

    2015-06-02

    An apparatus, system, and method for monitoring traffic and roadway water conditions. Traffic flow and roadway flooding is monitored concurrently through a wireless sensor network. The apparatus and system comprises ultrasound rangefinders monitoring traffic flow, flood water conditions, or both. Routing information may be calculated from the traffic conditions, such that routes are calculated to avoid roadways that are impassable or are slow due to traffic conditions.

  11. Apparatus for carbonization of bituminous materials

    Energy Technology Data Exchange (ETDEWEB)

    Krupa, G

    1924-08-25

    Apparatus is described for carbonization of bituminous fuels and bituminous shale, in which the material to be carbonized slips continuously over sloping surfaces of a retort arranged in a zigzag and thereby it is exposed to a continuously increasing heating. The apparatus is characterized by the sloping surface being of a boxlike solid hearth with internal heating through which every hearth can be heated directly to a determined constant degree of heat.

  12. Proton imaging apparatus for proton therapy application

    International Nuclear Information System (INIS)

    Sipala, V.; Lo Presti, D.; Brianzi, M.; Civinini, C.; Bruzzi, M.; Scaringella, M.; Talamonti, C.; Bucciolini, M.; Cirrone, G.A.P.; Cuttone, G.; Randazzo, N.; Stancampiano, C.; Tesi, M.

    2011-01-01

    Radiotherapy with protons, due to the physical properties of these particles, offers several advantages for cancer therapy as compared to the traditional radiotherapy and photons. In the clinical use of proton beams, a p CT (Proton Computer Tomography) apparatus can contribute to improve the accuracy of the patient positioning and dose distribution calculation. In this paper a p CT apparatus built by the Prima (Proton Imaging) Italian Collaboration will be presented and the preliminary results will be discussed.

  13. Apparatus, System, And Method For Roadway Monitoring

    KAUST Repository

    Claudel, Christian G.

    2015-01-01

    An apparatus, system, and method for monitoring traffic and roadway water conditions. Traffic flow and roadway flooding is monitored concurrently through a wireless sensor network. The apparatus and system comprises ultrasound rangefinders monitoring traffic flow, flood water conditions, or both. Routing information may be calculated from the traffic conditions, such that routes are calculated to avoid roadways that are impassable or are slow due to traffic conditions.

  14. Continuously rotating cat scanning apparatus and method

    International Nuclear Information System (INIS)

    Bax, R.F.

    1980-01-01

    A tomographic scanner with a continuously rotating source of radiation is energized by converting inertial mechanical energy to electrical energy. The mechanical-to-electrical conversion apparatus is mounted with the x-ray source to be energized on a rotating flywheel. The inertial mechanical energy stored in the rotating conversion apparatus, flywheel and x-ray source is utilized for generating electrical energy used, in turn, to energize the x-ray source

  15. Assembly and handling apparatus for the EBFA Marx generator

    International Nuclear Information System (INIS)

    Staller, G.E.; Hiett, G.E.; Hamilton, I.D.; Aker, M.F.; Daniels, G.A.

    1979-05-01

    Marx generators, a major slow-pulsed power component in Sandia Laboratories' Electron Beam Fusion Accelerator (EBFA), were assembled at a remote facility modified to utilize an assembly-line technique. Due to the size and weight of the various components, as well as the final Marx generator assembly, special handling apparatus was designed. Time and manpower constraints required that this assembly be done in parallel with the construction of the Electron Beam Fusion Facility (EBFF). The completed Marx generators were temporarily stored and then moved from the assembly building to the EBFF using special transportation racks designed specifically for this purpose

  16. Method and apparatus for measuring underground fluid flow characteristics

    International Nuclear Information System (INIS)

    Paap, H.J.; Richter, A.P.; Peelman, H.E.; Arnold, D.M.; Scot, H.D.

    1979-01-01

    This invention relates to the use of neutron activation techniques to measure the azimuth and speed of the horizontal fluid flow in earth formations in the vicinity of a well borehole and the analysis of the resultant gamma radiation based on count rate data obtained as functions of horizontal direction and time. The apparatus consisting of a sonde (a downhole well logging tool) equipped with a neutron source, a gamma detector and a rotatable shield with collimator slot and the data processing equipment located at the surface, are described. (UK)

  17. A study of structure and properties of molecularly thin methanol film using the modified surface forces apparatus.

    Science.gov (United States)

    Zhao, Gutian; Cai, Di; Wu, Gensheng; Tan, Qiyan; Xiang, Li; Zhang, Yin; Xiang, Nan

    2014-11-01

    A novel approach for studying the adsorption and evaporation processes of molecularly thin methanol film by the modified surface forces apparatus (M-SFA) is reported. This method can be used precisely to measure the thickness, morphology, and mechanical properties of the film confined between two mica surfaces in a real-time manner at gas atmosphere. By observing the adsorption and evaporation processes of the methanol molecule, it is found that the first adsorbed layer of the methanol film on the mica surface behaves as a solid-like structure. The thickness of this layer is measured to be about 3.2 Å, approximately equal to the diameter of a methanol molecule. Besides, this first adsorbed layer can carry normalized loads of more than 5.6 atm due to the carrying capacity conserved by the bond of mica-OH. The outer layers of the methanol film are further adsorbed with the increase of the exposure time, which are liquid-like and can be easily eliminated out from the substrate. The present study suggests that the interacting mode between hydroxy and mica is of great potential in material science and biomedical systems. © 2014 Wiley Periodicals, Inc.

  18. Quantum behaviour of measuring apparatus

    International Nuclear Information System (INIS)

    Amri, T.

    2011-05-01

    This thesis explores the quantum behavior of measurement apparatus with illustrations in quantum optics. This is the first study of quantum properties of measurements performed by any kind of devices. We show that the quantum properties of a measurement, such as its projective or non-classical character, are revealed only by the quantum states of an unusual approach of quantum physics: the retrodictive approach. This approach involves retro-predictions about state preparations leading to a given measurement result, contrary to the predictive approach with which we usually make predictions about the results of an experiment. By clarifying the mathematical foundations of the retrodictive approach, we propose a general procedure for reconstructing the quantum states of this approach: the retrodicted states. We have realized these reconstructions for single-photon detectors, widely used in quantum cryptography for instance. This is the first tomography of quantum states totally based on the retrodictive approach and preparation choices, contrary to usual reconstructions based on measurement results. These tomographies enabled us to study experimentally the noise influence on the quantum properties of measurements performed by these detectors, in particular their transition from a strongly quantum behavior into a more classical behavior. Finally, we propose a detector of Schroedinger's Cat states of light, which are superpositions of incompatible quasi-classical states of light. In a modern version of a thought experiment proposed by Eugene Wigner in 1961, such a device could allow the Wigner's Friend to detect a Schroedinger's Cat, contrary to human eyes for which we specify some quantum properties. We generalize the use of such a non-classical detector to an estimation protocol, totally based on the retrodictive approach and preparation choices. Such a procedure could enable optimal estimations, by reaching the quantum Cramer-Rao bound, which is a very topical issue

  19. Improvements to the APEX apparatus

    International Nuclear Information System (INIS)

    Ahmad, I.; Back, B.B.; Betts, R.R.

    1995-01-01

    A number of technical issues led us to rework extensively the APEX apparatus in summer 1994. During the earlier runs, a significant fraction of the 432 silicon detector elements showed degraded resolution such that they had to be excluded from the final analysis in software. The effect of this is to reduce the efficiency of APEX and possibly also to introduce holes in the acceptance which, for some perhaps exotic scenarios, might reduce the acceptance to an unacceptably low level. Also, the energy thresholds below which it is not possible to generate timing information from the silicon detectors, were high enough that the low-energy acceptance of APEX was compromised to a significant extent. The origins of these difficulties were in part due to degraded performance of the silicon detectors themselves, problems with the silicon cooling systems and electronics problems. Both silicon arrays were disassembled and sub-standard detectors replaced, all detectors were also cleaned with the result that all detectors now performed at the specified values of leakage current. The silicon cooling systems were disassembled and rebuilt with the result that many small leaks were fixed. Defective electronics channels were repaired or replaced. The rotating target wheel was also improved with the installation of new bearings and a computer-controlled rotation and readout system. The rebuilt wheel can now run at speeds up to 900 rpm for weeks on end without breakdown. The target wheel and associated beam sweeping now work extremely well so that low-melting-point targets such as Pb and In can be used in quite intense beams without melting

  20. Cask handling method and apparatus

    International Nuclear Information System (INIS)

    Yoli, A.H.; Husain, I.

    1977-01-01

    The method of transferring radioactive material into and out of the cask comprises positioning a tank with an open end in a well. Then a cask having a passage for moving radioactive material into and out of the cask is placed in the tank through the opening in the tank. The tank opening is then sealed to the cask relative to the well without sealing the passage relative to the well to prevent water filled into the well from leaking into the tank. Then the well is filled with water above the seal, and radioactive material is then moved through the water in the well through the passage into the cask. The tank may be filled with demineralized water from a separate source to pressurize the space in the tank on the other side of the seal from the well to prevent water in the well from entering the tank. The water level in the well and in the tank is then lowered, the tank opening to the cask seal is removed, and a cover is attached to the cask passage to maintain the radioactive material and contaminated water in the cask. The apparatus which accomplishes the above method comprises a tank in a well for receiving a cask therein. A seal between the tank and the cask prevents water in the well from flowing into the tank about the cask and permits water in the well to flow through the cask opening into the cask. A first water supply means raises and lowers the water level in the well, and a second water supply means supplies clean demineralized water to the tank under pressure to prevent water in the well from leaking into the tank. The seal is annularly shaped and is attached to the top of the tank. The central portion of the annular seal is aligned with the cask opening and it has means to seal the annular seal to the cask

  1. Radioactive decontamination apparatus and process

    International Nuclear Information System (INIS)

    Jackson, O.L.

    1983-01-01

    Apparatus for removing radioactive contamination from metal objects is disclosed, consisting of three of three separate pieces. The first is an electro- polishing tank, pump and filter assembly, ventilation duct and filter assembly, and DC power supply. The second is a rinse tank and a pump and filter assembly therefor. The third is a divot crane. The electro-polishing tank assembly and the rinse tank assembly are each separately mounted on pallets to facilitate moving. The filter systems of the electro-polishing tank and the rinse tank are designed to remove the radioactive contamination from the fluids in those tanks. Heavy items or highly contaminated items are handled with the divot crane constructed of stainless steel. The electro- polishing tank and the rinse tank are also made of stainless steel. The ventilation system on the electro- polishing tank exhausts acid fumes resulting from the tank heaters and the electro-polishing process. Inside the electro-polishing tank are two swinging arms that carry two stainless steel probes that hang down in the electrolyte fluid. These negative DC probes and are electrically isolated from the tank and the rest of the system. Across the top center of the tank is a copper pipe, which is also electrically isolated from the tank. This is the positive side of the DC system. To decontaminate a metal object, it is suspended from the positive copper pipe, with good electrical contact, into the electrolyte fluid. The negative probes are then moved on their swinging arms to a close proximity to the object being decontaminated, without making contact

  2. Surface Forces Apparatus measurements of interactions between rough and reactive calcite surfaces.

    Science.gov (United States)

    Dziadkowiec, Joanna; Javadi, Shaghayegh; Bratvold, Jon Einar; Nilsen, Ola; Røyne, Anja

    2018-05-28

    Nm-range forces acting between calcite surfaces in water affect macroscopic properties of carbonate rocks and calcite-based granular materials, and are significantly influenced by calcite surface recrystallization. We suggest that the repulsive mechanical effects related to nm-scale surface recrystallization of calcite in water could be partially responsible for the observed decrease of cohesion in calcitic rocks saturated with water. Using the Surface Forces Apparatus (SFA), we simultaneously followed the calcite reactivity and measured the forces in water in two surface configurations: between two rough calcite surfaces (CC), or between rough calcite and a smooth mica surface (CM). We used nm-scale rough, polycrystalline calcite films prepared by Atomic Layer Deposition (ALD). We measured only repulsive forces in CC in CaCO 3 -saturated water, which was related to roughness and possibly to repulsive hydration effects. Adhesive or repulsive forces were measured in CM in CaCO 3 -saturated water depending on calcite roughness, and the adhesion was likely enhanced by electrostatic effects. The pull-off adhesive force in CM became stronger with time and this increase was correlated with a decrease of roughness at contacts, which parameter could be estimated from the measured force-distance curves. That suggested a progressive increase of real contact areas between the surfaces, caused by gradual pressure-driven deformation of calcite surface asperities during repeated loading-unloading cycles. Reactivity of calcite was affected by mass transport across nm to µm-thick gaps between the surfaces. Major roughening was observed only for the smoothest calcite films, where gaps between two opposing surfaces were nm-thick over µm-sized areas, and led to force of crystallization that could overcome confining pressures of the order of MPa. Any substantial roughening of calcite caused a significant increase of the repulsive mechanical force contribution.

  3. Hydraulic Apparatus for Mechanical Testing of Nuts

    Science.gov (United States)

    Hinkel, Todd J.; Dean, Richard J.; Hacker, Scott C.; Harrington, Douglas W.; Salazar, Frank

    2004-01-01

    The figure depicts an apparatus for mechanical testing of nuts. In the original application for which the apparatus was developed, the nuts are of a frangible type designed for use with pyrotechnic devices in spacecraft applications in which there are requirements for rapid, one-time separations of structures that are bolted together. The apparatus can also be used to test nonfrangible nuts engaged without pyrotechnic devices. This apparatus was developed to replace prior testing systems that were extremely heavy and immobile and characterized by long setup times (of the order of an hour for each nut to be tested). This apparatus is mobile, and the setup for each test can now be completed in about five minutes. The apparatus can load a nut under test with a static axial force of as much as 6.8 x 10(exp 5) lb (3.0 MN) and a static moment of as much as 8.5 x 10(exp 4) lb in. (9.6 x 10(exp 3) N(raised dot)m) for a predetermined amount of time. In the case of a test of a frangible nut, the pyrotechnic devices can be exploded to break the nut while the load is applied, in which case the breakage of the nut relieves the load. The apparatus can be operated remotely for safety during an explosive test. The load-generating portion of the apparatus is driven by low-pressure compressed air; the remainder of the apparatus is driven by 110-Vac electricity. From its source, the compressed air is fed to the apparatus through a regulator and a manually operated valve. The regulated compressed air is fed to a pneumatically driven hydraulic pump, which pressurizes oil in a hydraulic cylinder, thereby causing a load to be applied via a hydraulic nut (not to be confused with the nut under test). During operation, the hydraulic pressure is correlated with the applied axial load, which is verified by use of a load cell. Prior to operation, one end of a test stud (which could be an ordinary threaded rod or bolt) is installed in the hydraulic nut. The other end of the test stud passes

  4. A simple apparatus for measuring the blood urea, manufactured by Dr. Luigj Benusi in 1943 in Albania

    OpenAIRE

    Tartari, Flamur; Buzo, Stiliano; Vyshka, Gentian

    2009-01-01

    The apparatus invented by Dr. Luigj Benusi in 1943, in Tirana, was a practical application of the Kowarsky technique and Ambard laws, helping in determining blood urea levels and very important to a variety of diseases, mainly kidney disorders. The apparatus was invented and prepared from very simple laboratory materials, such as glasses, test tubes, corks and volumetric cylinders. Technologically, it was based upon the determination of blood urea through hypobromite, and, among the advantage...

  5. Design of neutral particle incident heating apparatus for large scale helical apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Kaneko, Osamu; Oka, Yoshihide; Osakabe, Masaki; Takeiri, Yasuhiko; Tsumori, Katsuyoshi; Akiyama, Ryuichi; Asano, Eiji; Kawamoto, Toshikazu; Kuroda, Tsutomu [National Inst. for Fusion Science, Nagoya (Japan)

    1997-02-01

    In the Institute of Nuclear Fusion Science, construction of the large scale helical apparatus has been progressed favorably, and constructions of the heating apparatus as well as of electron resonance apparatus were begun in their orders under predetermined manner since 1994 fiscal year. And, on 1995 fiscal year, construction of neutral particle incident heating apparatus, leading heat apparatus, was begun under 3 years planning. The plasma heating study system adopted the study results developed in this institute through the large scale hydrogen negative ion source and also adopted thereafter development on nuclear fusion study by modifying the original specification set at the beginning of the research plan before 7 years. As a result, system design was changed from initial 125 KeV to 180 KeV in the beam energy and to execute 15 MW incidence using two sets beam lines, to begin its manufacturing. Here is described on its new design with reason of its modifications. (G.K.)

  6. Technical note: CT-guided biopsy of lung masses using an automated guiding apparatus

    International Nuclear Information System (INIS)

    Chellathurai, Amarnath; Kanhirat, Saneej; Chokkappan, Kabilan; Swaminathan, Thiruchendur S; Kulasekaran, Nadhamuni

    2009-01-01

    Automated guiding apparatuses for CT-guided biopsies are now available. We report our experience with an indigenous system to guide lung biopsies. This system gave results similar to those with the manual technique. Automated planning also appears to be technically easier, it requires fewer number of needle passes, consumes less time, and requires fewer number of check scans

  7. The standardization of an apparatus for the mixing of soil samples ...

    African Journals Online (AJOL)

    Quantitative determination of nematode populations in soils frequently necessitates the mixing of representative soil samples to form a homogeneous, compound sample from which the nematodes are extracted. A mixing apparatus was developed and standardized with the aid of a spectrophotometric technique by which ...

  8. Matrix isolation sublimation: An apparatus for producing cryogenic beams of atoms and molecules

    Energy Technology Data Exchange (ETDEWEB)

    Sacramento, R. L.; Alves, B. X.; Silva, B. A.; Wolff, W.; Cesar, C. L. [Instituto de Física, Universidade Federal do Rio de Janeiro, Caixa Postal 68528, 21941-972 Rio de Janeiro, RJ (Brazil); Oliveira, A. N. [Instituto de Física, Universidade Federal do Rio de Janeiro, Caixa Postal 68528, 21941-972 Rio de Janeiro, RJ (Brazil); INMETRO, Av. Nossa Senhora das Graças, 50 25250-020 Duque de Caxias, RJ (Brazil); Li, M. S. [Instituto de Física de São Carlos, Universidade de São Paulo, Ave. Trabalhador São Carlense, 400, 13565-590 São Carlos, SP (Brazil)

    2015-07-15

    We describe the apparatus to generate cryogenic beams of atoms and molecules based on matrix isolation sublimation. Isolation matrices of Ne and H{sub 2} are hosts for atomic and molecular species which are sublimated into vacuum at cryogenic temperatures. The resulting cryogenic beams are used for high-resolution laser spectroscopy. The technique also aims at loading atomic and molecular traps.

  9. A Study on Test Technology to Diagnose the Power Apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Kim, K H; Kang, Y S; Jeon, Y K; Lee, W Y; Kang, D S; Kyu, H S; Sun, J H; Jo, K H [Korea Electrotechnology Research Institute (Korea, Republic of); Jung, J S; Mun, Y T; Lee, K H; Jung, E H; Kim, J H [Korea Water Resources Corporation (Korea, Republic of)

    1997-02-01

    In this study, we have educated KOWACO(Korea Water Resources Corporation) specialists about the insulation diagnostic technology and trained them the insulation diagnostic test and estimation method of power apparatus. The main results of this study are as follows; A. Education of basic high-voltage engineering. B. Research of insulation characteristic and deterioration mechanism in power apparatus C. Discussion on high-voltage test standard specifications. D. Study on insulation deterioration diagnostics in power apparatus. E. Field testing of insulation diagnosis in power apparatus. F. Engineering of insulation diagnostic testing apparatus to diagnose power apparatus. KOWACO specialists are able to diagnose insulation diagnostic test of power apparatus through this study. As they have instruments to diagnose power apparatus, they can do the test and estimation of the power apparatus insulation diagnosis. (author). refs., figs., tabs.

  10. Continuous culture apparatus and methodology

    International Nuclear Information System (INIS)

    Conway, H.L.

    1975-01-01

    At present, we are investigating the sorption of potentially toxic trace elements by phytoplankton under controlled laboratory conditions. Continuous culture techniques were used to study the mechanism of the sorption of the trace elements by unialgal diatom populations and the factors influencing this sorption. Continuous culture methodology has been used extensively to study bacterial kinetics. It is an excellent technique for obtaining a known physiological state of phytoplankton populations. An automated method for the synthesis of continuous culture medium for use in these experiments is described

  11. Tomographic apparatus for reconstructing planar slices from non-absorbed and non-scattered radiation

    International Nuclear Information System (INIS)

    1980-01-01

    After briefly reviewing the history of computerised tomography, the deficiencies inherent in the various methods that have been adopted are discussed, e.g. slow data collection time, blurring of images and poor spatial resolution. Tomographic apparatus and processing methods are then described which can overcome these problems. The apparatus consists of a fan-shaped source of X-rays and a detector array which both rotate around the patient being examined. The data reduction process is derived in great detail; it is claimed that digital processing using convolution techniques is much faster than conventional methods. (U.K.)

  12. A portable X-ray diffraction apparatus for in situ analyses of masters' paintings

    International Nuclear Information System (INIS)

    Eveno, Myriam; Duran, Adrian; Castaing, Jacques

    2010-01-01

    It is rare that the analyses of materials in paintings can be carried out by taking micro-samples. Valuable works of art are best studied in situ by non-invasive techniques. For that purpose, a portable X-ray diffraction and fluorescence apparatus has been designed and constructed at the C2RMF. This apparatus has been used for paintings of Rembrandt, Leonardo da Vinci, Van Gogh, Mantegna, etc. Results are given to illustrate the performance of X-ray diffraction, especially when X-ray fluorescence does not bring sufficient information to conclude. (orig.)

  13. Development of an apparatus to measure thermophysical properties of wind tunnel heat transfer models

    Science.gov (United States)

    Romanowski, R. F.; Steinberg, I. H.

    1974-01-01

    The apparatus and technique for measuring the thermophysical properties of models used with the phase-change paint method for obtaining wind tunnel heat transfer data are described. The method allows rapid measurement of the combined properties in a transient manner similar to an actual wind tunnel test. An effective value of the thermophysical properties can be determined which accounts for changes in thermal properties with temperature or with depth into the model surface. The apparatus was successfully tested at various heating rates between 19,000 and 124,000 watts per square meter.

