WorldWideScience

Sample records for aphis gossypii glover

  1. Respon Fungsional Menochilus sexmaculatus Fabricius terhadap Aphis Gossypii Glover

    Directory of Open Access Journals (Sweden)

    F. X. Wagiman

    1996-12-01

    Full Text Available Laboratory and field-cage experiments were conducted at the Universiti Pertanian Malaysia. Objective of the study was to determine the functional response of Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae predating on chilli aphid Aphis gossypii Glover (Homoptera: Aphididae. The larvae and adults of the predaceous coccinellid exhibited the Hulling's Type II functional response. A first instar of the coccinellid predating on single first instar of the aphid within 24.6 minutes in the laboratory and 16.8 minutes in the field. While a fourth instar and an adult of the coccinellid predating on single fourth instar of the aphid within 4.2 and 1.5 minutes respectively.

  2. Biological parameters of the non-target pest Aphis gossypii Glover ...

    African Journals Online (AJOL)

    Thiago Mota

    2013-04-17

    Apr 17, 2013 ... Development and commercial use of Bollgard cotton in the USA nearly promises versus today reality. Plant. J. 27:489-501. Pessoa LGA, Souza B, Carvalho CF, Silva M (2004). Aspectos da biologia de Aphis gossypii Glover, 1877 (Hemiptera: Aphididae) em quatro cultivares de Algodoeiro, em Laboratório.

  3. A laboratory and field condition comparison of life table parameters of Aphis gossypii Glover (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Hosseini-Tabesh Behnaz

    2015-01-01

    Full Text Available Life table studies are essential tools for understanding population dynamics. The life table parameters of Aphis gossypii Glover (Hemiptera: Aphididae feeding on the host plant, Hibiscus syriacus L. were studied under laboratory (25±1°C and relative humidity of 65±5% and a photoperiod of 16L : 8D h and field conditions (23-43°C, and relative humidity of 27-95%. The data were analysed using the age-stage, two-sex life table theory. The life table studies were started with 50 and 40 nymphs in laboratory and field conditions, respectively. Under laboratory conditions, A. gossypii reared on H. syriacus had a higher survival rate, fecundity, and longevity than those reared under field conditions. When reared under field conditions, A. gossypii had a longer nymphal developmental time, shorter adult longevity, and lower fecundity than those reared under laboratory conditions. The intrinsic rate of increase (r, net reproductive rate (R0, and the finite rate of increase (λ under laboratory conditions, were higher than those obtained under field conditions. Nevertheless, there were no significant differences in the mean generation time T (days between field and laboratory conditions. In the present study, the results clearly showed that life table parameters of A. gossypii were significantly different under field and laboratory conditions. These results could help us to understand the A. gossypii population dynamics under field conditions. The results could also help us make better management decisions for economically important crops

  4. Biological control of cotton aphid (Aphis gossypii Glover) in cotton (inter)cropping systems in China : a simulation study

    NARCIS (Netherlands)

    Xia, J.

    1997-01-01

    Cotton aphid ( Aphis gossypii Glover) is the key insect pest of seedling cotton ( Gossypium hirsutum L. ) in China, particularly in the North China cotton region. The resulting annual losses amount to 10-15% of the attainable yield. Sole reliance on

  5. Hypersensitive response to Aphis gossypii Glover in melon genotypes carrying the Vat gene.

    Science.gov (United States)

    Villada, Emilio Sarria; González, Elisa Garzo; López-Sesé, Ana Isabel; Castiel, Alberto Fereres; Gómez-Guillamón, María Luisa

    2009-01-01

    Aphis gossypii Glover causes direct and indirect damage to Cucumis melo L. crops. To decrease the harmful effects of this pest, one of the most economically and environmentally acceptable options is to use genetically resistant melon varieties. To date, several sources of resistance carrying the Vat gene are used in melon breeding programmes that aim to prevent A. gossypii colonization and the subsequent aphid virus transmission. The results suggest that the resistance conferred by this gene is associated with a microscopic hypersensitive response specific against A. gossypii. Soon after aphid infestation, phenol synthesis, deposits of callose and lignin in the cell walls, damage to the plasmalemma, and a micro-oxidative burst were detected in genotypes carrying the Vat gene. According to electrical penetration graph experiments, this response seems to occur after aphid stylets puncture the plant cells and not during intercellular stylet penetration. This type of plant tissue reaction was not detected in melon plants infested with Bemisia tabaci Gennadius nor Myzus persicae Sulzer.

  6. First record of larvae of Allograpta exotica Wiedemann (Diptera, Syrphidae preying on Aphis gossypii Glover (Hemiptera, Aphididae in watermelon in Brazil

    Directory of Open Access Journals (Sweden)

    Vinícius Soares Sturza

    2011-06-01

    Full Text Available First record of larvae of Allograpta exotica Wiedemann (Diptera, Syrphidae preying on Aphis gossypii Glover (Hemiptera, Aphididae in watermelon in Brazil. Brazil is one of the largest world producers of watermelon (Citrullus lanatus Thumb. Mansf. and Aphis gossypii Glover, 1877 (Hemiptera, Aphididae is among the most important pest on this crop. Larvae of Allograpta exotica Wiedemann, 1830 (Diptera, Syrphidae were found preying on A. gossypii in watermelon crop, in Santa Maria, Rio Grande do Sul State, what represents the first report of this tritrophic association in Brazil.

  7. Biological parameters of the non-target pest Aphis gossypii Glover ...

    African Journals Online (AJOL)

    In the present work, we aimed to evaluate: 1) the influence of the Cry1Ac protein expressed by the genetically modified cotton variety (Bt) NuOpal, on the biological parameters of a non-target pest, Aphis gossypii, reared under laboratory conditions; 2) the influence of plant age on aphid development. Cotton cultivars were ...

  8. Effectiveness of Lysiphlebus testaceïpes Cresson as biocontrol agent of Aphis gossypii Glover infesting pepper plants

    Directory of Open Access Journals (Sweden)

    M. Ben Halima Kamel

    2011-12-01

    Full Text Available In Tunisia, greenhouse crops are damaged by Aphis gossypii Glover and Myzus persicae Sulzer (Ben Halima Kamel 1991; Ben Halima Kamel and Ben Hamouda 1993, 1998. These aphids are considered to be the most dangerous pests