  14. A portable X-ray diffraction apparatus for in situ analyses of masters' paintings

    Science.gov (United States)

    Eveno, Myriam; Duran, Adrian; Castaing, Jacques

    2010-09-01

    It is rare that the analyses of materials in paintings can be carried out by taking micro-samples. Valuable works of art are best studied in situ by non-invasive techniques. For that purpose, a portable X-ray diffraction and fluorescence apparatus has been designed and constructed at the C2RMF. This apparatus has been used for paintings of Rembrandt, Leonardo da Vinci, Van Gogh, Mantegna, etc. Results are given to illustrate the performance of X-ray diffraction, especially when X-ray fluorescence does not bring sufficient information to conclude.

  15. BROACHING AND TUBE-INSTALLING APPARATUS

    Science.gov (United States)

    Frantz, C.E.; Cawley, W.E.

    1961-05-16

    An apparatus is given for sizing long holes in graphite bodies. The apparatus comprises a shaft having 3 spiral broach cutting elements and a straight broach cutting element rotatably mounted thereon. The broach cutting elements are keyed to each other in end to end relationship with the straight broach cutting element at one end of the shaft. The spiral broach cutting elements when considered toward the straight broach cutting element increase in diameter and the cutting teeth thereon increase in lead angle. The straight broach cutting element, when considered in the same direction, increases in diameter from the minimum to maximum diameters of the spiral broach cutting elements. No longitudinal movement of the broach cutting elements is permitted on the shsft snd means are provided for the removal of chips from the apparatus.

  16. Superconducting magnetic shielding apparatus and method

    Science.gov (United States)

    Clem, John R.; Clem, John R.

    1983-01-01

    Disclosed is a method and apparatus for providing magnetic shielding around a working volume. The apparatus includes a hollow elongated superconducting shell or cylinder having an elongated low magnetic pinning central portion, and two high magnetic pinning end regions. Transition portions of varying magnetic pinning properties are interposed between the central and end portions. The apparatus further includes a solenoid substantially coextensive with and overlying the superconducting cylinder, so as to be magnetically coupled therewith. The method includes the steps passing a longitudinally directed current through the superconducting cylinder so as to depin magnetic reservoirs trapped in the cylinder. Next, a circumferentially directed current is passed through the cylinder, while a longitudinally directed current is maintained. Depinned magnetic reservoirs are moved to the end portions of the cylinder, where they are trapped.

  17. Superconducting magnetic shielding apparatus and method

    Science.gov (United States)

    Clem, J.R.

    1982-07-09

    Disclosed is a method and apparatus for providing magnetic shielding around a working volume. The apparatus includes a hollow elongated superconducting shell or cylinder having an elongated low magnetic pinning central portion, and two high magnetic pinning end regions. Transition portions of varying magnetic pinning properties are interposed between the central and end portions. The apparatus further includes a solenoid substantially coextensive with and overlying the superconducting cylinder, so as to be magnetically coupled therewith. The method includes the steps passing a longitudinally directed current through the superconducting cylinder so as to depin magnetic reservoirs trapped in the cylinder. Next, a circumferentially directed current is passed through the cylinder, while a longitudinally directed current is maintained. Depinned magnetic reservoirs are moved to the end portions of the cylinder, where they are trapped.

  18. Uranium dioxide calcining apparatus and method

    International Nuclear Information System (INIS)

    Cole, E.A.; Peterson, R.S.

    1978-01-01

    This invention relates to an improved continuous calcining apparatus for consistently and controllably producing from calcinable reactive solid compounds of uranium, such as ammonium diuranate, uranium dioxide (UO 2 ) having an oxygen to uranium ratio of less than 2.2. The apparatus comprises means at the outlet end of a calciner kiln for receiving hot UO 2 , means for cooling the UO 2 to a temperature of below 100 0 C and conveying the cooled UO 2 to storage or to subsequent UO 2 processing apparatus where it finally comes into contact with air, the means for receiving, cooling and conveying being sealed to the outlet end of the calciner and being maintained full of UO 2 and so operable as to exclude atmospheric oxygen from coming into contact with any UO 2 which is at elevated temperatures where it would readily oxidize, without the use of extra hydrogen gas in said means

  19. CFT and RTD methods for wastewater treatment plants apparatus investigation

    International Nuclear Information System (INIS)

    Palige, J.; Owczarczyk, A.; Dobrowolski, A.; Ptaszek, S.

    2006-01-01

    Two methods, residence time distributions (RTD) and computational fluid dynamics (CFD) are most effective for solid and wastewater phases investigations of flow dynamics. On the basis of measured (in tracer experiment) RTD function, the model of flow can be proposed for the unit under investigation. The experimental and numerical RTD functions were compared for different technological parameters values of processes (apparatus geometry, flow rate, location and construction of input and output). Numerical RTD function was obtained by DRW (discrete random walk) technique - determination of residence times of many liquid particles. The usefulness of these techniques was checked on a large scale laboratory model of settler. Satisfactory agreement of the data obtained by both methods - tracer and CFD - was observed

  20. Apparatus for controlling nuclear core debris

    International Nuclear Information System (INIS)

    Jones, R.D.

    1978-01-01

    Disclosed is an apparatus for containing, cooling, and dispersing reactor debris assumed to flow from the core area in the unlikely event of an accident causing core meltdown. The apparatus includes a plurality of horizontally disposed vertically spaced plates, having depressions to contain debris in controlled amounts, and a plurality of holes therein which provide natural circulation cooling and a path for debris to continue flowing downward to the plate beneath. The uppermost plates may also include generally vertical sections which form annular-like flow areas which assist the natural circulation cooling

  1. Apparatus for isotopic alteration of mercury vapor

    Science.gov (United States)

    Grossman, Mark W.; George, William A.; Marcucci, Rudolph V.

    1988-01-01

    An apparatus for enriching the isotopic Hg content of mercury is provided. The apparatus includes a reactor, a low pressure electric discharge lamp containing a fill including mercury and an inert gas. A filter is arranged concentrically around the lamp. In a preferred embodiment, constant mercury pressure is maintained in the filter by means of a water-cooled tube that depends from it, the tube having a drop of mercury disposed in it. The reactor is arranged around the filter, whereby radiation from said lamp passes through the filter and into said reactor. The lamp, the filter and the reactor are formed of a material which is transparent to ultraviolet light.

  2. Apparatus for controlling nuclear core debris

    Science.gov (United States)

    Jones, Robert D.

    1978-01-01

    Nuclear reactor apparatus for containing, cooling, and dispersing reactor debris assumed to flow from the core area in the unlikely event of an accident causing core meltdown. The apparatus includes a plurality of horizontally disposed vertically spaced plates, having depressions to contain debris in controlled amounts, and a plurality of holes therein which provide natural circulation cooling and a path for debris to continue flowing downward to the plate beneath. The uppermost plates may also include generally vertical sections which form annular-like flow areas which assist the natural circulation cooling.

  3. Apparatus for controlling molten core debris

    International Nuclear Information System (INIS)

    Golden, M.P.; Tilbrook, R.W.; Heylmun, N.F.

    1972-01-01

    Disclosed is an apparatus for containing, cooling, diluting, dispersing and maintaining subcritical the molten core debris assumed to melt through the bottom of a nuclear reactor pressure vessel in the unlikely event of a core meltdown. The apparatus is basically a sacrificial bed system which includes an inverted conical funnel, a core debris receptacle including a spherical dome, a spherically layered bed of primarily magnesia bricks, a cooling system of zig-zag piping in graphite blocks about and below the bed and a cylindrical liner surrounding the graphite blocks including a steel shell surrounded by firebrick. Tantalum absorber rods are used in the receptacle and bed. 9 claims, 22 figures

  4. Realtime radiation exposure monitor and control apparatus

    International Nuclear Information System (INIS)

    Cowart, R.W.

    1981-01-01

    This patent application relates to an apparatus and methods used to obtain image information from modulation of a uniform flux. An exposure measuring apparatus is disclosed which comprises a multilayered detector structure having an external circuit connected to a transparent insulating layer and to a conductive plate a radiation source adapted to irradiate the detector structure with radiation capable of producing electron-hole pairs in a photoconductive layer of the detector wherein the flow of current within the external circuit is measured when the detector is irradiated by the radiation source. (author)

  5. Methods and apparatus for controlling rotary machines

    Science.gov (United States)

    Bagepalli, Bharat Sampathkumaran [Niskayuna, NY; Jansen, Patrick Lee [Scotia, NY; Barnes, Gary R [Delanson, NY; Fric, Thomas Frank [Greer, SC; Lyons, James Patrick Francis [Niskayuna, NY; Pierce, Kirk Gee [Simpsonville, SC; Holley, William Edwin [Greer, SC; Barbu, Corneliu [Guilderland, NY

    2009-09-01

    A control system for a rotary machine is provided. The rotary machine has at least one rotating member and at least one substantially stationary member positioned such that a clearance gap is defined between a portion of the rotating member and a portion of the substantially stationary member. The control system includes at least one clearance gap dimension measurement apparatus and at least one clearance gap adjustment assembly. The adjustment assembly is coupled in electronic data communication with the measurement apparatus. The control system is configured to process a clearance gap dimension signal and modulate the clearance gap dimension.

  6. Apparatuses and methods for generating electric fields

    Science.gov (United States)

    Scott, Jill R; McJunkin, Timothy R; Tremblay, Paul L

    2013-08-06

    Apparatuses and methods relating to generating an electric field are disclosed. An electric field generator may include a semiconductive material configured in a physical shape substantially different from a shape of an electric field to be generated thereby. The electric field is generated when a voltage drop exists across the semiconductive material. A method for generating an electric field may include applying a voltage to a shaped semiconductive material to generate a complex, substantially nonlinear electric field. The shape of the complex, substantially nonlinear electric field may be configured for directing charged particles to a desired location. Other apparatuses and methods are disclosed.

  7. Apparatus for handling control rod drives

    International Nuclear Information System (INIS)

    Akimoto, A.; Watanabe, M.; Yoshida, T.; Sugaya, Z.; Saito, T.; Ishii, Y.

    1979-01-01

    An apparatus for handling control rod drives (CRD's) attached by detachable fixing means to housings mounted in a reactor pressure vessel and each coupled to one of control rods inserted in the reactor pressure vessel is described. The apparatus for handling the CRD's comprise cylindrical housing means, uncoupling means mounted in the housing means for uncoupling each of the control rods from the respective CRD, means mounted on the housing means for effecting attaching and detaching of the fixing means, means for supporting the housing means, and means for moving the support means longitudinally of the CRD

  8. Apparatus for extracting and sequestering carbon dioxide

    Science.gov (United States)

    Rau, Gregory H [Castro Valley, CA; Caldeira, Kenneth G [Livermore, CA

    2010-02-02

    An apparatus and method associated therewith to extract and sequester carbon dioxide (CO.sub.2) from a stream or volume of gas wherein said apparatus hydrates CO.sub.2 and reacts the resulting carbonic acid with carbonate. Suitable carbonates include, but are not limited to, carbonates of alkali metals and alkaline earth metals, preferably carbonates of calcium and magnesium. Waste products are metal cations and bicarbonate in solution or dehydrated metal salts, which when disposed of in a large body of water provide an effective way of sequestering CO.sub.2 from a gaseous environment.

  9. Two-dimensional heat flow apparatus

    Science.gov (United States)

    McDougall, Patrick; Ayars, Eric

    2014-06-01

    We have created an apparatus to quantitatively measure two-dimensional heat flow in a metal plate using a grid of temperature sensors read by a microcontroller. Real-time temperature data are collected from the microcontroller by a computer for comparison with a computational model of the heat equation. The microcontroller-based sensor array allows previously unavailable levels of precision at very low cost, and the combination of measurement and modeling makes for an excellent apparatus for the advanced undergraduate laboratory course.

  10. Programmers for diagnostic x-ray apparatus

    International Nuclear Information System (INIS)

    1981-01-01

    Novel apparatus is described for providing a pre-programmed selection of various parameters in X-ray radiography. The equipment consists of push-buttons which prompt the radiographer to make decisions such as thickness of patient, part of the anatomy to be X-rayed etc. From these data the apparatus selects the appropriate parameters such as H.T. voltage, current, product of current and irradiation time etc. The values of these parameters are displayed to the radiographer and facilities are provided to override the programmed parameters at the radiographer's discretion. (U.K.)

  11. Apparatus and process for controlling fluidized beds

    Science.gov (United States)

    Rehmat, Amirali G.; Patel, Jitendra G.

    1985-10-01

    An apparatus and process for control and maintenance of fluidized beds under non-steady state conditions. An ash removal conduit is provided for removing solid particulates from a fluidized bed separate from an ash discharge conduit in the lower portion of the grate supporting such a bed. The apparatus and process of this invention is particularly suitable for use in ash agglomerating fluidized beds and provides control of the fluidized bed before ash agglomeration is initiated and during upset conditions resulting in stable, sinter-free fluidized bed maintenance.

  12. Purged window apparatus utilizing heated purge gas

    Science.gov (United States)

    Ballard, Evan O.

    1984-01-01

    A purged window apparatus utilizing tangentially injected heated purge gases in the vicinity of electromagnetic radiation transmitting windows, and a tapered external mounting tube to accelerate these gases to provide a vortex flow on the window surface and a turbulent flow throughout the mounting tube. Use of this apparatus prevents backstreaming of gases under investigation which are flowing past the mouth of the mounting tube which would otherwise deposit on the windows. Lengthy spectroscopic investigations and analyses can thereby be performed without the necessity of interrupting the procedures in order to clean or replace contaminated windows.

  13. Method and apparatus for combinatorial chemistry

    Science.gov (United States)

    Foote, Robert S [Oak Ridge, TN

    2012-06-05

    A method and apparatus are provided for performing light-directed reactions in spatially addressable channels within a plurality of channels. One aspect of the invention employs photoactivatable reagents in solutions disposed into spatially addressable flow streams to control the parallel synthesis of molecules immobilized within the channels. The reagents may be photoactivated within a subset of channels at the site of immobilized substrate molecules or at a light-addressable site upstream from the substrate molecules. The method and apparatus of the invention find particularly utility in the synthesis of biopolymer arrays, e.g., oligonucleotides, peptides and carbohydrates, and in the combinatorial synthesis of small molecule arrays for drug discovery.

  14. Long-duration heat load measurement approach by novel apparatus design and highly efficient algorithm

    Science.gov (United States)

    Zhu, Yanwei; Yi, Fajun; Meng, Songhe; Zhuo, Lijun; Pan, Weizhen

    2017-11-01

    Improving the surface heat load measurement technique for vehicles in aerodynamic heating environments is imperative, regarding aspects of both the apparatus design and identification efficiency. A simple novel apparatus is designed for heat load identification, taking into account the lessons learned from several aerodynamic heating measurement devices. An inverse finite difference scheme (invFDM) for the apparatus is studied to identify its surface heat flux from the interior temperature measurements with high efficiency. A weighted piecewise regression filter is also proposed for temperature measurement prefiltering. Preliminary verification of the invFDM scheme and the filter is accomplished via numerical simulation experiments. Three specific pieces of apparatus have been concretely designed and fabricated using different sensing materials. The aerodynamic heating process is simulated by an inductively coupled plasma wind tunnel facility. The identification of surface temperature and heat flux from the temperature measurements is performed by invFDM. The results validate the high efficiency, reliability and feasibility of heat load measurements with different heat flux levels utilizing the designed apparatus and proposed method.

  15. The design of high-temperature thermal conductivity measurements apparatus for thin sample size

    Directory of Open Access Journals (Sweden)

    Hadi Syamsul

    2017-01-01

    Full Text Available This study presents the designing, constructing and validating processes of thermal conductivity apparatus using steady-state heat-transfer techniques with the capability of testing a material at high temperatures. This design is an improvement from ASTM D5470 standard where meter-bars with the equal cross-sectional area were used to extrapolate surface temperature and measure heat transfer across a sample. There were two meter-bars in apparatus where each was placed three thermocouples. This Apparatus using a heater with a power of 1,000 watts, and cooling water to stable condition. The pressure applied was 3.4 MPa at the cross-sectional area of 113.09 mm2 meter-bar and thermal grease to minimized interfacial thermal contact resistance. To determine the performance, the validating process proceeded by comparing the results with thermal conductivity obtained by THB 500 made by LINSEIS. The tests showed the thermal conductivity of the stainless steel and bronze are 15.28 Wm-1K-1 and 38.01 Wm-1K-1 with a difference of test apparatus THB 500 are −2.55% and 2.49%. Furthermore, this apparatus has the capability to measure the thermal conductivity of the material to a temperature of 400°C where the results for the thermal conductivity of stainless steel is 19.21 Wm-1K-1 and the difference was 7.93%.

  16. Long-duration heat load measurement approach by novel apparatus design and highly efficient algorithm

    International Nuclear Information System (INIS)

    Zhu, Yanwei; Yi, Fajun; Meng, Songhe; Zhuo, Lijun; Pan, Weizhen

    2017-01-01

    Improving the surface heat load measurement technique for vehicles in aerodynamic heating environments is imperative, regarding aspects of both the apparatus design and identification efficiency. A simple novel apparatus is designed for heat load identification, taking into account the lessons learned from several aerodynamic heating measurement devices. An inverse finite difference scheme (invFDM) for the apparatus is studied to identify its surface heat flux from the interior temperature measurements with high efficiency. A weighted piecewise regression filter is also proposed for temperature measurement prefiltering. Preliminary verification of the invFDM scheme and the filter is accomplished via numerical simulation experiments. Three specific pieces of apparatus have been concretely designed and fabricated using different sensing materials. The aerodynamic heating process is simulated by an inductively coupled plasma wind tunnel facility. The identification of surface temperature and heat flux from the temperature measurements is performed by invFDM. The results validate the high efficiency, reliability and feasibility of heat load measurements with different heat flux levels utilizing the designed apparatus and proposed method. (paper)

  17. A simple apparatus for measuring the blood urea, manufactured by Dr. Luigj Benusi in 1943 in Albania.

    Science.gov (United States)

    Tartari, Flamur; Buzo, Stiliano; Vyshka, Gentian

    2009-01-01

    The apparatus invented by Dr. Luigj Benusi in 1943, in Tirana, was a practical application of the Kowarsky technique and Ambard laws, helping in determining blood urea levels and very important to a variety of diseases, mainly kidney disorders. The apparatus was invented and prepared from very simple laboratory materials, such as glasses, test tubes, corks and volumetric cylinders. Technologically, it was based upon the determination of blood urea through hypobromite, and, among the advantages of the apparatus of Benusi, were its extreme simplicity, the smaller amount of blood needed for producing results (2 milliliters), as well as an easiest way to clean up and to manage the apparatus from a practical point of everyday use.

  18. Apparatuses, Systems and Methods for Cleaning Photovoltaic Devices

    KAUST Repository

    Eitelhuber, Georg

    2013-01-01

    Embodiments of solar panel cleaning apparatuses, solar panel cleaning systems, and solar panel cleaning methods are disclosed. In certain embodiments, the disclosed solar panel cleaning apparatuses, systems and methods do may not require any water

  19. Apparatus and method for radiation processing of materials

    International Nuclear Information System (INIS)

    Neuberg, W.B.; Luniewski, R.

    1983-01-01

    A method and apparatus for radiation degradation processing of polytetrafluoroethylene makes use of a simultaneous irradiation, agitation and cooling. The apparatus is designed to make efficent use of radiation in the processing. (author)

  20. Self contained compressed air breathing apparatus to facilitate personnel decontamination

    Energy Technology Data Exchange (ETDEWEB)

    McDonald, C W [Radiological and Safety Division, Atomic Energy Establishment, Winfrith, Dorchester, Dorset (United Kingdom)

    1963-11-15

    This report describes the modification of a Self Contained Compressed Air Breathing Apparatus to provide extended respiratory protection to grossly contaminated personnel during a decontamination period which may exceed the duration of the Breathing Apparatus air supply. (author)

  1. Self contained compressed air breathing apparatus to facilitate personnel decontamination

    International Nuclear Information System (INIS)

    McDonald, C.W.

    1963-11-01

    This report describes the modification of a Self Contained Compressed Air Breathing Apparatus to provide extended respiratory protection to grossly contaminated personnel during a decontamination period which may exceed the duration of the Breathing Apparatus air supply. (author)

  2. X-ray filtration apparatus

    International Nuclear Information System (INIS)

    Thompson, G.

    1992-01-01

    This invention relates to an X-ray shielding support device. In spite of considerable development in X-ray taking techniques, a need still exists for effective shielding, inter alia, to compensate for variations in the thickness, density and the absorption properties of the object being studied. By appropriate shielding, the X-ray image produced is of sufficient detail, contrast and intensity over its entire area to constitute a useful diagnostic aid. It is also desirable to subject the patient to the smallest possible X-ray dosage. 4 figs

  3. Method and apparatus for calibrating spectrophotometers

    NARCIS (Netherlands)

    Schreutelkamp, F.H.

    2003-01-01

    The present invention relates to a method of calibrating spectrophotometers by placing one or more filters in the light path of the spectrophotometer and measuring the amount of radiation by means of a detector. The present invention furthermore relates to an apparatus to be used with such a method.

  4. Process and apparatus for controlling control rods

    International Nuclear Information System (INIS)

    Gebelin, B.; Couture, R.

    1987-01-01

    This process and apparatus is characterized by 2 methods, for examination of cluster of nuclear control rods. Foucault current analyzer which examines fraction by fraction all the control rods. This examination is made by rotation of the cluster. Doubtful rods are then analysed by ultrasonic probe [fr

  5. Apparatus for distillation of bituminous material

    Energy Technology Data Exchange (ETDEWEB)

    Carthaus, E; von Rittersberg, K; Abraham, A

    1917-05-03

    Apparatus for dry distillation of bituminous material, such as oil shale and brown coal with simultaneous fractional separation of the distillate, consists in the fact, that the domed water-cooled condenser, arranged above the conveyer carrying it, is divided by double vertical partitions in the chamber.

  6. Apparatus and method for reconstructing data

    International Nuclear Information System (INIS)

    1981-01-01

    A method and apparatus is described for constructing a two-dimensional picture of an object slice from linear projections of radiation not absorbed or scattered by the object, using convolution methods of data reconstruction, useful in the fields of medical radiology, microscopy, and non-destructive testing. (U.K.)

  7. Filter apparatus for actively reducing noise

    NARCIS (Netherlands)

    Berkhoff, Arthur P.; Nijsse, G.

    2010-01-01

    A filter apparatus for reducing noise from a primary noise source, comprising a secondary source signal connector for generating secondary noise to reduce said primary noise and a sensor connector for connecting to a sensor for measuring said primary and secondary noise as an error signal. A first

  8. A filter apparatus for actively reducing noise

    NARCIS (Netherlands)

    Berkhoff, Arthur P.; Nijsse, G.

    2006-01-01

    A filter apparatus for reducing noise from a primary noise source, comprising a secondary source signal connector for generating secondary noise to reduce said primary noise and a sensor connector for connecting to a sensor for measuring said primary and secondary noise as an error signal. A first

  9. Kinematic X-Ray Analysis Apparatus

    NARCIS (Netherlands)

    Koningsberger, D.C.; Brinkgreve, P.

    1983-01-01

    In an X-ray analysis apparatus, a moving mechanism is provided by a main guide member along which a main slide device can be displaced. Rotatably connected with the main slide device is a detector guide member along which a detection slide device is displaced. The main slide device, as well as the

  10. Apparatus for measurement of tree core density

    International Nuclear Information System (INIS)

    Blincow, D.W.

    1975-01-01

    Apparatus is described for direct measurement of the density of a core sample from a tree. A radiation source and detector with a receptacle for the core therebetween, an integrator unit for the detector output, and an indicating meter driven by the integrator unit are described

  11. Status of the LHCf apparatus at LHC

    CERN Document Server

    Bonechi, L; Bongi, M; Castellini, G; D’Alessandro, R; Faus, A; Fukui, K; Haguenauer, M; Itow, Y; Kasahara, K; Macina, D; Mase, T; Masuda, K; Matsubara, Y; Menjo, H; Mizuishi, M; Muraki, Y; Papini, P; Perrot, A L; Ricciarini, S; Sako, T; Shimizu, Y; Taki, K; Tamura, T; Torii, S; Tricomi, A; Turner, W C; Velasco, J; Viciani, A; Yoshida, K

    2009-01-01

    The LHCf experiment at the LHC accelerator is ready for data taking. Both the LHCf detectors have been successfully tested and installed in their running configuration. The status of the apparatus, control software and some results of the last beam test at the SPS accelerator are presented in this work.

  12. Electrolytic plating apparatus for discrete microsized particles

    International Nuclear Information System (INIS)

    Mayer, A.

    1976-01-01

    Method and apparatus are disclosed for electrolytically producing very uniform coatings of a desired material on discrete microsized particles. Agglomeration or bridging of the particles during the deposition process is prevented by imparting a sufficiently random motion to the particles that they are not in contact with a powered cathode for a time sufficient for such to occur. 4 claims, 2 figures

  13. Portable apparatus for measurement of nuclear radiation

    International Nuclear Information System (INIS)

    Whitlock, G.D.

    1975-01-01

    The apparatus described is stated to be particularly applicable to the measurement of tritium contamination of a surface, although it may have other applications to the determination of radioactivity on surfaces. The mean range of a tritium β particle in air at normal atmospheric pressure is only 1.5 mm. and when monitoring such radiation with the apparatus it is necessary to exclude light. The apparatus comprises a plastic scintillator sheet located in the base of a housing, with a sealing ring mounted in the base so as to make a hermetic and light-tight seal between a support surface and the base of the housing. Photomultiplier means are optically coupled to the scintillator sheet to detect and amplify the scintillations, and a pump device is provided to reduce the air pressure in the vicinity of the sheet to below atmospheric pressure. The scintillator sheet and the photomultiplier means are movable as one unit within the housing, the unit being arranged to be acted upon by atmospheric pressure so as to move the unit into an operative position against a spring when the air pressure in the vicinity of the sheet is reduced to below atmospheric pressure. A shutter is provided to prevent exposure of the scintillator sheet to light when the apparatus is not in use. (U.K.)

  14. Apparatus for combining oxygen and hydrogen

    International Nuclear Information System (INIS)

    Betz, E.C.

    1977-01-01

    An apparatus is described for catalytically combining hydrogen and oxygen which includes two concentric catalyst chambers arranged so that the outer chamber surrounds the inner chamber and the gas stream passes radially through the outer catalyst chamber. 10 claims, 2 figures

  15. Process and apparatus for conversion of biomass

    NARCIS (Netherlands)

    Bakker, R.R.C.; Hazewinkel, J.H.O.; Groenestijn, van J.W.

    2006-01-01

    The invention is directed to a process for the conversion of cellulosic biomass, in particular lignocellulose-containing biomass into fermentable sugars. The invention is further directed to apparatus suitable for carrying out such processes. According to the invention biomass is converted into

  16. Process and apparatus for conversion of biomass

    NARCIS (Netherlands)

    Bakker, R.R.C.; Hazewinkel, J.H.O.; Groenestijn, van J.W.

    2006-01-01

    The invention is directed to a process for the conversion of biomass, in particular lignocellulose-containing biomass into a product that may be further processes in a fermentation step. The invention is further directed to apparatus suitable for carrying out such processes. According to the

  17. Collection shield for ion separation apparatus

    International Nuclear Information System (INIS)

    Ford, K.L.; Pugh, R.A.

    1981-01-01

    The ion separation electrodes in isotope separation apparatus are provided with removable collection shields to collect neutral particles which would normally pass through the ionization region. A preferred collection shield comprises a u-shaped section for clipping onto the leading edge of an electrode and a pair of flanges projecting substantially perpendicular to the clipping section for collecting neutral particles

  18. 21 CFR 886.4100 - Radiofrequency electrosurgical cautery apparatus.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Radiofrequency electrosurgical cautery apparatus... SERVICES (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4100 Radiofrequency electrosurgical cautery apparatus. (a) Identification. A radiofrequency electrosurgical cautery apparatus is an AC...

  19. 21 CFR 868.5165 - Nitric oxide administration apparatus.

    Science.gov (United States)

    2010-04-01

    ... apparatus. (a) Identification. The nitric oxide administration apparatus is a device used to add nitric oxide to gases that are to be breathed by a patient. The nitric oxide administration apparatus is to be used in conjunction with a ventilator or other breathing gas administration system. (b) Classification...

  20. Switched-mode power supply apparatus and method

    NARCIS (Netherlands)

    2013-01-01

    The present invention relates to a switched-mode power supply apparatus and a corresponding method. For an effective compensation of non-linearities caused by dead- time and voltage drops in the switching power amplifier of the apparatus, an apparatus is proposed comprising a switching power

  1. Switched-mode power supply apparatus and method

    NARCIS (Netherlands)

    2013-01-01

    The present invention relates to a switched-mode power supply apparatus and a corresponding method. For an effective compensation of non-linearities caused by dead-time and voltage drops in the switching power amplifier of the apparatus, an apparatus is proposed comprising a switching power

  2. Apparatus Named after Our Academic Ancestors--I

    Science.gov (United States)

    Greenslade, Thomas B., Jr.

    2010-01-01

    Let us now praise famous physicists, and the apparatus named after them, with apologies to the writer of Ecclesiastes. I once compiled a list of about 300 pieces of apparatus known to us as X's Apparatus. Some of the values of X are familiar, like Wheatstone and Kelvin and Faraday, but have you heard of Pickering or Rhumkorff or Barlow? In an…

  3. Acoustic agglomeration methods and apparatus

    Science.gov (United States)

    Barmatz, M. B. (Inventor)

    1984-01-01

    Methods are described for using acoustic energy to agglomerate fine particles on the order of one micron diameter that are suspended in gas, to provide agglomerates large enough for efficient removal by other techniques. The gas with suspended particles, is passed through the length of a chamber while acoustic energy at a resonant chamber mode is applied to set up one or more acoustic standing wave patterns that vibrate the suspended particles to bring them together so they agglomerate. Several widely different frequencies can be applied to efficiently vibrate particles of widely differing sizes. The standing wave pattern can be applied along directions transversed to the flow of the gas. The particles can be made to move in circles by applying acoustic energy in perpendicular directions with the energy in both directions being of the same wavelength but 90 deg out of phase.

  4. Electro-optical and Magneto-optical Sensing Apparatus and Method for Characterizing Free-space Electromagnetic Radiation

    Science.gov (United States)

    Zhang, Xi-Cheng; Riordan, Jenifer Ann; Sun, Feng-Guo

    2000-08-29

    Apparatus and methods for characterizing free-space electromagnetic energy, and in particular, apparatus/method suitable for real-time two-dimensional far-infrared imaging applications are presented. The sensing technique is based on a non-linear coupling between a low-frequency electric (or magnetic) field and a laser beam in an electro-optic (or magnetic-optic) crystal. In addition to a practical counter-propagating sensing technique, a co-linear approach is described which provides longer radiated field-optical beam interaction length, thereby making imaging applications practical.

  5. Versatile user-oriented atomic and molecular beam apparatus for use with the National Synchrotron Light Source

    International Nuclear Information System (INIS)

    Mitchell, J.B.A.; Grover, J.R.

    1978-11-01

    A proposed atomic and moleuclar beam apparatus is described for photon interaction studies using the National Sychrotron Light Source at the Brookhaven National Laboratory. This apparatus will employ ultrahigh vacuum techniques compatible with storage ring operation. Supersonic nozzle sources will be used to produce the beams and signal detection will be accomplished using a quadrupole mass analysis system. The equipment is intended for use both by in-house and outside users and primary consideration has been given to flexibility of design. The application of photoionization techniques to the study of crossed beam reactive scattering with particular emphasis on internal energy distribution analysis is discussed

  6. Method and apparatus for performing digital intravenous subtraction angiography

    International Nuclear Information System (INIS)

    Stein, J.A.

    1986-01-01

    This invention relates to digital intravenous subtraction angiography (DISA), and more particularly concerns novel apparatus and techniques for providing high resolution angiograms with equipment that coacts with existing standard medical X-ray equipment. A typical medical X-ray generator provides low mA, continuous X-ray exposures illuminating a standard image intensifier producing an image scanned by a conventional television camera to produce a video signal. An analog-to-digital converter digitizes the signal, and adding means adds the digital frame signals together in real time to provide an intermediate digital signal representing the addition of 5 to 20 frames. Digital storage means store the intermediate image signals. Preferably there are two system memories with means for summing a subsequent intermediate image in the second memory while a previously-formed intermediate image is being transferred to disk storage

  7. Method and apparatus for logging inclined earth boreholes

    International Nuclear Information System (INIS)

    Youmans, A.H.

    1981-01-01

    An improved technique is provided for comparing the velocity of an elongated well logging instrument traversing an inclined earth borehole with the playout velocity of the well logging cable at the earth's surface to control both the cable hoist drum rotation and the rate of movement of the subsurface instrument and thus insure cable playout is in equilibrium with the logging instrument movement. Method and apparatus are described for detecting any reduction in movement of the logging instrument through the borehole and for reducing the velocity of the logging cable playout in response thereto by reducing drum rotation. Further, when the velocity of cable playout slows to a preselected value, a monitoring circuit generates control signals which actuate a means of power attached to or integral with the logging instrument which, upon initiation, apply a force to move the logging instrument upward or downward within the borehole

  8. An apparatus for preparing isotopically pure He4

    International Nuclear Information System (INIS)

    McClintock, P.V.E.

    1978-01-01

    A cryostat has been constructed for extracting pure He 4 from He II of natural isotopic composition by means of a heat flush technique. It is shown that the method is in principle capable of yielding He 4 which is entirely devoid of He 3 isotopic impurities. A secondary heat flush, operated in conjunction with a conical heat exchanger of novel design, was used to place an experimental lower bound of 2 x 10 15 on the He 4 /He 3 ratio of the product, a standard sufficient for all present or projected applications requiring isotopically pure He 4 . The apparatus produces 2 000 1 (at standard temperature and pressure) of He 4 per thermal cycle. The design of future purifiers is discussed. (author)

  9. Apparatus and method for radioactive waste screening

    Science.gov (United States)

    Akers, Douglas W.; Roybal, Lyle G.; Salomon, Hopi; Williams, Charles Leroy

    2012-09-04

    An apparatus and method relating to screening radioactive waste are disclosed for ensuring that at least one calculated parameter for the measurement data of a sample falls within a range between an upper limit and a lower limit prior to the sample being packaged for disposal. The apparatus includes a radiation detector configured for detecting radioactivity and radionuclide content of the of the sample of radioactive waste and generating measurement data in response thereto, and a collimator including at least one aperture to direct a field of view of the radiation detector. The method includes measuring a radioactive content of a sample, and calculating one or more parameters from the radioactive content of the sample.

  10. Apparatus and method for assembling fuel elements

    International Nuclear Information System (INIS)

    Arya, S.P.

    1978-01-01

    A nuclear fuel element assembling method and apparatus is preferably operable under programmed control unit to receive fuel rods from storage, arrange them into axially aligned stacks of closely monitored length, and transfer the stacks of fuel rods to a loading device for insertion into longitudinal passages in the fuel elements. In order to handle large numbers of one or more classifications of fuel rods or other cylindrical parts, the assembling apparatus includes at least two feed troughs each formed by a pair of screw members with a movable table having a plurality of stacking troughs for alignment with the feed troughs and with a conveyor for delivering the stacks to the loading device, the fuel rods being moved along the stacking troughs upon a fluid cushion. 23 claims, 6 figures

  11. Apparatus for measuring a concentration of radioactivity

    International Nuclear Information System (INIS)

    Tabuchi, H.; Ogushi, A.

    1978-01-01

    Disclosed is an apparatus for measuring concentration of radioactivity in a fluid circulating in a cooling system or a disposal system, etc., of a nuclear power plant (e.g. coolant), the apparatus having a plurality of sampling tubes with different diameters depending on the intensities of radioactivity, and the sampling tubes having valves for switching from one fluid to another fluid. The sampling tubes are connected to the system to a discharge pipe, and are disposed in the proximity of a radiation detector adapted to issue a signal representative of radiation. The issued signal is supplied to a multichannel pulse height analyzer and a data processing system providing an indication of the concentrations of radioactivities for respective radionuclides

  12. Apparatus and method for treating waste material

    International Nuclear Information System (INIS)

    Allison, W.

    1981-01-01

    Apparatus is described for the packaging of waste material in a vessel, comprising: a vessel entry station having inlet and outlet doors; a filling station downstream of the vessel entry station and having a filling position to which vessels are transferred from the entry station through the outlet door, the filling station having filling means for introducing radioactive waste into the vessel; a mixing station having a mixing position to which a vessel is transferred from the filling position; a capping station having a capping position to which a vessel is transferred from the mixing position; and means for effecting transfer of a vessel through the apparatus. Radiation shielding is provided. (U.K.)

  13. Nuclear propulsion apparatus with alternate reactor segments

    International Nuclear Information System (INIS)

    Szekely, T.

    1979-01-01

    Nuclear propulsion apparatus comprising: (a) means for compressing incoming air; (b) nuclear fission reactor means for heating said air; (c) means for expanding a portion of the heated air to drive said compressing means; (d) said nuclear fission reactor means being divided into a plurality of radially extending segments; (e) means for directing a portion of the compressed air for heating through alternate segments of said reactor means and another portion of the compressed air for heating through the remaining segments of said reactor means; and (f) means for further expanding the heated air from said drive means and the remaining heated air from said reactor means through nozzle means to effect reactive thrust on said apparatus. 12 claims

  14. Flow coating apparatus and method of coating

    Science.gov (United States)

    Hanumanthu, Ramasubrahmaniam; Neyman, Patrick; MacDonald, Niles; Brophy, Brenor; Kopczynski, Kevin; Nair, Wood

    2014-03-11

    Disclosed is a flow coating apparatus, comprising a slot that can dispense a coating material in an approximately uniform manner along a distribution blade that increases uniformity by means of surface tension and transfers the uniform flow of coating material onto an inclined substrate such as for example glass, solar panels, windows or part of an electronic display. Also disclosed is a method of flow coating a substrate using the apparatus such that the substrate is positioned correctly relative to the distribution blade, a pre-wetting step is completed where both the blade and substrate are completed wetted with a pre-wet solution prior to dispensing of the coating material onto the distribution blade from the slot and hence onto the substrate. Thereafter the substrate is removed from the distribution blade and allowed to dry, thereby forming a coating.

  15. Gram staining apparatus for space station applications

    Science.gov (United States)

    Molina, T. C.; Brown, H. D.; Irbe, R. M.; Pierson, D. L.

    1990-01-01

    A self-contained, portable Gram staining apparatus (GSA) has been developed for use in the microgravity environment on board the Space Station Freedom. Accuracy and reproducibility of this apparatus compared with the conventional Gram staining method were evaluated by using gram-negative and gram-positive controls and different species of bacteria grown in pure cultures. A subsequent study was designed to assess the performance of the GSA with actual specimens. A set of 60 human and environmental specimens was evaluated with the GSA and the conventional Gram staining procedure. Data obtained from these studies indicated that the GSA will provide the Gram staining capability needed for the microgravity environment of space.

  16. Therapeutic radiation apparatus having an optical pointer

    International Nuclear Information System (INIS)

    1981-01-01

    This patent specification relates to a therapeutic irradiating apparatus including a radiation source arranged to provide a beam of penetrating radiation and an optical alignment indicator comprising at least two light sources each provided with means to provide a planar divergent beam of light located so that at least two light beams intersect along a line substantially coincident with the central axis of the path of the radiation beam. The claim relates to cylindrical lenses providing the means of providing the divergent beams, and to lasers as the light sources. Claims are also made for the apparatus providing means of supporting and aligning the patient, and for disposing the light sources so that the exit point of the radiation beam is illuminated. (U.K.)

  17. Safety apparatus for serious radioactive accidents (1962)

    International Nuclear Information System (INIS)

    Estournel, R.; Rodier, J.

    1962-01-01

    In the case of a serious radioactive accident, radioactive dust and gases may be released into the atmosphere. It is therefore necessary to be able to evaluate rapidly the importance of the risk to the surrounding population, and to be able to ensure, even in the event of an evacuation of the Centre, the continuation of the radioactivity analyses and the decontamination of the personnel. For this, the Anti-radiation Protection Service at Marcoule has organised mobile detection teams and designed a mobile laboratory and a mobile shower-unit. After describing the duty of the mobile teams, the report gives a description of the apparatus which would be used at the Marcoule Centre in the case of a serious radioactive accident. The method of using this apparatus is given. (authors) [fr

  18. New apparatus for training the avoidance reaction.

    Science.gov (United States)

    Tikal, K

    1988-01-01

    A new apparatus for active avoidance training in rats consists of a short, wide runway which can be tilted from a horizontal to vertical position. One half of the electrifiable grid floor is covered by a nonconducting sheet. For brightness (black-white) discrimination training a white walled goal box can be inserted into the runway and shifted from left to right during training. Avoidance training of 24 rats (female Wistar SPF) required 14.1 +/- 2.6 (mean +/- SEM) to-criterion trials (9/10) and was completed in less than 4 min. Brightness discrimination training required 21.3 +/- 2.1 to-criterion trials and the time of training did not exceed 12 min. The retention of the acquired responses was very good in both cases. The main advantage of the apparatus is very rapid acquisition of the one-way and discriminated avoidance without the necessity of manual manipulation of the animal.

  19. Photovoltaic array mounting apparatus, systems, and methods

    Science.gov (United States)

    West, John Raymond; Atchley, Brian; Hudson, Tyrus Hawkes; Johansen, Emil

    2014-12-02

    An apparatus for mounting a photovoltaic (PV) module on a surface, including a support with an upper surface, a lower surface, tabs, one or more openings, and a clip comprising an arm and a notch, where the apparatus resists wind forces and seismic forces and creates a grounding electrical bond between the PV module, support, and clip. The invention further includes a method for installing PV modules on a surface that includes arranging supports in rows along an X axis and in columns along a Y axis on a surface such that in each row the distance between two neighboring supports does not exceed the length of the longest side of a PV module and in each column the distance between two neighboring supports does not exceed the length of the shortest side of a PV module.

  20. Apparatus for monitoring two-phase flow

    Science.gov (United States)

    Sheppard, John D.; Tong, Long S.

    1977-03-01

    A method and apparatus for monitoring two-phase flow is provided that is particularly related to the monitoring of transient two-phase (liquid-vapor) flow rates such as may occur during a pressurized water reactor core blow-down. The present invention essentially comprises the use of flanged wire screens or similar devices, such as perforated plates, to produce certain desirable effects in the flow regime for monitoring purposes. One desirable effect is a measurable and reproducible pressure drop across the screen. The pressure drop can be characterized for various known flow rates and then used to monitor nonhomogeneous flow regimes. Another useful effect of the use of screens or plates in nonhomogeneous flow is that such apparatus tends to create a uniformly dispersed flow regime in the immediate downstream vicinity. This is a desirable effect because it usually increases the accuracy of flow rate measurements determined by conventional methods.

  1. Apparatus for detecting leakage of liquid sodium

    Science.gov (United States)

    Himeno, Yoshiaki

    1978-01-01

    An apparatus for detecting the leakage of liquid sodium includes a cable-like sensor adapted to be secured to a wall of piping or other equipment having sodium on the opposite side of the wall, and the sensor includes a core wire electrically connected to the wall through a leak current detector and a power source. An accidental leakage of the liquid sodium causes the corrosion of a metallic layer and an insulative layer of the sensor by products resulted from a reaction of sodium with water or oxygen in the atmospheric air so as to decrease the resistance between the core wire and the wall. Thus, the leakage is detected as an increase in the leaking electrical current. The apparatus is especially adapted for use in detecting the leakage of liquid sodium from sodium-conveying pipes or equipment in a fast breeder reactor.

  2. A steam separator-superheater apparatus

    International Nuclear Information System (INIS)

    Androw, Jean; Bessouat, Roger; Peyrelongue, J.-P.

    1973-01-01

    Description is given of a separator-superheater apparatus comprising an outer enclosure containing a separating-unit and a steam superheating unit according to the main patent. The present addition relates to an improvement in that apparatus, characterized in that the separating unit and the superheating unit, mounted in two distinct portions of the outer enclosure, are divided into the same number of sub-units of each unit being identical and operating in parallel, and in that to each separator sub-unit is associated a superheater sub-unit, said sub-units being mounted in series and located in one in the other of the enclosure two portions, respectively. This can be applied to the treatment of the exhaust steam of a turbine high pressure body, prior to re-injecting said steam into the low pressure body [fr

  3. Spectroscopic Chemical Analysis Methods and Apparatus

    Science.gov (United States)

    Hug, William F. (Inventor); Reid, Ray D. (Inventor); Bhartia, Rohit (Inventor); Lane, Arthur L. (Inventor)

    2018-01-01

    Spectroscopic chemical analysis methods and apparatus are disclosed which employ deep ultraviolet (e.g. in the 200 nm to 300 nm spectral range) electron beam pumped wide bandgap semiconductor lasers, incoherent wide bandgap semiconductor light emitting devices, and hollow cathode metal ion lasers to perform non-contact, non-invasive detection of unknown chemical analytes. These deep ultraviolet sources enable dramatic size, weight and power consumption reductions of chemical analysis instruments. In some embodiments, Raman spectroscopic detection methods and apparatus use ultra-narrow-band angle tuning filters, acousto-optic tuning filters, and temperature tuned filters to enable ultra-miniature analyzers for chemical identification. In some embodiments Raman analysis is conducted along with photoluminescence spectroscopy (i.e. fluorescence and/or phosphorescence spectroscopy) to provide high levels of sensitivity and specificity in the same instrument.

  4. Apparatus, system, and method for traffic monitoring

    KAUST Repository

    Claudel, Christian G.

    2016-08-25

    An apparatus, system, and method for traffic monitory can have a Lagrangian inertial measurement unit. The Lagrangian inertial measurement unit can have a processor, an accelerometer, a gyroscope, and/or a wireless transmitter. The processor can have an integrated direction cosine matrix. The accelerometer can be configured to measure linear accelerations of a vehicle and/or can communicate measured linear acceleration to the processor. The gyroscope can be configured to measure rotational accelerations of the vehicle and/or can communicate measured rotational acceleration to the processor. The processor can be configured to calculate estimated vehicle speed and/or estimated vehicle attitude. The wireless transmitter can be configured to wirelessly transmit estimated vehicle speed and/or estimated vehicle attitude. The apparatus, system, and method can be integrated with a wireless sensor network.

  5. Apparatus for monitoring two-phase flow

    International Nuclear Information System (INIS)

    Sheppard, J.D.; Tong, L.S.

    1977-01-01

    A method and apparatus for monitoring two-phase flow is provided that is particularly related to the monitoring of transient two-phase (liquid-vapor) flow rates such as may occur during a pressurized water reactor core blow-down. The present invention essentially comprises the use of flanged wire screens or similar devices, such as perforated plates, to produce certain desirable effects in the flow regime for monitoring purposes. One desirable effect is a measurable and reproducible pressure drop across the screen. The pressure drop can be characterized for various known flow rates and then used to monitor nonhomogeneous flow regimes. Another useful effect of the use of screens or plates in nonhomogeneous flow is that such apparatus tends to create a uniformly dispersed flow regime in the immediate downstream vicinity. This is a desirable effect because it usually increases the accuracy of flow rate measurements determined by conventional methods. 3 claims, 9 figures

  6. Data structures and apparatuses for representing knowledge

    Science.gov (United States)

    Hohimer, Ryan E; Thomson, Judi R; Harvey, William J; Paulson, Patrick R; Whiting, Mark A; Tratz, Stephen C; Chappell, Alan R; Butner, Robert S

    2014-02-18

    Data structures and apparatuses to represent knowledge are disclosed. The processes can comprise labeling elements in a knowledge signature according to concepts in an ontology and populating the elements with confidence values. The data structures can comprise knowledge signatures stored on computer-readable media. The knowledge signatures comprise a matrix structure having elements labeled according to concepts in an ontology, wherein the value of the element represents a confidence that the concept is present in an information space. The apparatus can comprise a knowledge representation unit having at least one ontology stored on a computer-readable medium, at least one data-receiving device, and a processor configured to generate knowledge signatures by comparing datasets obtained by the data-receiving devices to the ontologies.

  7. Ultrasonic stir welding process and apparatus

    Science.gov (United States)

    Ding, R. Jeffrey (Inventor)

    2009-01-01

    An ultrasonic stir welding device provides a method and apparatus for elevating the temperature of a work piece utilizing at least one ultrasonic heater. Instead of relying on a rotating shoulder to provide heat to a workpiece an ultrasonic heater is utilized to provide ultrasonic energy to the workpiece. A rotating pin driven by a motor assembly performs the weld on the workpiece. A handheld version can be constructed as well as a fixedly mounted embodiment.

  8. Apparatus for measurement of coefficient of friction

    Science.gov (United States)

    Slifka, A. J.; Siegwarth, J. D.; Sparks, L. L.; Chaudhuri, Dilip K.

    1990-01-01

    An apparatus designed to measure the coefficient of friction in certain controlled atmospheres is described. The coefficient of friction observed during high-load tests was nearly constant, with an average value of 0.56. This value is in general agreement with that found in the literature and also with the initial friction coefficient value of 0.67 measured during self-mated friction of 440C steel in an oxygen environment.

  9. Coating and curing apparatus and methods

    Science.gov (United States)

    Brophy, Brenor L; Maghsoodi, Sina; Neyman, Patrick J; Gonsalves, Peter R; Hirsch, Jeffrey G; Yang, Yu S

    2015-02-24

    Disclosed are coating apparatus including flow coating and roll-coating that may be used for uniform sol-gel coating of substrates such as glass, solar panels, windows or part of an electronic display. Also disclosed are methods for substrate preparation, flow coating and roll coating. Lastly systems and methods for skin curing sol-gel coatings deposited onto the surface of glass substrates using a high temperature air-knife are disclosed.

  10. Molding apparatus. [for thermosetting plastic compositions

    Science.gov (United States)

    Heier, W. C. (Inventor)

    1974-01-01

    Apparatus for compression molding of thermosetting plastics compositions including interfitting hollow male and female components is reported. The components are adapted to be compressed to form a rocket nozzle in a cavity. A thermal jacket is provided exteriorly adjacent to the female component for circulating a thermal transfer fluid to effect curing of a thermosetting plastics material being molded. Each of the male and female components is provided with suitable inlets and outlets for circulating a thermal transfer fluid.

  11. Hafnium - material for chemical apparatus engineering

    International Nuclear Information System (INIS)

    Jennert, D.

    1981-01-01

    This work describes - on the background of available literature - the properties of hafnium in technical quality (DIN-material No. 2.6400) as material for chemical apparatus engineering. The occurence, refining, physical and chemical properties will be described as well as the material behavior. In conclusion, it has been found that there is, at present, sufficient information for the engineering of hafnium which has to be completed by additional investigations for special applications. (orig.) [de

  12. Plasma/Neutral-Beam Etching Apparatus

    Science.gov (United States)

    Langer, William; Cohen, Samuel; Cuthbertson, John; Manos, Dennis; Motley, Robert

    1989-01-01

    Energies of neutral particles controllable. Apparatus developed to produce intense beams of reactant atoms for simulating low-Earth-orbit oxygen erosion, for studying beam-gas collisions, and for etching semiconductor substrates. Neutral beam formed by neutralization and reflection of accelerated plasma on metal plate. Plasma ejected from coaxial plasma gun toward neutralizing plate, where turned into beam of atoms or molecules and aimed at substrate to be etched.

  13. Capacity control of rotary vane apparatus

    International Nuclear Information System (INIS)

    Roberts, R. W.

    1985-01-01

    A capacity control arrangement for a rotary vane fluid displacement apparatus, such as a rotary vane compressor, having a vane retaining means that normally engages and retains the vanes in their retracted or nonworking position within the rotor defined guide slits of such rotary vane compressor. The retaining means are actuated to the vane-disengaged position by hydraulic control fluid which is communicated to the retaining means in response to an external parameter sensed by a control means

  14. Apparatus and Methods for Mitigating Electromagnetic Emissions

    Science.gov (United States)

    Geng, Steven M. (Inventor); Niedra, Janis M. (Inventor)

    2016-01-01

    Apparatus, methods, and other embodiments associated with mitigation of magnetic fields are described herein. In an embodiment, a method for mitigating an electromagnetic field includes positioning a mitigating coil around a linear alternator of linear motor so that the mitigating coil is coaxially located with an alternator coil; arranging the mitigating coil to generate a field to mitigate an electromagnetic field generated by the alternator coil; and passing an induced current from the alternator coil through the mitigating coil.

  15. Apparatus for storing and processing fissionable substances

    International Nuclear Information System (INIS)

    Dubovsky, B.G.; Bogatyrev, V.K.; Vladykov, G.M.; Sviridenko, V.Y.

    1974-01-01

    An apparatus is described for storing and processing fissionable substances in which there is provided a protective shield in the form of a layer of neutron absorbing material located in direct proximity to a vessel with a fissionable substance contained therein. The layer of neutron retarding material according to the present invention has alternating projections and depressions facing the layer of neutron-absorbing material. (author)

  16. A muon trigger for the MACRO apparatus

    International Nuclear Information System (INIS)

    Barbarito, E.; Bellotti, R.; Calicchio, M.; Castellano, M.; DeCataldo, G.; DeMarzo, C.; Erriquez, O.; Favuzzi, C.; Giglietto, N.; Liuzzi, R.; Spinelli, P.

    1991-01-01

    A trigger circuit based on EPROM components, able to manage up to 30 lines from independent counters, is described. The circuit has been designed and used in the MACRO apparatus at the Gran Sasso Laboratory for triggering on fast particles. The circuit works with standard TTL positive logic and is assembled in a double standard CAMAC module. It has a high triggering capacity and a high flexibility. (orig.)

  17. Apparatus for neutralization of accelerated ions

    International Nuclear Information System (INIS)

    Fink, J.H.; Frank, A.M.

    1979-01-01

    Apparatus is described for neutralization of a beam of accelerated ions, such as hydrogen negative ions (H - ), using relatively efficient strip diode lasers which emit monochromatically at an appropriate wavelength (lambda = 8000 A for H - ions) to strip the excess electrons by photodetachment. A cavity, formed by two or more reflectors spaced apart, causes the laser beams to undergo multiple reflections within the cavity, thus increasing the efficiency and reducing the illumination required to obtain an acceptable percentage (approx. 85%) of neutralization

  18. Tomographic scanning apparatus with ionization detector means

    International Nuclear Information System (INIS)

    1981-01-01

    This patent specification describes a tomographic scanning apparatus using a fan beam and digital output signal. Particular reference is made to the gas-pressurized ionization detector chamber, consisting of an array of side-by-side elongate ionization detection cells, the principal axis of each of the said cells being oriented along a radius extending towards the radiation source, and connection means for applying potentials across the cells for taking their output signals. (U.K.)

  19. Continuous microwave regeneration apparatus for absorption media

    Science.gov (United States)

    Smith, Douglas D.

    1999-01-01

    A method and apparatus for continuously drying and regenerating ceramic beads for use in process gas moisture drying operations such as glove boxes. A microwave energy source is coupled to a process chamber to internally heat the ceramic beads and vaporize moisture contained therein. In a preferred embodiment, the moisture laden ceramic beads are conveyed toward the microwave source by a screw mechanism. The regenerated beads flow down outside of the screw mechanism and are available to absorb additional moisture.

  20. Apparatus Tests Peeling Of Bonded Rubbery Material

    Science.gov (United States)

    Crook, Russell A.; Graham, Robert

    1996-01-01

    Instrumented hydraulic constrained blister-peel apparatus obtains data on degree of bonding between specimen of rubbery material and rigid plate. Growth of blister tracked by video camera, digital clock, pressure transducer, and piston-displacement sensor. Cylinder pressure controlled by hydraulic actuator system. Linear variable-differential transformer (LVDT) and float provide second, independent measure of change in blister volume used as more precise volume feedback in low-growth-rate test.

  1. Maintenance and control of apparatus for radiotherapy

    International Nuclear Information System (INIS)

    Wakui, Sho

    1979-01-01

    In order to perform the safe operation of radiotherapy apparatuses and to secure the accuracy in positioning patients and in setting up radiation beam, proper checking-up and maintenance schedule is necessary. Such schedule is described briefly and also the mechanical or electrical equipments designed for securing the safety and accuracy or eliminating in adequate operation are explained, especially on treatment tables and accessories, such as wedge filters, irradiation field indicators and pointers, and the devices for observing patients. The structures and the practical control of the following equipments are explained; standard treatment table, treatment table with a lifting column by oil pressure, mobile positioning control pedestal, positioning control pendaut, mechanical fuse cutter for the safeguard of table height movement, safety interlock to protect table from physical contact with radiation head in rotation and safeguard for arms of a patient in longitudinal movement of treatment table. For the maintenance and control of wedge filters, the kind of filter angle in use, the direction of filter in use and whether filter is used or not are exactly confirmed by adequate display. The direction mechanism of radiation field and the pointers are required to be strict for exact focusing of radiation. Various control apparatuses and monitoring apparatuses are described. (Kobatake, H.)

  2. Apparatus for testing semiconductor devices and capacitors

    International Nuclear Information System (INIS)

    York, R.A.

    1984-01-01

    An apparatus is provided for testing semiconductor devices. The apparatus tests the impedance of the semiconductor devices in both conducting and non-conducting states to detect semiconductors whose impedance in the conducting state is too high or whose impedance in the non-conducting state is too low. The apparatus uses a battery source for low voltage d.c. The circuitry for detecting when the impedance is too high in the conducting state includes a lamp in series with the battery source and the semiconductor device, whereby the impedance of the semiconductor device determines whether sufficient current will flow through the lamp to cause the lamp to illuminate. A d.c. to d.c. converter is provided to boost the voltage from the battery source to a relatively high voltage d.c. The relatively high voltage d.c. can be connected by a switch to circuitry for detecting when the impedance of the semiconductor device in the non-conducting state is too low. The circuitry for detecting when the impedance of the semiconductor device is too low includes a resistor which senses the current flowing in the device and converts the current into a voltage proportional to the leakage current. This voltage is then compared against a fixed reference. Further circuitry is provided for providing a visual indication when the voltage representative of leakage in relation to the reference signal indicates that there is excessive current flow through the semiconductor device

  3. Polarization Imaging Apparatus with Auto-Calibration

    Science.gov (United States)

    Zou, Yingyin Kevin (Inventor); Zhao, Hongzhi (Inventor); Chen, Qiushui (Inventor)

    2013-01-01

    A polarization imaging apparatus measures the Stokes image of a sample. The apparatus consists of an optical lens set, a first variable phase retarder (VPR) with its optical axis aligned 22.5 deg, a second variable phase retarder with its optical axis aligned 45 deg, a linear polarizer, a imaging sensor for sensing the intensity images of the sample, a controller and a computer. Two variable phase retarders were controlled independently by a computer through a controller unit which generates a sequential of voltages to control the phase retardations of the first and second variable phase retarders. A auto-calibration procedure was incorporated into the polarization imaging apparatus to correct the misalignment of first and second VPRs, as well as the half-wave voltage of the VPRs. A set of four intensity images, I(sub 0), I(sub 1), I(sub 2) and I(sub 3) of the sample were captured by imaging sensor when the phase retardations of VPRs were set at (0,0), (pi,0), (pi,pi) and (pi/2,pi), respectively. Then four Stokes components of a Stokes image, S(sub 0), S(sub 1), S(sub 2) and S(sub 3) were calculated using the four intensity images.

  4. Ventilation system for 99Mo production apparatus

    International Nuclear Information System (INIS)

    Izumo, Mishiroku; Okane, Shougo; Sorita, Takami; Aoyama, Saburou

    1978-04-01

    In production of 20 Ci 99 Mo from 235 U fission, about 120 Ci of radioiodine ( 131 I, 132 I, and 133 I) is involved. To remove airborne radioiodine from the exhaust air from production apparatus and minimize radioiodine release to the atmosphere, the ventilation system is equipped with 2 units of Model-FD charcoal filter (KI 3 -Impregnated charcoal 2 inch thick of Barnebey-Cheney Co.). From September 1976 to December 1977, 21 runs of 99 Mo production involving airborne radioiodine were carried out. The ventilation system was operated continuously for the whole 15 months period; variation in removal efficiency of airborne radioiodine from the exhaust air stream was observed. In the runs valuable experiences were gained in operation and maintenance of the ventilation system including activated charcoal filter and health-physics management of such facility. Following are the results: (1) Airborne radioiodine from 99 Mo production apparatus is reduced to 10 -3 % of the original quantity. (2) When the ventilation system is operated at a maximum air flow rate through the filter, the average efficiency during 15 months is over 98%. (3) Airborne radioiodine released from 99 Mo production apparatus to the ventilation system is less than 5% particulate iodine and alkyl iodines and more than 95% inorganic iodine. (4) Airborne radioiodine released from the stack is less than 28 μCi/run, which is below the limit in regulations on Radioisotope Production Laboratory. (auth.)

  5. Active magnetic regenerator method and apparatus

    Science.gov (United States)

    DeGregoria, Anthony J.; Zimm, Carl B.; Janda, Dennis J.; Lubasz, Richard A.; Jastrab, Alexander G.; Johnson, Joseph W.; Ludeman, Evan M.

    1993-01-01

    In an active magnetic regenerator apparatus having a regenerator bed of material exhibiting the magnetocaloric effect, flow of heat transfer fluid through the bed is unbalanced, so that more fluid flows through the bed from the hot side of the bed to the cold side than from the cold side to the hot side. The excess heat transfer fluid is diverted back to the hot side of the bed. The diverted fluid may be passed through a heat exchanger to draw heat from a fluid to be cooled. The apparatus may be operated at cryogenic temperatures, and the heat transfer fluid may be helium gas and the fluid to be cooled may be hydrogen gas, which is liquified by the device. The apparatus can be formed in multiple stages to allow a greater span of cooling temperatures than a single stage, and each stage may be comprised of two bed parts. Where two bed parts are employed in each stage, a portion of the fluid passing from the hot side to the cold side of a first bed part which does not have a magnetic field applied thereto is diverted back to the cold side of the other bed part in the stage, where it is passed through to the hot side. The remainder of the fluid from the cold side of the bed part of the first stage is passed to the hot side of the bed part of the second stage.

  6. Apparatus and method for pulsed laser deposition of materials on wires and pipes

    Science.gov (United States)

    Fernandez, Felix E.

    2003-01-01

    Methods and apparatuses are disclosed which allow uniform coatings to be applied by pulsed laser deposition (PLD) on inner and outer surfaces of cylindrical objects, such as rods, pipes, tubes, and wires. The use of PLD makes this technique particularly suitable for complex multicomponent materials, such as superconducting ceramics. Rigid objects of any length, i.e., pipes up to a few meters, and with diameters from less than 1 centimeter to over 10 centimeters can be coated using this technique. Further, deposition is effected simultaneously onto an annular region of the pipe wall. This particular arrangement simplifies the apparatus, reduces film uniformity control difficulties, and can result in faster operation cycles. In addition, flexible wires of any length can be continuously coated using the disclosed invention.

  7. Positioning calibration apparatus for transducers employed in nuclear reactor vessel inspection apparatus

    International Nuclear Information System (INIS)

    Elsner, H.J.

    1979-01-01

    Calibration apparatus for verifying the position and orientation of transducers used in nuclear reactor vessel inspection apparatus is disclosed. A tank, filled with water, the operating inspection medium, is fitted with a movable mounting assembly adapted to securely accommodate a transducer and the mounting assembly in which it is normally secured during an inspection procedure. The tank is also provided with a slidably mounted target positioned therein at a predetermined distance from the target which is selected to avoid the distortion effects in the near field of the transducer response. The calibration apparatus can be used to check the normal transducer mounting for either perpendicularity or angular orientation by moving the tank's mounting assembly via a lead screw with which it is threadingly engaged. 6 claims

  8. Positioning calibration apparatus for transducers employed in nuclear reactor vessel inspection apparatus

    International Nuclear Information System (INIS)

    Elsner, H.J.

    1981-01-01

    The invention provides a calibration apparatus suitable for verifying the position and orientation of transducers used in reactor vessel ultrasonic inspection. The apparatus includes moveable mounting means which secures a transducer within the tank in its normal inspection orientation. A drive is also provided for moving the transducer in the tank relative to a target. The target is slidably positioned in the tank at a distance from the transducer which is selected to avoid the distortion effects in the near field of the transducer. The drive mechanism may be provided with graduated indicia of travel, or a scale may be affixed to the side of the tank. (L.L.)

  9. Heated junction thermocouple level measurement apparatus

    International Nuclear Information System (INIS)

    Bevilacqua, F.; Burger, J.M.

    1984-01-01

    A liquid level sensing apparatus senses the level of liquid surrounding the apparatus. A plurality of axially spaced sensors are enclosed in a separator tube. The separator tube tends to collapse the level of a two-phase fluid within the separator tube into essentially a liquid phase and a gaseous phase where the collapsed level bears a relationship to the coolant inventory outside the separator tube. The level of the liquid phase is sensed by level sensing apparatus. The separator tube contains inlet-outlet ports near the top and bottom thereof to equalize the liquid level inside and outside the separator tube when the level fluctuates or the water within the separator tube flashes to steam. Each sensor is comprised of a heater, a heated thermocouple junction and an unheated thermocouple junction within an elongated heat conductive housing. The heated portion of housing is enclosed in a splash guard with inlet-outlet ports near the top and bottom to equalize the liquid level inside and outside the splash guardand to eliminate the spurious indications of liquid level change which may arise if water droplets contact the housing in the region of the heater. To prevent steam bubbles entrained in a two-phase fluid cross flow from entering the lateral inlet-outlet ports of the separator tube, the separator tube is enclosed in support tube which may in turn be enclosed in an otherwise unused control element assembly shroud. The lateral inlet-outlet ports of separator tube are axially offset from lateral inlet-outlet ports of support tube at least where support tube is subjected to cross flow. The shroud is open on the bottom and has lateral inlet-outlet ports to facilitate liquid level fluctuations to equalize inside and outside shroud

  10. Experimental apparatus to test air trap valves

    Science.gov (United States)

    Lemos De Lucca, Y. de F.; de Aquino, G. A.; Filho, J. G. D.

    2010-08-01

    It is known that the presence of trapped air within water distribution pipes can lead to irregular operation or even damage to the distribution systems and their components. The presence of trapped air may occur while the pipes are being filled with water, or while the pumping systems are in operation. The formation of large air pockets can produce the water hammer phenomenon, the instability and the loss of pressure in the water distribution networks. As a result, it can overload the pumps, increase the consumption of electricity, and damage the pumping system. In order to avoid its formation, all of the trapped air should be removed through "air trap valves". In Brazil, manufacturers frequently have unreliable sizing charts, which cause malfunctioning of the "air trap valves". The result of these malfunctions causes accidents of substantial damage. The construction of a test facility will provide a foundation of technical information that will be used to help make decisions when designing a system of pipelines where "air trap valves" are used. To achieve this, all of the valve characteristics (geometric, mechanic, hydraulic and dynamic) should be determined. This paper aims to describe and analyze the experimental apparatus and test procedure to be used to test "air trap valves". The experimental apparatus and test facility will be located at the University of Campinas, Brazil at the College of Civil Engineering, Architecture, and Urbanism in the Hydraulics and Fluid Mechanics laboratory. The experimental apparatus will be comprised of various components (pumps, steel pipes, butterfly valves to control the discharge, flow meter and reservoirs) and instrumentation (pressure transducers, anemometer and proximity sensor). It should be emphasized that all theoretical and experimental procedures should be defined while taking into consideration flow parameters and fluid properties that influence the tests.

  11. Experimental apparatus to test air trap valves

    Energy Technology Data Exchange (ETDEWEB)

    Lemos De Lucca, Y de F [CTH-DAEE-USP/FAAP/UNICAMP (Brazil); Aquino, G A de [SABESP/UNICAMP (Brazil); Filho, J G D, E-mail: yvone.lucca@gmail.co [Water Resources Department, University of Campinas-UNICAMP, Av. Albert Einstein, 951, Cidade Universitaria-Barao Geraldo-Campinas, S.P., 13083-852 (Brazil)

    2010-08-15

    It is known that the presence of trapped air within water distribution pipes can lead to irregular operation or even damage to the distribution systems and their components. The presence of trapped air may occur while the pipes are being filled with water, or while the pumping systems are in operation. The formation of large air pockets can produce the water hammer phenomenon, the instability and the loss of pressure in the water distribution networks. As a result, it can overload the pumps, increase the consumption of electricity, and damage the pumping system. In order to avoid its formation, all of the trapped air should be removed through 'air trap valves'. In Brazil, manufacturers frequently have unreliable sizing charts, which cause malfunctioning of the 'air trap valves'. The result of these malfunctions causes accidents of substantial damage. The construction of a test facility will provide a foundation of technical information that will be used to help make decisions when designing a system of pipelines where 'air trap valves' are used. To achieve this, all of the valve characteristics (geometric, mechanic, hydraulic and dynamic) should be determined. This paper aims to describe and analyze the experimental apparatus and test procedure to be used to test 'air trap valves'. The experimental apparatus and test facility will be located at the University of Campinas, Brazil at the College of Civil Engineering, Architecture, and Urbanism in the Hydraulics and Fluid Mechanics laboratory. The experimental apparatus will be comprised of various components (pumps, steel pipes, butterfly valves to control the discharge, flow meter and reservoirs) and instrumentation (pressure transducers, anemometer and proximity sensor). It should be emphasized that all theoretical and experimental procedures should be defined while taking into consideration flow parameters and fluid properties that influence the tests.

  12. A Simple Apparatus for Fast Ion Exchange Separations

    International Nuclear Information System (INIS)

    Samsahl, K.

    1964-09-01

    An apparatus suitable for very fast ion exchange group separations in radiochemistry has been elaborated. The apparatus which consists of a system of glass tubes with pistons driven by the same force, allows the exact adjustment of influent solutions to a long series of ion-exchange columns. The practical application of the apparatus to the simultaneous separation of six groups of trace elements in the neutron activation analysis of biological material is described

  13. A Simple Apparatus for Fast Ion Exchange Separations

    Energy Technology Data Exchange (ETDEWEB)

    Samsahl, K

    1964-09-15

    An apparatus suitable for very fast ion exchange group separations in radiochemistry has been elaborated. The apparatus which consists of a system of glass tubes with pistons driven by the same force, allows the exact adjustment of influent solutions to a long series of ion-exchange columns. The practical application of the apparatus to the simultaneous separation of six groups of trace elements in the neutron activation analysis of biological material is described.

  14. Influence of Temperature and Catalyst on the Decomposition of Potassium Chlorate in a Simple DTA-Apparatus.

    Science.gov (United States)

    Wiederholt, Erwin

    1983-01-01

    DTA is a technique in which the temperature difference between sample/reference is measured as a function of temperature, while both are subject to a controlled temperature program. Use of a simple DTA-apparatus in demonstrating catalytic effects of manganese dioxide and aluminum oxide on decomposition temperature of potassium chlorate is…

  15. [Mathematical apparatus of the circuit theory in modeling of heat transfer upon extreme heating of an organism].

    Science.gov (United States)

    2010-01-01

    The mathematical model of heat transfer in whole-body hyperthermia, developed earlier by the author, has been refined using the mathematical apparatus of the circuit theory. The model can be used to calculate the temperature of each organ, which can increase the efficacy and safety of the immersion-convection technique of whole-body hyperthermia.

  16. Apparatus and method for detecting explosives

    International Nuclear Information System (INIS)

    Griffith, B.

    1976-01-01

    An apparatus is described for use in situations such as airports to detect explosives hidden in containers (for eg. suitcases). The method involves the evaluation of the quantities of oxygen and nitrogen within the container by neutron activation analysis and the determination of whether these quantities exceed predetermined limits. The equipment includes a small sub-critical lower powered reactor for thermal (0.01 to 0.10 eV) neutron production, a radium beryllium primary source, a deuterium-tritium reactor as a high energy (> 1.06 MeV) neutron source and Geiger counter detector arrays. (UK)

  17. Apparatus for isotopic alteration of mercury vapor

    International Nuclear Information System (INIS)

    Grossman, M.W.; George, W.A.; Marcucci, R.V.

    1988-01-01

    This patent describes an apparatus for enriching the isotopic content of mercury. It comprises: a low pressure electric discharge lamp, the lamp comprising an envelope transparent to ultraviolet radiation and containing a fill comprising mercury and an inert gas; a filter concentrically arranged around the low pressure electric discharge lamp, the filter being transparent to ultraviolet radiation and containing mercury including 196 Hg isotope; means for controlling mercury pressure in the filter; and a reactor arranged around the filter such that radiation passes from the low pressure electric discharge lamp through the filter and into Said reactor, the reactor being transparent to ultraviolet light

  18. Apparatus for reducing shock and overpressure

    Science.gov (United States)

    Walter, C.E.

    1975-01-28

    An apparatus for reducing shock and overpressure is particularly useful in connection with the sequential detonation of a series of nuclear explosives under ground. A coupling and decoupling arrangement between adjacent nuclear explosives in the tubing string utilized to emplace the explosives is able to support lower elements on the string but yields in a manner which absorbs energy when subjected to the shock wave produced upon detonation of one of the explosives. Overpressure is accomodated by an arrangement in the string which provides an additional space into which the pressurized material can expand at a predetermined overpressure. (10 claims)

  19. A radiation research apparatus sensitive to wavelength

    International Nuclear Information System (INIS)

    1980-01-01

    The apparatus described is equipped with a radiation source with a tuning device for the generation of X radiation of at least two different wavelength spectra. The detector with ionisation chamber is able to discriminate between these spectra. This is done with the aid of an auxillary electrode between the entrance window and a high voltage electrode. With a lower source of voltage this electrode has a potential equal to the high voltage electrode potential and with a higher voltage source it has a potential equal to the signal electrode potential. (Th.P.)

  20. Process and apparatus for distilling bituminous minerals

    Energy Technology Data Exchange (ETDEWEB)

    Veyrier, J A

    1922-03-27

    This process of distillation of bituminous minerals and particularly bituminous limestone is characterized by the fact that the minerals are introduced into the retort where they stand only the temperature necessary to distill the water and lighter oils that they contain and then are drawn out into the hearth and serve for heating the retort. The apparatus is characterized by the fact that the retort has a screw conveyor, placed in the flue of the hearth, supplied with a chamber for evacuation below this hearth.

  1. Method and apparatus for processing algae

    Science.gov (United States)

    Chew, Geoffrey; Reich, Alton J.; Dykes, Jr., H. Waite; Di Salvo, Roberto

    2012-07-03

    Methods and apparatus for processing algae are described in which a hydrophilic ionic liquid is used to lyse algae cells. The lysate separates into at least two layers including a lipid-containing hydrophobic layer and an ionic liquid-containing hydrophilic layer. A salt or salt solution may be used to remove water from the ionic liquid-containing layer before the ionic liquid is reused. The used salt may also be dried and/or concentrated and reused. The method can operate at relatively low lysis, processing, and recycling temperatures, which minimizes the environmental impact of algae processing while providing reusable biofuels and other useful products.

  2. Improvements in or relating to radiographic apparatus

    International Nuclear Information System (INIS)

    Hounsfield, G.N.

    1978-01-01

    Radiographic apparatus is described for examining part of the interior of a body by means of penetrating radiation including a packing member comprising a bag containing particulate or viscous material, having an absorption to the radiation similar to that of human tissue, the member as a whole being flexible and being adapted to be placed in contact with the body in the vicinity of the part to be examined. Locating means, arranged to maintain the member in place, and means for disposing the locating means in a predetermined position with respect to the source of the radiation are provided. (author)

  3. Fuel injection apparatus for internal combustion engine

    Energy Technology Data Exchange (ETDEWEB)

    Fujisawa, H; Kobayashi, H; Nagata, S

    1975-01-07

    A fuel injection apparatus for a rapid cut of fuel supply to internal combustion engines during deceleration is described. The fuel cut is achieved by an electromagnetic switch. The number of engine revolutions are determined by the movement of cam shafts, and one of the cam shafts is made of electroconductive and nonconductive materials which generate an intermittent electrical signal to the magnetic switch. The device can cut the fuel in any deceleration condition, therefore it is more advantageous than fuel injection utilizing the intake load variation which can operate only under certain deceleration conditions.

  4. Method and apparatus for injecting fluid

    Energy Technology Data Exchange (ETDEWEB)

    Hyde, W E

    1966-07-05

    A method and apparatus are described for injecting grouting material into porous, fractured, unconsolidated, or other formations, whose cohesion is to be increased and/or whose permeability is to be decreased. A tool for injecting the fluid consists of a packer and valves through which the pressurized fluid may pass from the interior of the tool to the packer to expand it. Another valve allows pressure fluid to be vented so as to allow contraction of the packer. A third valve allows a flow of pressurized flow out of the tool and into the material when a predetermined pressure within the tool has been attained. (9 claims)

  5. System and apparatus for neutron radiography

    International Nuclear Information System (INIS)

    Whittemore, W.L.

    1991-01-01

    This patent describes a neutron radiography apparatus. It comprises an imaging plane; a neutron moderator having a cavity defining a convergent collimator, the cavity having a base and converging walls of neutron moderating material terminating at an aperture; a divergent collimator coaxially joined to the cavity at the aperture, the divergent collimator having diverging walls of radiation- absorbing material extending from the aperture to an expanded distal opening for irradiating the imaging plane; sources of neutrons disposed symmetrically about the base of the cavity; a neutron moderating material disposed for maximum neutron thermalization between the sources and the base of the cavity; and means for substantially shielding the plane from electromagnetic energy

  6. Calibration apparatus for a machine-tool

    International Nuclear Information System (INIS)

    Crespin, G.

    1985-01-01

    The invention proposes a calibration apparatus for a machine-tool comprising a torque measuring device, where the tool is driven by a motor of which supply electric current is proportional to the torque applied upon the tool and can be controlled and measured, a housing having an aperture through which the rotatable tool can pass. This device alloys to apply a torque on the tool and to measure it from the supply current of the motor. The invention applies, more particularly to the screwing machines used for the mounting of the core containment plates [fr

  7. ELECTROMAGNETIC APPARATUS FOR MOVING A ROD

    Science.gov (United States)

    Young, J.N.

    1958-04-22

    An electromagnetic apparatus for moving a rod-like member in small steps in either direction is described. The invention has particular application in the reactor field where the reactor control rods must be moved only a small distance and where the use of mechanical couplings is impractical due to the high- pressure seals required. A neutron-absorbing rod is mounted in a housing with gripping uaits that engage the rod, and coils for magnetizing the gripping units to make them grip, shift, and release the rod are located outside the housing.

  8. Apparatus for cooling an electric machine

    Science.gov (United States)

    Palafox, Pepe; Gerstler, William Dwight; Shen, Xiaochun; El-Refaie, Ayman Mohamed Fawzi; Lokhandwalla, Murtuza; Salasoo, Lembit

    2013-07-16

    Provided is an apparatus, for example, for use with a rotating electric machine, that includes a housing. The housing can include a housing main portion and a housing end portion. The housing main portion can be configured to be disposed proximal to a body portion of a stator section of an electric machine. The housing main portion can define a main fluid channel that is configured to conduct fluid therethrough. The housing end portion can receive fluid from said main fluid channel and direct fluid into contact with a winding end portion of a conductive winding of the stator section.

  9. Method and apparatus for computerized tomography

    International Nuclear Information System (INIS)

    1976-01-01

    A method and apparatus is disclosed for examining a plane through a body by detecting the absorption of X- or gamma ray beams directed tangent to concentric rings defined in the body plane as the beams are rotated three hundred sixty degrees around the outside of the body. Signals proportional to the detected beams are used to generate signals proportional to absorption or transmission coefficients of defined concentric ring elements. These coefficients are useful in describing the interior of the body at the plane under examination

  10. Method and apparatus for continuous sampling

    International Nuclear Information System (INIS)

    Marcussen, C.

    1982-01-01

    An apparatus and method for continuously sampling a pulverous material flow includes means for extracting a representative subflow from a pulverous material flow. A screw conveyor is provided to cause the extracted subflow to be pushed upwardly through a duct to an overflow. Means for transmitting a radiation beam transversely to the subflow in the duct, and means for sensing the transmitted beam through opposite pairs of windows in the duct are provided to measure the concentration of one or more constituents in the subflow. (author)

  11. Method and apparatus for simultaneous spectroelectrochemical analysis

    Science.gov (United States)

    Chatterjee, Sayandev; Bryan, Samuel A; Schroll, Cynthia A; Heineman, William R

    2013-11-19

    An apparatus and method of simultaneous spectroelectrochemical analysis is disclosed. A transparent surface is provided. An analyte solution on the transparent surface is contacted with a working electrode and at least one other electrode. Light from a light source is focused on either a surface of the working electrode or the analyte solution. The light reflected from either the surface of the working electrode or the analyte solution is detected. The potential of the working electrode is adjusted, and spectroscopic changes of the analyte solution that occur with changes in thermodynamic potentials are monitored.

  12. Cellular mechanisms within the juxtaglomerular apparatus

    DEFF Research Database (Denmark)

    Briggs, J P; Skøtt, O; Schnermann, J

    1990-01-01

    Cl concentration at the macular densa. This change also results in inhibition of secretion of renin. The macula densa has a unique location near the terminal end of the thick ascending limb, where NaCl concentration is highly flow dependent. The cellular mechanisms by which changes in tubular fluid NaCl produce...... vasoconstriction and inhibition of renin secretion are unknown, but the anatomy of the juxtaglomerular apparatus strongly suggests that such responses may be mediated by the extraglomerular mesangial cells located in the polar cushion underlying the macula densa. Recent evidence suggests that interstitial chloride...

  13. Apparatus for Leak Testing Pressurized Hoses

    Science.gov (United States)

    Underwood, Steve D. (Inventor); Garrison, Steve G. (Inventor); Gant, Bobby D. (Inventor); Palmer, John R. (Inventor)

    2015-01-01

    A hose-attaching apparatus for leak-testing a pressurized hose may include a hose-attaching member. A bore may extend through the hose-attaching member. An internal annular cavity may extend coaxially around the bore. At least one of a detector probe hole and a detector probe may be connected to the internal annular cavity. At least a portion of the bore may have a diameter which is at least one of substantially equal to and less than a diameter of a hose to be leak-tested.

  14. Single beam pass migmacell method and apparatus

    International Nuclear Information System (INIS)

    Maglich, B.C.; Nering, J.E.; Mazarakis, M.G.; Miller, R.A.

    1976-01-01

    The invention provides improvements in migmacell apparatus and method by dispensing with the need for metastable confinement of injected molecular ions for multiple precession periods. Injected molecular ions undergo a 'single pass' through the reaction volume. By preconditioning the injected beam such that it contains a population distribution of molecules in higher vibrational states than in the case of a normal distribution, injected molecules in the single pass exper-ience collisionless dissociation in the migmacell under magnetic influence, i.e., so-called Lorentz dissociation. Dissociationions then form atomic migma

  15. Data eye monitor method and apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Gara, Alan G [Mount Kisco, NY; Marcella, James A [Rochester, MN; Ohmacht, Martin [Yorktown Heights, NY

    2012-01-31

    An apparatus and method for providing a data eye monitor. The data eye monitor apparatus utilizes an inverter/latch string circuit and a set of latches to save the data eye for providing an infinite persistent data eye. In operation, incoming read data signals are adjusted in the first stage individually and latched to provide the read data to the requesting unit. The data is also simultaneously fed into a balanced XOR tree to combine the transitions of all incoming read data signals into a single signal. This signal is passed along a delay chain and tapped at constant intervals. The tap points are fed into latches, capturing the transitions at a delay element interval resolution. Using XORs, differences between adjacent taps and therefore transitions are detected. The eye is defined by segments that show no transitions over a series of samples. The eye size and position can be used to readjust the delay of incoming signals and/or to control environment parameters like voltage, clock speed and temperature.

  16. Outer grid strap protruding spring repair apparatus

    International Nuclear Information System (INIS)

    Widener, W.H.

    1987-01-01

    This patent describes a nuclear fuel assembly grid spring repair apparatus for repairing a spring formed on an outer strap of a fuel assembly grid and having a portion protruding outwardly beyond the strap, the apparatus comprising: (a) a support frame defining an opening and having means defining a guide channel extending along the opening in a first direction; (b) means mounted on the frame and being adjustable for attaching the frame to the outer strap of the support grid so that the frame opening is aligned with the outwardly protruding spring on the outer strap; (c) an outer slide having a passageway defined therethrough and being mounted in the guide channel for reciprocable movement along the frame opening in the first direction for aligning the passageway with the outwardly protruding portion of the spring on the outer strap. The outer slide also has means defining a guide way extending along the passageway in a second direction generally orthogonal to the first direction; (d) a spring reset mechanism being operable for resetting the protruding spring to a nonprotruding position relative to the outer strap when the mechanism is aligned with the protruding portion of the spring; and (e) an inner slide supporting the spring reset mechanism and being mounted to the guide way for reciprocable movement along the passageway of the outer slide in the second direction for aligning the spring reset mechanism with the protruding portion of the spring on the outer strap

  17. Apparatus for delivering and receiving radioactive gas

    International Nuclear Information System (INIS)

    Dansky, B.; Epifano, L.; Farella, R.

    1980-01-01

    An apparatus for delivering and receiving gas to and from a patient, such as for lung ventilation studies. In accordance with the invention there is provided a restrictive breathing chamber adapted for coupling to the patient's breathing organs. A system, including a first check valve, is provided for coupling the breathing chamber to an inflatable gas receptacle so as to allow flow only toward the inflatable gas receptacle. Active gas input apparatus, including a second check valve, is also coupled to the breathing chamber, the second check valve allowing flow only toward the breathing chamber means. First and second auxiliary tubes and a gas filter are also provided. A system is provided for coupling the first auxiliary tube from the inflatable receptacle through the gas filter and to an ambient air environment. The second auxiliary tube is coupled from the inflatable receptacle to an ambient air environment. Finally, a gas pump is switchably coupled as between the first and second auxiliary tubes and operative to selectively cause gas flow in the first auxiliary tube toward the ambient environment, and in the second auxiliary tube toward the inflatable receptacle. A gas trap structure is also disclosed

  18. Method and apparatus for biological sequence comparison

    Science.gov (United States)

    Marr, T.G.; Chang, W.I.

    1997-12-23

    A method and apparatus are disclosed for comparing biological sequences from a known source of sequences, with a subject (query) sequence. The apparatus takes as input a set of target similarity levels (such as evolutionary distances in units of PAM), and finds all fragments of known sequences that are similar to the subject sequence at each target similarity level, and are long enough to be statistically significant. The invention device filters out fragments from the known sequences that are too short, or have a lower average similarity to the subject sequence than is required by each target similarity level. The subject sequence is then compared only to the remaining known sequences to find the best matches. The filtering member divides the subject sequence into overlapping blocks, each block being sufficiently large to contain a minimum-length alignment from a known sequence. For each block, the filter member compares the block with every possible short fragment in the known sequences and determines a best match for each comparison. The determined set of short fragment best matches for the block provide an upper threshold on alignment values. Regions of a certain length from the known sequences that have a mean alignment value upper threshold greater than a target unit score are concatenated to form a union. The current block is compared to the union and provides an indication of best local alignment with the subject sequence. 5 figs.

  19. Apparatus for enhancing tissue repair in mammals

    Science.gov (United States)

    Goodwin, Thomas J. (Inventor); Parker, Clayton R. (Inventor)

    2007-01-01

    An apparatus is disclosed for enhancing tissue repair in mammals, with the apparatus comprising: a sleeve for encircling a portion of a mammalian body part, said sleeve comprising an electrically conductive coil capable of generating an electromagnetic field when an electrical current is applied thereto, means for supporting the sleeve on the mammalian body part; and means for supplying the electrically conductive coil with a square wave time varying electrical current sufficient to create a time varying electromagnetic force of from approximately 0.05 gauss to 0.05 gauss within the interior of the coil in order that when the sleeve is placed on a mammalian body part and the time varying electromagnetic force of from approximately 0.05 gauss to 0.05 gauss is generated on the mammalian body part for an extended period of time, tissue regeneration within the mammalian body part is increased to a rate in excess of the normal tissue regeneration rate that would occur without application of the time varying electromagnetic force.

  20. Experiments with Coler magnetic current apparatus

    Science.gov (United States)

    Ludwig, T.

    Experiments with a replica of the famous Coler "Magnetstromapparat" (magnetic current apparatus) were conducted. The replica was built at the same institute at the Technical University of Berlin where the original was tested by Prof. Kloss in 1925. The details of the setup will be presented in this paper. The investigation of the Coler device was done with modern methods. The output was measured with a digital multi meter (DMM) and a digital storage oscilloscope (DSO). The results of the measurements will be presented. Did Coler convert vacuum fluctuations via magnetic, electric and acoustic resonance into electricity? There is a strong connection between magnetism and quantum field radiation energy. The magnetic moment of the electron is in part an energy exchange with the radiation field. The energy output of the Coler apparatus is measured. Furthermore the dynamics of the ferromagnetic magnets that Coler reported as the working principle of his device was investigated with magnetic force microscopy (MFM) and the spectroscopy mode of an atomic force microscope (AFM). The magnetic and acoustic resonance was investigated with magnetic force microscopy (MFM). The connection between ZPE and magnetism will be discussed as well as the perspective of using magnetic systems as a means to convert vacuum fluctuations into usable electricity.

  1. Apparatus for generating nonlinear pulse patterns

    Science.gov (United States)

    Nakamura, N.M.I.

    Apparatus for generating a plurality of nonlinear pulse patterns from a single linear pulse pattern. A first counter counts the pulses of the linear pulse pattern and a second counter counts the pulses of the nonlinear pulse pattern. A comparator compares the counts of both counters, and in response to an equal count, a gate is enabled to gate a pulse of the linear pattern as a pulse of the nonlinear pattern, the latter also resetting the first counter. Presettable dividers divide the pulses of each pattern before they are counted by the respective counters. Apparatus for generating a logarithmic pulse pattern from a linear pulse pattern to any log base is described. In one embodiment, a shift register is used in place of the second counter to be clocked by each pulse of the logarithmic pattern to generate the pattern. In another embodiment, a memory stores the logarithmic pattern and is addressed by the second counter which is clocked by the pulses of the logarithmic pulse pattern.

  2. Geotechnical deep ocean research apparatus (DORA)

    International Nuclear Information System (INIS)

    1986-01-01

    As part of the research programme on radioactive waste disposal in seabed geological formations, a Deep Ocean Research Apparatus (DORA) seabed machine has been conceptually designed and prototypes of principal subsystems built and tested by four DORA Project partners. The DORA is designed to operate in 6000 m of water and drive a string of test rods and a piezocone about 50 m into soft soil. Partner responsibility was Fugro for project management and the penetration apparatus; ISMES for data acquisition and control; Laboratorium voor Grondmechanica for the piezocone probe and its sensors; and Marine Structure Consultants for the mission profile and DORA handling requirements. The DORA will have a maximum thrust of 50 kN. The probe will measure cone resistance, sleeve friction, pore pressure and inclination. Stability on the seabed will be assisted by using a combination of polyester and polypropylene-nylon (double) braided rope. A continuous wheel-drive subsystem will drive the test rods. Gelled or lead-acid batteries can power a hydraulic powerpack. Acoustic data transmission will be used. Software for data processing automation has been tested with simulation of all input channels. Successful operation of subsystem prototypes indicates that a DORA can be constructed at any future time for use on fundamental or applied deep ocean science and seafloor engineering investigations by industry, government and universities

  3. Portable apparatus for measurement of nuclear radiation

    International Nuclear Information System (INIS)

    Whitlock, G.D.

    1976-01-01

    The apparatus described is claimed to be an improvement of that described in BP 1403265. It comprises a housing having a plastic scintillator sheet located at its base, together with a sealing ring at the base so as to afford a hermetic light-weight seal between a supporting surface and the base of the housing. Photomultiplier means are optically coupled to the scintillator sheet to amplify the scintillations, and a pump is provided to reduce air pressure in the region of the sheet to substantially below atmospheric pressure. The pump has a variable volume chamber, manually operable to reduce the volume, with a releasable latch to secure the pump in the reduced volume condition and a spring to increase the volume of the chamber and thus reduce the air pressure in the region of the scintillator sheet when the latch is released. The pump may be formed by the housing part of which is telescopically slidable within the other part. Alternatively a lever-operated rolling diaphragm pump may be used. With this arrangement there is no need to provide a pressure relief non-return valve to vent air from the apparatus. (U.K.)

  4. Flow analysis techniques for phosphorus: an overview.

    Science.gov (United States)

    Estela, José Manuel; Cerdà, Víctor

    2005-04-15

    A bibliographical review on the implementation and the results obtained in the use of different flow analytical techniques for the determination of phosphorus is carried out. The sources, occurrence and importance of phosphorus together with several aspects regarding the analysis and terminology used in the determination of this element are briefly described. A classification as well as a brief description of the basis, advantages and disadvantages of the different existing flow techniques, namely; segmented flow analysis (SFA), flow injection analysis (FIA), sequential injection analysis (SIA), all injection analysis (AIA), batch injection analysis (BIA), multicommutated FIA (MCFIA), multisyringe FIA (MSFIA) and multipumped FIA (MPFIA) is also carried out. The most relevant manuscripts regarding the analysis of phosphorus by means of flow techniques are herein classified according to the detection instrumental technique used with the aim to facilitate their study and obtain an overall scope. Finally, the analytical characteristics of numerous flow-methods reported in the literature are provided in the form of a table and their applicability to samples with different matrixes, namely water samples (marine, river, estuarine, waste, industrial, drinking, etc.), soils leachates, plant leaves, toothpaste, detergents, foodstuffs (wine, orange juice, milk), biological samples, sugars, fertilizer, hydroponic solutions, soils extracts and cyanobacterial biofilms are tabulated.

  5. Data mining and visualization techniques

    Science.gov (United States)

    Wong, Pak Chung [Richland, WA; Whitney, Paul [Richland, WA; Thomas, Jim [Richland, WA

    2004-03-23

    Disclosed are association rule identification and visualization methods, systems, and apparatus. An association rule in data mining is an implication of the form X.fwdarw.Y where X is a set of antecedent items and Y is the consequent item. A unique visualization technique that provides multiple antecedent, consequent, confidence, and support information is disclosed to facilitate better presentation of large quantities of complex association rules.

  6. Apparatus and methods for investigations into acoustic properties of electronic melts

    International Nuclear Information System (INIS)

    Glazov, V.M.; Timoshenko, V.I.; Kim, S.G.

    1985-01-01

    Apparatus and highly sensitive methods of systematic investigations into acoustic properties of electronic melts are described. A variant of a measuring cell to investigate agressive melts is presented. A new technique for the reception of an acoustic contact with high transmission capacity of ultrasonic wave based on utilization of clarified layers of liquid boron anhydride is described. Results of calibration tests on lead and aluminium melts point to a good agreement with literature data. High sensitivity of the above technique allows one to reveal thin structural effects in melts

  7. Laser-based irradiation apparatus and methods for monitoring the dose-rate response of semiconductor devices

    Science.gov (United States)

    Horn, Kevin M [Albuquerque, NM

    2006-03-28

    A scanned, pulsed, focused laser irradiation apparatus can measure and image the photocurrent collection resulting from a dose-rate equivalent exposure to infrared laser light across an entire silicon die. Comparisons of dose-rate response images or time-delay images from before, during, and after accelerated aging of a device, or from periodic sampling of devices from fielded operational systems allows precise identification of those specific age-affected circuit structures within a device that merit further quantitative analysis with targeted materials or electrical testing techniques. Another embodiment of the invention comprises a broad-beam, dose rate-equivalent exposure apparatus. The broad-beam laser irradiation apparatus can determine if aging has affected the device's overall functionality. This embodiment can be combined with the synchronized introduction of external electrical transients into a device under test to simulate the electrical effects of the surrounding circuitry's response to a radiation exposure.

  8. Experimental apparatus with full optical access for combustion experiments with laminar flames from a single circular nozzle at elevated pressures.

    Science.gov (United States)

    Joo, Peter H; Gao, Jinlong; Li, Zhongshan; Aldén, Marcus

    2015-03-01

    The design and features of a high pressure chamber and burner that is suitable for combustion experiments at elevated pressures are presented. The high pressure combustion apparatus utilizes a high pressure burner that is comprised of a chamber burner module and an easily accessible interchangeable burner module to add to its flexibility. The burner is well suited to study both premixed and non-premixed flames. The optical access to the chamber is provided through four viewports for direct visual observations and optical-based diagnostic techniques. Auxiliary features include numerous access ports and electrical connections and as a result, the combustion apparatus is also suitable to work with plasmas and liquid fuels. Images of methane flames at elevated pressures up to 25 atm and preliminary results of optical-based measurements demonstrate the suitability of the high pressure experimental apparatus for combustion experiments.

  9. A multifunctional microwave plasma reaction apparatus and its applications

    International Nuclear Information System (INIS)

    Wang Xizhang; Wu Qiang; Hu Zheng; Xu Hua; Miao Shui; Chen Yi

    2000-01-01

    A multifunctional apparatus for microwave plasma reaction has been set up, which can be used in the fields such as chemical synthesis, surface modification, and heterogeneous catalysis. The apparatus has laid an experimental foundation for new methods, new technologies, and new train of thoughts to be explored

  10. Apparatus as Milestones in the History of Comparative Psychology

    Science.gov (United States)

    Washburn, David A.; Rumbaugh, Duane M.; Putney, R. Thompson

    1994-01-01

    Significant apparatus developments from the history of comparative psychology are reviewed, including the contemporary trend toward computer use in research with nonhuman animals. It is argued that milestone apparatus served not only to open new lines of inquiry but also to shape or delimit the nature of the answers that were obtained.

  11. 46 CFR 160.010-6 - Capacity of buoyant apparatus.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Capacity of buoyant apparatus. 160.010-6 Section 160.010-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND... apparatus is not considered in determining the capacity. (b) [Reserved] ...

  12. 49 CFR 234.211 - Security of warning system apparatus.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Security of warning system apparatus. 234.211... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.211 Security of warning system apparatus...

  13. Past and present of measuring apparatus for nuclear medicine

    International Nuclear Information System (INIS)

    Murayama, Hideo

    2013-01-01

    The history of advancement of measuring apparatus for nuclear medicine is looked back. It is presented that Japanese contribution to these advancement has been in no small quantities. The future view carrying the measuring apparatus for nuclear medicine is also described. (M.H.)

  14. Simple and Low-Cost Exposed -Layer Grain Drying Apparatus ...

    African Journals Online (AJOL)

    Thin-layer drying apparatus was developed from standard “off-the- shelf” equipment: a fan convection laboratory oven and a weighing scale. Using this apparatus the thin-layer drying data for wheat under constant conditions were obtained for a range of drying air temperature from 30°C to 150°C and the initial moisture ...

  15. Apparatus for the laser ablative synthesis of carbon nanotubes

    Science.gov (United States)

    Smith, Michael W.; Jordan, Kevin

    2010-02-16

    An RF-induction heated side-pumped synthesis chamber for the production of carbon nanotubes. Such an apparatus, while capable of producing large volumes of carbon nanotubes, concurrently provides a simplified apparatus that allows for greatly reduced heat up and cool down times and flexible flowpaths that can be readily modified for production efficiency optimization.

  16. Apparatus For Eddy-Current Inspection Of Bolts

    Science.gov (United States)

    Amos, Jay M.

    1994-01-01

    Eddy-current apparatus for inspection of bolts, studs, and other threaded fasteners detects flaws in threads, shanks, and head fillets. With help of apparatus, technician quickly inspects fasteners of various dimensions. Accommodates fasteners with diameters from 0.190 in. to 1 in. and with lengths up to 5 in. Basic design modified to accommodate fasteners of other sizes.

  17. Apparatus for the ammonium recovery from liquid animal manure

    NARCIS (Netherlands)

    Starmans, D.A.J.; Timmerman, M.

    2013-01-01

    Nitrogen present in animal manure can be a limiting factor when considering manure application rates onto arable land. EU-regulations triggered the development of a new ammonia exchange apparatus for the recovery of ammonia. The described apparatus has a liquid to liquid ammonia mass transfer

  18. Apparatus for enrichment of uranium by double photoionization

    International Nuclear Information System (INIS)

    Laude, J.P.

    1983-11-01

    The present invention concerns enrichment of uranium by double photoionization. The use of a beam from a dye laser for excitation of gaseous uranium is known and the present invention concerns an apparatus of this type. The purpose of the invention is essentially to produce an apparatus having high energy efficiency. This is achieved according to the invention by using a continuous wave laser

  19. 21 CFR 862.2485 - Electrophoresis apparatus for clinical use.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Electrophoresis apparatus for clinical use. 862.2485 Section 862.2485 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... Instruments § 862.2485 Electrophoresis apparatus for clinical use. (a) Identification. An electrophoresis...

  20. Pressure suppression apparatus of a nuclear power plant

    International Nuclear Information System (INIS)

    Mizumachi, W.; Funalashi, T.

    1980-01-01

    Pressure suppression apparatus for a nuclear reactor comprises a vessel surrounding a reactor pressure vessel and containing a water pool at the bottom of the vessel, and a steam exhaust pipe. The apparatus further comprises an exhaust chamber connected to the immersed portion of the exhaust pipe and provided with a number of discharge openings. (auth)

  1. 7 CFR 801.9 - Tolerances for test weight apparatuses.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Tolerances for test weight apparatuses. 801.9 Section 801.9 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS... PERFORMANCE REQUIREMENTS FOR GRAIN INSPECTION EQUIPMENT § 801.9 Tolerances for test weight apparatuses. The...

  2. Method for Surface Scanning in Medical Imaging and Related Apparatus

    DEFF Research Database (Denmark)

    2015-01-01

    A method and apparatus for surface scanning in medical imaging is provided. The surface scanning apparatus comprises an image source, a first optical fiber bundle comprising first optical fibers having proximal ends and distal ends, and a first optical coupler for coupling an image from the image...

  3. Pulsed wire discharge apparatus for mass production of copper nanopowders.

    Science.gov (United States)

    Suematsu, H; Nishimura, S; Murai, K; Hayashi, Y; Suzuki, T; Nakayama, T; Jiang, W; Yamazaki, A; Seki, K; Niihara, K

    2007-05-01

    A pulsed wire discharge (PWD) apparatus for the mass production of nanopowders has been developed. The apparatus has a continuous wire feeder, which is operated in synchronization with a discharging circuit. The apparatus is designed for operation at a maximum repetition rate of 1.4 Hz at a stored energy of 160 J. In the present study, Cu nanopowder was synthesized using the PWD apparatus and the performance of the apparatus was examined. Cu nanopowder of 2.0 g quantity was prepared in N(2) gas at 100 kPa for 90 s. The particle size distribution of the Cu nanopowder was analyzed by transmission electron microscopy and the mean surface diameter was determined to be 65 nm. The ratio of the production mass of the powder to input energy was 362 g/kW h.

  4. Device for discharging drain in a control rod driving apparatus

    International Nuclear Information System (INIS)

    Ikeda, Tadasu; Ikuta, Takuzo; Yoshida, Tomiji; Tsukahara, Katsumi.

    1975-01-01

    Object: To efficiently and safely collect and discharge drain by a simple construction in which a drain cover and a drain tank in a control rod driving apparatus are integrally formed, and an overhauling wrench of said apparatus and a drain hose are mounted on the drain tank. Structure: When a mounting bolt is untightened by a torque wrench so as to be removed from a flange surface of the control rod driving apparatus in a nuclear reactor, axial movement of said apparatus is absorbed by a spring so that drain containing a radioactive material is discharged into a drain tank through the flange surface of said apparatus and is then guided into a collecting tank through a drain hose. (Kamimura, M.)

  5. Model of Coupled Drives Apparatus – Static and Dynamic Characteristics

    Directory of Open Access Journals (Sweden)

    Chalupa Petr

    2016-01-01

    Full Text Available The paper presents an initial part of a modelling the Coupled Drives Apparatus CE108 developed by TecQuipment Ltd. The final model should be used in the process of control design for the apparatus. The model derived by the developers of the apparatus using first-principle modelling is used as a starting point for comparison of its properties with measured characteristics. The static and dynamic characteristics of the real-time apparatus are presented and discussed. Special attention is paid to principal differences between the model and the real-time apparatus. Real-time measurements are obtained using MATLAB / Simulink environment in connection with a Real-time Toolbox. Evaluation of the experiments is also performed in the MATLAB environment

  6. Experiences with decontaminating tritium-handling apparatus

    International Nuclear Information System (INIS)

    Maienschein, J.L.; Garcia, F.; Garza, R.G.; Kanna, R.L.; Mayhugh, S.R.; Taylor, D.T.

    1992-01-01

    Tritium-handling apparatus has been decontaminated as part of the downsizing of the LLNL Tritium Facility. Two stainless-steel glove boxes that had been used to process lithium deuteride-tritide (LiDT) slat were decontaminated using the Portable Cleanup System so that they could be flushed with room air through the facility ventilation system. In this paper the details on the decontamination operation are provided. A series of metal (palladium and vanadium) hydride storage beds have been drained of tritium and flushed with deuterium, in order to remove as much tritium as possible. The bed draining and flushing procedure is described, and a calculational method is presented which allows estimation of the tritium remaining in a bed after it has been drained and flushed. Data on specific bed draining and flushing are given

  7. Methods And Apparatus For Acoustic Fiber Fractionation

    Science.gov (United States)

    Brodeur, Pierre

    1999-11-09

    Methods and apparatus for acoustic fiber fractionation using a plane ultrasonic wave field interacting with water suspended fibers circulating in a channel flow using acoustic radiation forces to separate fibers into two or more fractions based on fiber radius, with applications of the separation concept in the pulp and paper industry. The continuous process relies on the use of a wall-mounted, rectangular cross-section piezoelectric ceramic transducer to selectively deflect flowing fibers as they penetrate the ultrasonic field. The described embodiment uses a transducer frequency of approximately 150 kHz. Depending upon the amount of dissolved gas in water, separation is obtained using a standing or a traveling wave field.

  8. Automatic control of oscillatory penetration apparatus

    Science.gov (United States)

    Lucon, Peter A

    2015-01-06

    A system and method for controlling an oscillatory penetration apparatus. An embodiment is a system and method for controlling a sonic drill having a displacement and an operating range and operating at a phase difference, said sonic drill comprising a push-pull piston and eccentrics, said method comprising: operating the push-pull piston at an initial push-pull force while the eccentrics are operated at a plurality of different operating frequencies within the operating range of the sonic drill and measuring the displacement at each operating frequency; determining an efficient operating frequency for the material being drilled and operating the eccentrics at said efficient operating frequency; determining the phase difference at which the sonic drill is operating; and if the phase difference is not substantially equal to minus ninety degrees, operating the push-pull piston at another push-pull force.

  9. Solar energy apparatus with apertured shield

    Science.gov (United States)

    Collings, Roger J. (Inventor); Bannon, David G. (Inventor)

    1989-01-01

    A protective apertured shield for use about an inlet to a solar apparatus which includesd a cavity receiver for absorbing concentrated solar energy. A rigid support truss assembly is fixed to the periphery of the inlet and projects radially inwardly therefrom to define a generally central aperture area through which solar radiation can pass into the cavity receiver. A non-structural, laminated blanket is spread over the rigid support truss in such a manner as to define an outer surface area and an inner surface area diverging radially outwardly from the central aperture area toward the periphery of the inlet. The outer surface area faces away from the inlet and the inner surface area faces toward the cavity receiver. The laminated blanket includes at least one layer of material, such as ceramic fiber fabric, having high infra-red emittance and low solar absorption properties, and another layer, such as metallic foil, of low infra-red emittance properties.

  10. Method and apparatus for inspecting tires

    International Nuclear Information System (INIS)

    Fox, R.L.T.

    1975-01-01

    A method and apparatus for inspecting tires by the use of x-rays is disclosed in which a tire is advanced to an inspection station, engaged along opposite bead rims and inflated to axially spread the bead rims and side walls. An x-ray source is advanced axially into the tire and the tire is eccentrically rotated relative to the x-ray source to enable radial positioning of the source relative to the tire near the tire bead rim diameter without requiring radial movement of the x-ray source. The x-ray source produces an x-ray beam which sweeps about the interior of the expanded tire from bead rim to bead rim while the tire is rotated about its centerline. An x-ray detection system detects x-rays which have penetrated the wall and produces inspection information concerning the tire construction. (Patent Office Record)

  11. Method and apparatuses for ion cyclotron spectrometry

    Science.gov (United States)

    Dahl, David A [Idaho Falls, ID; Scott, Jill R [Idaho Falls, ID; McJunkin, Timothy R [Idaho Falls, ID

    2012-03-06

    An ion cyclotron spectrometer may include a vacuum chamber that extends at least along a z-axis and means for producing a magnetic field within the vacuum chamber so that a magnetic field vector is generally parallel to the z-axis. The ion cyclotron spectrometer may also include means for producing a trapping electric field within the vacuum chamber. The trapping electric field may comprise a field potential that, when taken in cross-section along the z-axis, includes at least one section that is concave down and at least one section that is concave up so that ions traversing the field potential experience a net magnetron effect on a cyclotron frequency of the ions that is substantially equal to zero. Other apparatuses and a method for performing ion cyclotron spectrometry are also disclosed herein.

  12. Multiple sample, radioactive particle counting apparatus

    International Nuclear Information System (INIS)

    Reddy, R.R.V.; Kelso, D.M.

    1978-01-01

    An apparatus is described for determining the respective radioactive particle sample count being emitted from radioactive particle containing samples. It includes means for modulating the information on the radioactive particles being emitted from the samples, coded detecting means for sequentially detecting different respective coded combinations of the radioactive particles emitted from more than one but less than all of the samples, and processing the modulated information to derive the sample count for each sample. It includes a single light emitting crystal next to a number of samples, an encoder belt sequentially movable between the crystal and the samples. The encoder belt has a coded array of apertures to provide corresponding modulated light pulses from the crystal, and a photomultiplier tube to convert the modulated light pulses to decodable electrical signals for deriving the respective sample count

  13. Apparatus for electron beam irradiation of objects

    International Nuclear Information System (INIS)

    Dmitriev, S.P.; Ivanov, A.S.; Sviniin, M.P.; Fedotov, M.T.

    1984-01-01

    This patent provides an apparatus for electron beam irradiation of objects, comprising a shaper of a ribbon-shaped electron beam and a deflecting electromagnet having a frame-type magnetic circuit and used to direct said electron beam onto an irradiated object substantially at an angle of 90 degrees. The deflecting electromagnet has two poles extended over the width of the irradiated object and comprises two windings embracing said poles and connected to a d.c. source. The deflecting electromagnet is arranged in such a manner that the trajectories of the electrons at an area from the shaper to the electromagnet are inclined to the plane of the frame of its magnetic circuit

  14. Apparatus for sectioning demountable semiconductor samples

    Science.gov (United States)

    Sopori, B.L.; Wolf, A.

    1984-01-01

    Apparatus for use during polishing and sectioning operations of a ribbon sample is described. The sample holder includes a cylinder having an axially extending sample cavity terminated in a first funnel-shaped opening and a second slot-like opening. A spring-loaded pressure plunger is located adjacent the second opening of the sample cavity for frictional engagement of the sample cavity. A heat softenable molding medium is inserted in the funnel-shaped opening, to surround the sample. After polishing, the heater is energized to allow draining of the molding medium from the sample cavity. During manual polishing, the second end of the sample holder is inserted in a support ring which provides mechanical support as well as alignment of the sample holder during polishing. A gauge block for measuring the protrusion of a sample beyond the second wall of the holder is also disclosed.

  15. Method and apparatus for altering material

    Science.gov (United States)

    Stinnett, Regan W.; Greenly, John B.

    2002-02-05

    Methods and apparatus for thermally altering the near surface characteristics of a material are described. In particular, a repetitively pulsed ion beam system comprising a high energy pulsed power source and an ion beam generator are described which are capable of producing single species high voltage ion beams (0.25-2.5 MeV) at 1-1000 kW average power and over extended operating cycles (10.sup.8). Irradiating materials with such high energy, repetitively pulsed ion beams can yield surface treatments including localized high temperature anneals to melting, both followed by rapid thermal quenching to ambient temperatures to achieve both novel and heretofore commercially unachievable physical characteristics in a near surface layer of material.

  16. Casimir apparatuses in a weak gravitational field

    DEFF Research Database (Denmark)

    Bimonte, Giuseppe; Calloni, Enrico; Esposito, Giampiero

    2009-01-01

    We review and assess a part of the recent work on Casimir apparatuses in the weak gravitational field of the Earth. For a free, real massless scalar field subject to Dirichlet or Neumann boundary conditions on the parallel plates, the resulting regularized and renormalized energy-momentum tensor...... is covariantly conserved, while the trace anomaly vanishes if the massless field is conformally coupled to gravity. Conformal coupling also ensures a finite Casimir energy and finite values of the pressure upon parallel plates. These results have been extended to an electromagnetic field subject to perfect...... conductor (hence idealized) boundary conditions on parallel plates, by various authors. The regularized and renormalized energy-momentum tensor has beene valuated up to second order in the gravity acceleration. In both the scalar and the electromagnetic case, studied to first order in the gravity...

  17. Apparatus for irradiation with electron beam

    International Nuclear Information System (INIS)

    Uehara, K.; Ito, A.; Nishimune, K.; Fujita, K.

    1976-01-01

    An irradiation apparatus with high energy electrons is disclosed in which a wire shaped or linear object to be irradiated is moved back and forth many times under an electron window so as to irradiate it with an electron beam. According to one feature of the invention, an electron beam, which leaks through gaps between the objects to be irradiated or which penetrates the objects to be irradiated, is reversed by a magnetic field approximately perpendicular to the scanning face of the electron beam by means of a magnet which is disposed under the objects to be irradiated, and the reversed electron beam is thereby again applied to the objects to be irradiated. A high utilization rate of the electron beam is accomplished, and the objects can be thereby uniformly irradiated with the electron beam. 4 claims, 6 drawing figures

  18. Methods and apparatuses for deoxygenating pyrolysis oil

    Science.gov (United States)

    Baird, Lance Awender; Brandvold, Timothy A.; Frey, Stanley Joseph

    2017-09-12

    Methods and apparatuses are provided for deoxygenating pyrolysis oil. A method includes contacting a pyrolysis oil with a deoxygenation catalyst in a first reactor at deoxygenation conditions to produce a first reactor effluent. The first reactor effluent has a first oxygen concentration and a first hydrogen concentration, based on hydrocarbons in the first reactor effluent, and the first reactor effluent includes an aromatic compound. The first reactor effluent is contacted with a dehydrogenation catalyst in a second reactor at conditions that deoxygenate the first reactor effluent while preserving the aromatic compound to produce a second reactor effluent. The second reactor effluent has a second oxygen concentration lower than the first oxygen concentration and a second hydrogen concentration that is equal to or lower than the first hydrogen concentration, where the second oxygen concentration and the second hydrogen concentration are based on the hydrocarbons in the second reactor effluent.

  19. Apparatus for concentrating by dual temperature exchange

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1975-01-01

    The dual temperature exchange apparatus, with a dual temperature stage having a hot processing tower and a cold processing tower, is provided with means for transferring heat from the hot processed gas to both liquid and gas being delivered to the hot processing tower. The heat exchange system provides means for effecting direct contact between the hot processed gas and the cold processed liquid being delivered to the hot tower, means for establishing a circulation of the resulting heated processed liquid, and means including an indirect contact exchanger for transferring heat from said circulation to condition the gas being supplied to the hot processing tower. The reactants in the example given are hydrogen sulfide gas and liquid water

  20. Method and apparatus for producing synthesis gas

    Science.gov (United States)

    Hemmings, John William; Bonnell, Leo; Robinson, Earl T.

    2010-03-03

    A method and apparatus for reacting a hydrocarbon containing feed stream by steam methane reforming reactions to form a synthesis gas. The hydrocarbon containing feed is reacted within a reactor having stages in which the final stage from which a synthesis gas is discharged incorporates expensive high temperature materials such as oxide dispersed strengthened metals while upstream stages operate at a lower temperature allowing the use of more conventional high temperature alloys. Each of the reactor stages incorporate reactor elements having one or more separation zones to separate oxygen from an oxygen containing feed to support combustion of a fuel within adjacent combustion zones, thereby to generate heat to support the endothermic steam methane reforming reactions.

  1. An apparatus for cattle-blood irradiation

    International Nuclear Information System (INIS)

    Damdinsuerehn, S.; Gunaadzav, T.; Chueltehm, D.; Sajnkhueue, Zh.; Byambaa, S.; Moenkhtsehtsehg, N.; Dorzhnyambuu, B.

    1989-01-01

    An apparatus for cattle-blood irradiation in vitro by low intensity ultraviolet light (10-12 w/m 2 ) emitted by mercury-quartz lamp at the wavelength range of 254-280 nm has been constructed. For this purpose a simple connection circuit for shunting the source electrodes by effective resistance and switching on electrical network in series through capacitor is presented. Stabilized cattle blood for UV-irradiation is running through 5mm diameter quartz tubes at the distance of 15mm from UV-lamp. Irradiated in this way blood sample is administered intravenously or intramuscular in various way. Method of using this source in veterinary practice is developed. Results of the use of this method during the last 4-5 years demonstrate the efficiency of treating and preventing from desease could be above 80%. 1 fig. (B.Sh.)

  2. Method and apparatus for synthesizing hydrocarbons

    Science.gov (United States)

    Colmenares, C.A.; Somorjai, G.A.; Maj, J.J.

    1985-04-16

    A method and apparatus for synthesizing a mixture of aliphatic alcohols having five carbons or less is disclosed. An equal molar ratio of CO and H/sub 2/ gases is caused to pass through a ThO/sub 2/ catalyst having a surface area of about 80 to 125 m/sup 2//g. The catalyst further optionally includes Na ions present as substitutional cations in an amount of about 5 to 10 atom %. At a temperature of about 570 to 630/sup 0/K, and at pressures of about 20 to 50 atm, methanol and isobutanol are the predominant products and are produced in amounts of about 90 wt % of the total hydrocarbon mixture. 6 figs.

  3. Foam generator and viscometer apparatus and process

    Science.gov (United States)

    Reed, Troy D.; Pickell, Mark B.; Volk, Leonard J.

    2004-10-26

    An apparatus and process to generate a liquid-gas-surfactant foam and to measure its viscosity and enable optical and or electronic measurements of physical properties. The process includes the steps of pumping selected and measured liquids and measured gases into a mixing cell. The mixing cell is pressurized to a desired pressure and maintained at a desired pressure. Liquids and gas are mixed in the mixing cell to produce a foam of desired consistency. The temperature of the foam in the mixing cell is controlled. Foam is delivered from the mixing cell through a viscometer under controlled pressure and temperature conditions where the viscous and physical properties of the foam are measured and observed.

  4. Present status of radiation-pasteurization apparatus

    International Nuclear Information System (INIS)

    Mio, Keigo

    2006-01-01

    Electron beams with the energy less than 10 MeV can be utilized to destroy directly DNA of microorganism or indirectly via OH radicals produced from water which may diffuse toward the DNA. The article summarizes the features of radiation pasteurization in general, using X-rays or electron beams, followed by stating the advantage claimed for electron beam treatment compared to X-ray treatment. The article explains various types of electron-beam accelerators now used for pasteurization and food preservation. For this purposes some specific apparatus are introduced with which food irradiation facilities should be equipped, for example beam scanning systems and sample transport systems with an automatic switch for door open-shut. The objects of each type of food to be irradiated and necessary dose range are tabulated. Finally, some recent problems regarding food irradiation are discussed: possible radioactivity induced by irradiation, use of methyl bromide instead of irradiation, etc. (S. Ohno)

  5. Apparatus for Removing Remaining Adhesives of Filter

    International Nuclear Information System (INIS)

    Kang, Il Sik; Kim, Tae Kuk; Hong, Dae Seok; Ji, Young Yong; Ryu, Woo Seog

    2010-01-01

    A Large amount of ventilation filter was used at radiation areas not only in nuclear power plants but also in nuclear facilities. These spent ventilation filters are generated as radioactive waste and composed of a steel frame, glass fiber media and aluminum separator. When treated, the spent filter is separated into filter media for air purification and frame. After separation, while the filter media is collected using steel drum for reducing internal exposure, the filter frame is treated further to remove adhesives for recycling the frame as many as possible in order to reduce waste and cost and improve working conditions. Usually, the adhesives are separated from the filter frame manually. As a result, a lot of time and labor is required. So, the objective of this study is to develop a motor-driven apparatus for removing adhesives efficiently

  6. Apparatus for diffusion-gap thermal desalination

    Science.gov (United States)

    Lowenstein, Andrew

    2017-09-26

    A thermal distillation apparatus including evaporation surfaces that are wetted with a solution, and from which at least some of the volatile solvent contained in the solution evaporates, condensers having an external surface in close proximity to, but not touching, a corresponding one of the one or more evaporation surfaces, and on which vapors of the solvent condense, releasing thermal energy that heats a flow of the solution moving upward within the condensers, spacers that prevent contact between the evaporating surfaces and the condensers, wherein spaces between the evaporating surfaces and the condensers are filled with a gaseous mixture composed of solvent vapor and one or more non-condensable gases, and except for diffusion of the solvent vapor relative to the non-condensable gases, the gaseous mixture is stationary.

  7. Starting apparatus for internal combustion engines

    Science.gov (United States)

    Dyches, Gregory M.; Dudar, Aed M.

    1997-01-01

    An internal combustion engine starting apparatus uses a signal from a curt sensor to determine when the engine is energized and the starter motor should be de-energized. One embodiment comprises a transmitter, receiver, computer processing unit, current sensor and relays to energize a starter motor and subsequently de-energize the same when the engine is running. Another embodiment comprises a switch, current transducer, low-pass filter, gain/comparator, relay and a plurality of switches to energize and de-energize a starter motor. Both embodiments contain an indicator lamp or speaker which alerts an operator as to whether a successful engine start has been achieved. Both embodiments also contain circuitry to protect the starter and to de-energize the engine.

  8. Seal Apparatus and Methods to Manufacture Thereof

    Science.gov (United States)

    Richard, James A. (Inventor)

    2013-01-01

    In some implementations, apparatus and methods are provided through which a dynamic cryogenic seal is manufactured. In some implementations, the seal includes a retainer and a spring-seal assembly, the assembly being comprised of a main spring housing and fluorine-containing polymer seals. In some implementations, either a radial seal, or an axial (or "piston seal") is provided. In some implementations, methods of manufacturing the dynamic cryogenic seal are also provided. In some implementations, the methods include assembling the components while either heated or cooled, taking advantage of thermal expansion and contraction, such that there is a strong interference fit between the components at room temperature. In some implementations, this process ensures that the weaker fluorine-containing polymer seal is forced to expand and contract with the stronger retainer and spring and is under constant preload. In some implementations, the fluorine-containing polymer is therefore fluidized and retained, and can not lift off.

  9. Apparatus for generating x-ray holograms

    Science.gov (United States)

    Rhodes, Charles K.; Boyer, Keith; Solem, Johndale C.; Haddad, Waleed S.

    1990-01-01

    Apparatus for x-ray microholography of living biological materials. A Fourier transform holographic configuration is described as being most suitable for the 3-dimensional recording of the physical characteristics of biological specimens. The use of a spherical scatterer as a reference and a charge-coupled device two-dimensional detector array placed in the forward direction relative to the incident x-radiation for viewing electromagnetic radiation simultaneously scattered from both the specimen and the reference scatterer permits the ready reconstruction of the details of the specimen from the fringe pattern detected by the charge-coupled device. For example, by using a nickel reference scatter at 4.5 nm, sufficient reference illumination is provided over a wide enough angle to allow similar resolution in both transverse and longitudinal directions. Both laser and synchrotron radiation sources are feasible for generating microholographs. Operation in the water window (2.4 to 4.5 nm) should provide maximum contrast for features of the specimen and spatial resolution on the order of the wavelength of x-radiation should be possible in all three dimensions, which is sufficient for the visualization of many biological features. It is anticipated that the present apparatus will find utility in other areas as well where microscopic physical details of a specimen are important. A computational procedure which enables the holographic data collected by the detector to be used to correct for misalignments introduced by inexact knowledge of the relative positions of the spherical reference scatterer and the sample under investigation has been developed. If the correction is performed prior to reconstruction, full compensation can be achieved and a faithfully reconstructed image produced.

  10. [IMPACT OF SIX COOKING TECHNIQUES ON FATTY ACID COMPOSITION OF MARLIN (MAKAIRA NIGRICANS) AND HAKE (MERLUCCIUS PRODUCTUS)].

    Science.gov (United States)

    Castro-González, María Isabel; Carrillo-Domínguez, Silvia

    2015-09-01

    the regular consumption of fish brings benefits to health due to its content of n-3 fatty acids, but cooking enhances or damages the concentration of fatty acids (FA) since they are susceptible to oxidation by temperatures and cooking times. to analyze the effect of six cooking techniques on total lipids (TL) and (FA) content in marlin and hake and select which one helps the best conservation of health beneficial FA. fillets were subjected to different cooking techniques: steam (ST), foiled-aluminum-paper (FAP), foiled- banana-leaf (FBL), gas-oven (GO), microwave-oven (MO) and fried-lightly (FL). FA were identified by gas chromatography/FID. Marlin: FL increased the concentration of TL and MO decreased it. Statistically, PUFA, SFA and EPA + DHA increased with FAP, MUFA decreased with FBL and increased in FL. Hake: FL increased concentration in all groups of FA while ST decreased it. SFA values and index of atherogenicity (IA), thrombogenicity (IT), peroxidisability and hipocolesterolemic/ hipercolesterolemic fatty acid ratio (HH) found, suggested that hake is a fish with greater health benefits, regardless of the technique you employ. By its EPA + DHA content, marlin seems to be an excellent choice if cooked FAP. FL technique in both species decreased the IA, IT and significantly increased the HH; however n3/n6 ratio decreased. ST seems to be the least desirable cooking technique for both species. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

  11. Detection of corrosion by a radiometric technique

    International Nuclear Information System (INIS)

    Charlton, J.S.; Ross, J.F.

    1975-01-01

    A method is described for the detection and measurement of corrosion in metal tube bundles using a radioisotope technique. The method is stated to be accurate and quick, and dismantling is unnecessary. A radioactive source is inserted into one of the tubes of the bundle and radiation detectors are inserted into the remainder of the tubes, which may be up to six in number with the apparatus described. The radiation absorption by the walls of each pair of tubes is compared with a standard measurement representing a known thickness of the material of the tubes. Simultaneous measurements may be made. Suitable apparatus is described in detail. (U.K.)

  12. Slit aperture technique for mammography

    International Nuclear Information System (INIS)

    Friedrich, M.

    1984-01-01

    Following a discussion of various principles used in the elimination of scatter, the prototype of a simple slit aperture mammography apparatus is described (modified Mammomat, Siemens). The main advantage of this technique compared with grid mammography is a halving of the radiation dose for identical image quality, using an identical film system. The technical requirements (heavy duty tube, new generator) are, however, considerable. If the film-screen systems currently in use are to remain the common systems for the future, then the development of a multi-lamellar slit diaphragm technique carries much promise for mammography. (orig.) [de

  13. Apparatus Producing an Even Distribution of Strain into Carries

    Science.gov (United States)

    Hrabovský, Leopold

    2017-10-01

    In many high-rise residential buildings or multi-storey warehouses, machinery, so called lifts, is used for the vertical transportation of people or weights between two or more altitudinally distant places. Carriers used for lifts are steel ropes or sprocket chains, on which a cage or a counterbalance is hinged. Apparatus of all carriers, attached to the hinge of the cage or counterbalance, should be even. This can be made only by hammer hinge. Fixed or springe hinge cannot be a perfect equalizing apparatus. This article describes an apparatus, which allows an even distribution of the strain into lift carriers, which use springe hinge of carrier ropes.

  14. Apparatus to simulate nuclear heating in advanced fuels

    International Nuclear Information System (INIS)

    Wrona, B.J.; Galvin, T.M.; Johanson, E.

    1976-10-01

    A direct-electrical-heating apparatus has been built to simulate in-reactor temperature gradients and heating conditions in both the mixed nitrides and carbides of uranium and plutonium. The apparatus has the capability for the investigation and direct observation of fuel-behavior phenomena that should significantly enlarge the data base on mixed carbides and nitrides at temperatures near and above their melting points. In addition to heating UC, results of prooftests showed that the apparatus has the capability to heat graphite, 30 vol % ZrC in graphite, B 4 C control-rod pellets, and stainless steel

  15. Article separation apparatus and method for unit operations

    Science.gov (United States)

    Pardini, Allan F.; Gervais, Kevin L.; Mathews, Royce A.; Hockey, Ronald L.

    2010-06-22

    An apparatus and method are disclosed for separating articles from a group of articles. The apparatus includes a container for containing one or more articles coupled to a suitable fluidizer for suspending articles within the container and transporting articles to an induction tube. A portal in the induction tube introduces articles singly into the induction tube. A vacuum pulls articles through the induction tube separating the articles from the group of articles in the container. The apparatus and method can be combined with one or more unit operations or modules, e.g., for inspecting articles, assessing quality of articles, or ascertaining material properties and/or parameters of articles, including layers thereof.

  16. Development of counting system for wear measurements using Thin Layer Activation and the Wearing Apparatus

    Energy Technology Data Exchange (ETDEWEB)

    França, Michel de A.; Suita, Julio C.; Salgado, César M., E-mail: mchldante@gmail.com, E-mail: suita@ien.gov.br, E-mail: otero@ien.gov.br [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2017-07-01

    This paper focus on developing a counting system for the Wearing Apparatus, which is a device previously built to generate measurable wear on a given surface (Main Source) and to carry the fillings from it to a filter (second source). The Thin Layer Activation is a technique used to produce activity on one of the Wearing Apparatus' piece, this activity is proportional to the amount of material worn, or scrapped, from the piece's surface. Thus, by measuring the activity on those two points it is possible to measure the produced wear. The methodology used in this work is based on simulations through MCNP-X Code to nd the best specifications for shielding, solid angles, detectors dimensions and collimation for the Counting System. By simulating several scenarios, each one different from the other, and analyzing the results in the form of Counts Per Second, the ideal counting system's specifications and geometry to measure the activity in the Main Source and the Filter (second source) is chosen. After that, a set of previously activated stainless steel foils were used to reproduce the real experiments' conditions, this real experiment consists of using TLA and the Wearing Apparatus, the results demonstrate that the counting system and methodology are adequate for such experiments. (author)

  17. Bone densitometry by gamma ray attenuation measurement. Development of an apparatus for use on medullary casualties

    International Nuclear Information System (INIS)

    Berard, E.J.-J.

    1975-01-01

    We proposed to follow changes in the bone mineral content of medullary damage cases by measuring the attenuation of a monoenergetic gamma ray according to the Cameron and Sorenson technique. Apart from their high cost, existing instruments are not designed for this bedside observation of patients. Our aim was therefore to design and develop an easily portable, inexpensive apparatus. The γ radiation is supplied by a sealed 125 I source fitted with a narrow collimator. The battery-operated scintillation detector is that used to detect post-operative phlebites after injection of radio-fibrinogen. The source-detector unit can move to allow a transverse bone mineral content measurement. Data from the detector are processed electronically and the results given: - either graphically on a tracing board which gives an area proportional to the bone mineral content, - or numerically by means of an integrator computing this area and supplying the linear bone density directly. Experiments carried out in vivo showed the apparatus to be sensitive and the measurements reproducible, the results obtained being comparable with those of other authors. Using pieces of embalmed bone moreover an excellent correlation was observed between the bone mineral content obtained after incineration and the results displayed by our apparatus, which can therefore be calibrated [fr

  18. Comparative study of two techniques for assessing fat intake in a Mediterranean diet. The influence of culinary oils changes.

    Science.gov (United States)

    Ruiz-Roso, B; Cuesta, I; Varela-Moreiras, G; Carmena, R; Pérez-Olleros, L

    2000-07-01

    The diet usually consumed by a community of 18 normolipemic monks was studied. It included olive oil as cooking fat (basal period BP). This diet was modified by substituting olive oil for sunflower oil during a 21-day period (experimental period EP). The precise individual weighing technique was utilised for the determination of intake, and by means of the food composition tables (FCTs) the energy and nutrient of the diet were calculated. By chemical analysis of the duplicate sample (CA) of the cooked dishes the lipid intake was also determined. Total serum cholesterol HDL and LDL cholesterol, serum triglycerides, AI and B-100 apolipoproteins and Lp(a) were also analysed. Similarly the absolute and relative values for SFA, MUFA and PUFA obtained by both techniques were also different and these were maintained when the (PUFA + MUFA)/SFA ratio was calculated by both techniques and in the two periods. The correction of the lipid intake by means of the CA technique did not improve either the correlation between the intake or the plasma lipid concentration or the cholesterolemia prediction (r = 0.83 for FCT and CA).

  19. Evaluation of Baermann apparatus sedimentation time on recovery of Strongylus vulgaris and S. edentatus third stage larvae from equine coprocultures.

    Science.gov (United States)

    Bellaw, Jennifer L; Nielsen, Martin K

    2015-06-30

    Traditional methods of diagnosing equine Strongylinae infections require culturing feces, sedimenting the culture media in Baermann apparatuses, collecting the sediment, and morphologically identifying recovered third stage larvae. However, this method is plagued by low negative predictive values. This study evaluated sedimentation time within the Baermann apparatus by comparing larval recovery from the traditionally collected sediment, "sediment 1", and from the usually discarded remaining fluid contents, "sediment 2", of the Baermann apparatus after 12, 24, and 48 h. A grand total of 147,482 larvae were recovered and examined. Sedimentation time did not significantly influence total larval recovery. At all three durations, significantly more Cyathostominae and Strongylus vulgaris larvae were covered from sediment 1 than from sediment 2. However, less than 60% of all recovered Strongylus edentatus were recovered from sediment 1. As 95% of S. vulgaris larvae were always recovered from sediment 1, the need for collection and examination of the remaining fluid contents of the Baermann apparatus is obviated when performing coprocultures for diagnosis of S. vulgaris infections, and sedimentation for 12h is adequate. Approximately 70% of Cyathostominae were recovered in sediment 1 at all durations, suggesting that 12h of sedimentation is adequate, although there is a need for future research to evaluate the risk of selection bias at differing sedimentation times among individual cyathostomin species. In contrast to S. vulgaris, collecting and examining the entire contents of the Baermann apparatus may be necessary when an increased diagnostic sensitivity and negative predictive value is desired in diagnosing S. edentatus infections as only 38-61% of larvae were recovered from sediment 1 portion of the Baermann apparatus. This information will allow researchers and practitioners to make more informed decisions in choosing appropriate larval recovery techniques, balancing

  20. A Next-Generation Apparatus for Lithium Optical Lattice Experiments

    Science.gov (United States)

    Keshet, Aviv

    Quantum simulation is emerging as an ambitious and active subfield of atomic physics. This thesis describes progress towards the goal of simulating condensed matter systems, in particular the physics of the Fermi-Hubbard model, using ultracold Lithium atoms in an optical lattice. A major goal of the quantum simulation program is to observe phase transitions of the Hubbard model, into Neal antiferromagnetic phases and d-wave superfluid phases. Phase transitions are generally accompanied by a change in an underlying correlation in a physical system. Such correlations may be most amenable to probing by looking at fluctuations in the system. Experimental techniques for probing density and magnetization fluctuations in a variety of atomic Fermi systems are developed. The suppression of density fluctuations (or atom "shot noise") in an ideal degenerate Fermi gas is observed by absorption imaging of time-of-flight expanded clouds. In-trap measurements of density and magnetization fluctuations are not easy to probe with absorption imaging, due to their extremely high attenuation. A method to probe these fluctuations based on speckle patterns, caused by fluctuations in the index of refraction for a detuned illumination beam, is developed and applied first to weakly interacting and then to strongly interacting in-trap gases. Fluctuation probes such as these will be a crucial tool in future quantum simulation of condensed matter systems. The quantum simulation experiments that we want to perform require a complex sequence of precisely timed computer controlled events. A distributed GUI-based control system designed with such experiments in mind, The Cicero Word Generator, is described. The system makes use of a client-server separation between a user interface for sequence design and a set of output hardware servers. Output hardware servers are designed to use standard National Instruments output cards, but the client-server nature allows this to be extended to other output

  1. A transfer method and apparatus therefore

    International Nuclear Information System (INIS)

    Billington, A.J.; Brown, S.C.N.; Snelson, B.; Drayton, J.H.; Wood, S.A.; Desborough, P.H.; Slater, S.

    1990-01-01

    In a method and apparatus for transferring relatively light objects, such as nuclear fuel pellets, the objects are supported on a cushion element having a multiplicity of extremely fine and relatively short flexible fibres packed at an ultra high density pile in a backing. The fibres are aligned at an angle or inclination with respect to the base so that when the cushion element or the object is vibrated the objects are transferred in the direction of lay of the fibres. The cushion element may be supported by a base with the object resting on the fibres, or the cushion element may be secured to the underside of the object so that the fibres rest on the base. The pile may have (68-80) x 10 6 fibres per square metre, with a fibre length/thickness ratio of about 50:1. The fibres may be 43-45 microns thick and up to 2.5 mm in length. The support may be in the form of a V-section track and used in conjunction with an inspection device, or have an orienting function. (author)

  2. Hanging drop crystal growth apparatus and method

    Science.gov (United States)

    Carter, Daniel C. (Inventor); Smith, Robbie E. (Inventor)

    1989-01-01

    An apparatus (10) is constructed having a cylindrical enclosure (16) within which a disc-shaped wicking element (18) is positioned. A well or recess (22) is cut into an upper side (24) of this wicking element, and a glass cover plate or slip (28) having a protein drop disposed thereon is sealably positioned on the wicking element (18), with drop (12) being positioned over well or recess (22). A flow of control fluid is generated by a programmable gradient former (16), with this control fluid having a vapor pressure that is selectively variable. This flow of control fluid is coupled to the wicking element (18) where control fluid vapor diffusing from walls (26) of the recess (22) is exposed to the drop (12), forming a vapor pressure gradient between the drop (12) and the control fluid vapor. Initially, this gradient is adjusted to draw solvent from the drop (12) at a relatively high rate, and as the critical supersaturation point is approached (the point at which crystal nucleation occurs), the gradient is reduced to more slowly draw solvent from the drop (12). This allows discrete protein molecules more time to orient themselves into an ordered crystalline lattice, producing protein crystals which, when processed by X-ray crystallography, possess a high degree of resolution.

  3. Apparatus and method for reconstructing data

    International Nuclear Information System (INIS)

    Pavkovich, J.M.

    1977-01-01

    The apparatus and method for reconstructing data are described. A fan beam of radiation is passed through an object, the beam lying in the same quasi-plane as the object slice to be examined. Radiation not absorbed in the object slice is recorded on oppositely situated detectors aligned with the source of radiation. Relative rotation is provided between the source-detector configuration and the object. Reconstruction means are coupled to the detector means, and may comprise a general purpose computer, a special purpose computer, and control logic for interfacing between said computers and controlling the respective functioning thereof for performing a convolution and back projection based upon non-absorbed radiation detected by said detector means, whereby the reconstruction means converts values of the non-absorbed radiation into values of absorbed radiation at each of an arbitrarily large number of points selected within the object slice. Display means are coupled to the reconstruction means for providing a visual or other display or representation of the quantities of radiation absorbed at the points considered in the object. (Auth.)

  4. Method and apparatus for manufacturing gas tags

    International Nuclear Information System (INIS)

    Gross, K.C.; Laug, M.T.

    1996-01-01

    For use in the manufacture of gas tags employed in a gas tagging failure detection system for a nuclear reactor, a plurality of commercial feed gases each having a respective noble gas isotopic composition are blended under computer control to provide various tag gas mixtures having selected isotopic ratios which are optimized for specified defined conditions such as cost. Using a new approach employing a discrete variable structure rather than the known continuous-variable optimization problem, the computer controlled gas tag manufacturing process employs an analytical formalism from condensed matter physics known as stochastic relaxation, which is a special case of simulated annealing, for input feed gas selection. For a tag blending process involving M tag isotopes with N distinct feed gas mixtures commercially available from an enriched gas supplier, the manufacturing process calculates the cost difference between multiple combinations and specifies gas mixtures which approach the optimum defined conditions. The manufacturing process is then used to control tag blending apparatus incorporating tag gas canisters connected by stainless-steel tubing with computer controlled valves, with the canisters automatically filled with metered quantities of the required feed gases. 4 figs

  5. Tooling apparatus for modifying nuclear reactors

    International Nuclear Information System (INIS)

    Gallo, F.G.; Swenson, C.E.; Bencloski, W.A.; Cassette, A.J.; Mano, J.L.; Parlak, E.A.

    1990-01-01

    This patent describes support apparatus for supporting and selectively locating a tool with respect to its work piece, and the work piece having first and second dimensions. It comprises a tool carriage for receiving the tool; a support structure for supporting and guiding the tool carriage with respect to the workpiece; first drive means mounted on the support structure and coupled to the tool carriage for selectively driving the tool carriage along the first dimension; rail means mounted on the tool carriage along the second dimension; a support table mounted for movement along the rail means; second drive means mounted on the tool carriage selectively driving the tool along the second dimension, the second drive means mounted on the support table and engaging the tool carriage to drive the support table along the rail means, whereby the tool may be accurately positioned with respect to the work piece; and clamp means affixed to the support structure for engaging work piece for suspending the support structure

  6. Computed tomography apparatus with detector sensilivity correction

    International Nuclear Information System (INIS)

    Waltham, R. M.

    1984-01-01

    In a rotary fan beam computed tomography apparatus using recurrent relative displacement between the source and detectors (e.g. a deflected spot X-ray tube) for the recalibration of detectors in chain-like sequences across the detector array by successive pairwise common-path sensitivity comparisons starting from a terminal detector each sequence normally involves or more successive comparisons, and consistent but unpredictable errors are found to occur, leading to incorrect Houndsfield values in the computed image matrix. The improvement comprises locating at least one radiation transparent detector of high stability in front of the array at an intermediate point and using the output to further correct the chain-corrected detector sensitivity values. A detector comprising a plastics scintillator optically coupled to a photomultiplier is described, whose output pulses are counted during a rotational scan and compared with the mean corresponding measurement from detectors lying behind the detector, to form a sensitivity ratio. From a corresponding ratio and data derived during calibration, a measured sensitivity value for detectors is determined for each scan and is compared with the corresponding chain-corrected sensitivity value to generate a further sensitivity correction value which is then distributed among the detectors of the comparison sequence

  7. Methods and apparatus for cooling electronics

    Science.gov (United States)

    Hall, Shawn Anthony; Kopcsay, Gerard Vincent

    2014-12-02

    Methods and apparatus are provided for choosing an energy-efficient coolant temperature for electronics by considering the temperature dependence of the electronics' power dissipation. This dependence is explicitly considered in selecting the coolant temperature T.sub.0 that is sent to the equipment. To minimize power consumption P.sub.Total for the entire system, where P.sub.Total=P.sub.0+P.sub.Cool is the sum of the electronic equipment's power consumption P.sub.0 plus the cooling equipment's power consumption P.sub.Cool, P.sub.Total is obtained experimentally, by measuring P.sub.0 and P.sub.Cool, as a function of three parameters: coolant temperature T.sub.0; weather-related temperature T.sub.3 that affects the performance of free-cooling equipment; and computational state C of the electronic equipment, which affects the temperature dependence of its power consumption. This experiment provides, for each possible combination of T.sub.3 and C, the value T.sub.0* of T.sub.0 that minimizes P.sub.Total. During operation, for any combination of T.sub.3 and C that occurs, the corresponding optimal coolant temperature T.sub.0* is selected, and the cooling equipment is commanded to produce it.

  8. Method and apparatus for generating neutrons

    International Nuclear Information System (INIS)

    Cranberg, L.

    1978-01-01

    An apparatus and method for generating high-energy neutrons are disclosed. Neutron emissive target material is deposited on one or more surfaces on a rotatable, hollow, toroidal target support. The surfaces are bombarded by beams of ions of generally rectangular cross section, so that when the bombarded surfaces are viewed end-wise, a compact, generally square source of neutrons is provided, such as is required for collimation. A combination of molecular and atomic ions emitted from at least one conventional accelerator are passed through a magnetic field for the purpose of separating the ions into one homogeneous group of atomic and one homogeneous group of molecular ions before the ions are allowed to impinge on the target surfaces. One accelerator directs ions to each target surface as the target rotates. Coolant is directed through a cavity within the toroidal support for the purpose of cooling the target support and target material. A refrigerated surface is placed in close proximity to the target surface to condense vapors which might prove harmful to the target and for thermally cooling said target

  9. Apparatus for integrated fuel assembly inspection system

    International Nuclear Information System (INIS)

    Ahmed, H.J.; Burchill, S.R.

    1988-01-01

    In a fuel assembly inspection apparatus, the combination is described comprising: (a) an elongated fixture mounted in a stationary upright position; (b) upper means mounted to an upper portion of the fixture and lower means mounted adjacent to a lower portion of the fixture, the upper and lower means being disposed outwardly from a side of the fixture for supporting a nuclear fuel assembly therebetween and extending along the side of the fixture; (c) a bottom carriage having a central opening adapted to receive the fuel assembly therethrough when supported between the upper and lower means such that the bottom carriage being connected only to, and extending in cantilever fashion outwardly from, the side of the fixture for generally vertical movement along the side of the fixture and along the fuel assembly extending along the side of the fixture; (d) drive means for selectively moving the bottom carriage; and (e) means disposed on the bottom carriage for measuring the envelop, of the fuel assembly when the bottom carriage is moved to and stationed at selected axial positions along the fuel assembly

  10. Diagnostic apparatus employing nuclear magnetic resonance

    International Nuclear Information System (INIS)

    Hoshino, K.; Yamada, N.; Yoshitome, E.; Matsuura, H.

    1987-01-01

    An NMR diagnostic apparatus is described comprising means for applying a primary magnetic field to a subject; means for applying RF pulses to the subject to give nuclear magnetic resonance to the nuclei of atoms in the subject; means for applying gradient magnetic fields to project an NMR signal of the nuclei at least in one direction; means for observing the NMR signal projected by the gradient magnetic fields applying means; and arithmetic means for constructing a distribution of information on resonance energy as an image from an output signal from the observing means; wherein the gradient magnetic fields applying means comprises means for applying the gradient magnetic fields at a predetermined time and for not applying the gradient magnetic fields at another predetermined time, during the time period of one view; and wherein the gradient magnetic fields applying means further comprises means for measuring the NMR signal during the predetermined time when the gradient magnetic fields are applied, and means for measuring the intensity of the primary magnetic field during the other predetermined time when no gradient magnetic fields are applied

  11. Neutron generator tube ion source control apparatus

    International Nuclear Information System (INIS)

    Bridges, J.R.

    1982-01-01

    A pulsed neutron well logging system includes a neutron generator tube of the deuterium-tritium accelerator type and an ion source control apparatus providing extremely sharply time-defined neutron pulses. A low voltage control pulse supplied to an input by timing circuits turns a power FET on via a buffer-driver whereby a 2000 volt pulse is produced in the secondary of a pulse transformer and applied to the ion source of the tube. A rapid fall in this ion source control pulse is ensured by a quenching circuit wherein a one-shot responds to the falling edge of the control pulse and produces a 3 microsecond delay to compensate for the propagation delay. A second one-shot is triggered by the falling edge of the output of the first one-shot and gives an 8 microsecond pulse to turn on the power FET which, via an isolation transformer turns on a series-connected transistor to ground the secondary of the pulse transformer and the ion source. (author)

  12. Experiences with decontaminating tritium-handling apparatus

    International Nuclear Information System (INIS)

    Maienschein, J.L.; Garcia, F.; Garza, R.G.; Kanna, R.L.; Mayhugh, S.R.; Taylor, D.T.

    1991-07-01

    Tritium-handling apparatus has been decontaminated as part of the shutdown of the LLNL Tritium Facility. Two stainless-steel gloveboxes that had been used to process lithium deuteride-tritide (LiDT) salt were decontaminated using the Portable Cleanup System so that they could be flushed with room air through the facility ventilation system. Further surface decontamination was performed by scrubbing the interior with paper towels and ethyl alcohol or Swish trademark. The surface contamination, as shown by swipe surveys, was reduced from 4x10 4 --10 6 disintegrations per minute (dpm)/cm 2 to 2x10 2 --4x10 4 dpm/cm 2 . Details on the decontamination operation are provided. A series of metal (palladium and vanadium) hydride storage beds have been drained of tritium and flushed with deuterium in order to remove as much tritium as possible. The bed draining and flushing procedure is described, and a calculational method is presented which allows estimation of the tritium remaining in a bed after it has been drained and flushed. Data on specific bed draining and flushing are given

  13. Apparatus and method for transverse tomography

    Energy Technology Data Exchange (ETDEWEB)

    1976-06-16

    An improved apparatus and method for generating the two-dimensional filtered back-projected image of a slice of an object is described. In accordance with the invention a photodetector means and illluminating means directed toward the photodetector means are provided. A carrier means is disposed between the illuminating means and the photodetector means, the carrier means having a plurality of substantially parallel elongated projections on the surface thereof. Each projection has an optical characteristic (transmissivity or reflectivity) representing the density characteristic of the slice of the object as measured at a particular relative rotational angle. A mask means, comprising a plurality of cycles of a substantially sinusoidally shaped pattern of varying amplitude, is disposed between the illuminating means and the photodetector. Means are provided for moving the carrier means and the mask means with respect to each other. Finally, a display or recording means, synchronized with the moving means, is responsive to the output of the photodetector for displaying the back-projected image.

  14. Power operated contact apparatus for superconductive circuit

    Energy Technology Data Exchange (ETDEWEB)

    Woods, D.C.; Efferson, K.R.

    1989-10-10

    This patent describes a power operated contact apparatus for extending and retracting one or more electrical leads into and out of a cryostat for making and breaking, at a cryogenic temperature, electrical contact with a superconductive circuit. It comprises at least one rigid elongated lead for extending into a cold space of the cryostat which is at or near a cryogenic temperature. The lead having an inner end and a outer end; a connector fixed at the inner end of the lead for making electrical contact in the cold space with a connector of the superconductive circuit; guide means journaling the lead for allowing the lead to move axially relative to the guide means and sealing against the lead; a foundation for sealed attachment to the cryostat and to the guide means so that the connector on the inner end of the lead is extendable into making electrical contact with the connector of the superconductive circuit in the cold space; power operated means mounted on the foundation and fixed to the outer end of the lead for extending and retracting the lead to and from making electrical contact with the superconductive circuit in the cold space; and means for de-icing the exterior of the leads and guide means when the leads are connected to the superconducting circuit.

  15. Method and apparatus for enhancing radiometric imaging

    International Nuclear Information System (INIS)

    Logan, R. H.; Paradish, F. J.

    1985-01-01

    Disclosed is a method and apparatus for enhancing target detection, particularly in the millimeter wave frequency range, through the utilization of an imaging radiometer. The radiometer, which is a passive thermal receiver, detects the reflected and emitted thermal radiation of targets within a predetermined antenna/receiver beamwidth. By scanning the radiometer over a target area, a thermal image is created. At millimeter wave frequencies, the received emissions from the target area are highly dependent on the emissivity of the target of interest. Foliage will appear ''hot'' due to its high emissivity and metals will appear cold due to their low emissivities. A noise power illuminator is periodically actuated to illuminate the target of interest. When the illuminator is actuated, the role of emissivity is reversed, namely poorly emissive targets will generally be good reflectors which in the presence of an illuminator will appear ''hot''. The highly emissive targets (such as foliage and dirt) which absorb most of the transmitted energy will appear almost the same as in a nonilluminated, passive image. Using a data processor, the intensity of the passive image is subtracted from the intensity of the illuminated, active image which thereby cancels the background foliage, dirt, etc. and the reflective metallic targets are enhanced

  16. Apparatus for precision micromachining with lasers

    Science.gov (United States)

    Chang, J.J.; Dragon, E.P.; Warner, B.E.

    1998-04-28

    A new material processing apparatus using a short-pulsed, high-repetition-rate visible laser for precision micromachining utilizes a near diffraction limited laser, a high-speed precision two-axis tilt-mirror for steering the laser beam, an optical system for either focusing or imaging the laser beam on the part, and a part holder that may consist of a cover plate and a back plate. The system is generally useful for precision drilling, cutting, milling and polishing of metals and ceramics, and has broad application in manufacturing precision components. Precision machining has been demonstrated through percussion drilling and trepanning using this system. With a 30 W copper vapor laser running at multi-kHz pulse repetition frequency, straight parallel holes with size varying from 500 microns to less than 25 microns and with aspect ratios up to 1:40 have been consistently drilled with good surface finish on a variety of metals. Micromilling and microdrilling on ceramics using a 250 W copper vapor laser have also been demonstrated with good results. Materialographic sections of machined parts show little (submicron scale) recast layer and heat affected zone. 1 fig.

  17. Faraday rotation measurement method and apparatus

    Science.gov (United States)

    Brockman, M. H. (Inventor)

    1981-01-01

    A method and device for measuring Faraday rotation of a received RF signal is described. A simultaneous orthogonal polarization receiver compensates for a 3 db loss due to splitting of a received signal into left circular and right circular polarization channels. The compensation is achieved by RF and modulation arraying utilizing a specific receiver array which also detects and measures Faraday rotation in the presence or absence of spin stabilization effects on a linear polarization vector. Either up-link or down-link measurement of Faraday rotation is possible. Specifically, the Faraday measurement apparatus utilized in conjunction with the specific receiver array provides a means for comparing the phase of a reference signal in the receiver array to the phase of a tracking loop signal related to the incoming signal, and comparing the phase of the reference signal to the phase of the tracking signal shifted in phase by 90 degrees. The averaged and unaveraged signals, are compared, the phase changes between the two signals being related to Faraday rotation.

  18. Dual-polarized feed antenna apparatus and method of use

    Science.gov (United States)

    Sarehraz, Mohammed (Inventor); Buckle, Kenneth A. (Inventor); Stefanakos, Elias (Inventor); Weller, Thomas (Inventor); Goswami, D. Yogi (Inventor)

    2009-01-01

    An antenna apparatus and method for the interception of randomly polarized electromagnetic waves utilizing a dual polarized antenna which is excited through a cross-slot aperture using two well-isolated orthogonal feeds.

  19. Apparatus to examine pulsed parallel field losses in large conductors

    International Nuclear Information System (INIS)

    Miller, J.R.; Shen, S.S.

    1977-01-01

    Conductors in tokamak toroidal field coils will be exposed to pulsed fields both parallel and perpendicular to the current direction. These conductors will likely be quite high capacity (10 to 20 kA) and therefore probably will be built up out of smaller units. We have previously published measurements of losses in conductors exposed to a pulsed parallel field, but those experiments necessarily used monolithic conductors of relatively small cross section because the pulse coil, a torus that surrounded the test conductor, was itself small. Here we describe an apparatus that is conceptually similar but has been scaled up to accept conductors of much larger cross section and current capacity. The apparatus consists basically of a superconducting torus that contains a movable spool to allow test samples to be wound inside without unwinding the torus. Details of apparatus design and capabilities are described and preliminary results from tests of the apparatus and from loss measurements using it are reported

  20. The Study Of Optometry Apparatus Of Laser Speckles

    Science.gov (United States)

    Bao-cheng, Wang; Kun, Yao; Xiu-qing, Wu; Chang-ying, Long; Jia-qi, Shi; Shi-zhong, Shi

    1988-01-01

    Based on the regularity of laser speckles movement the method of exam the uncorrected eyes is determined. The apparatus with micro-computer and optical transformation is made. Its practical function is excellent.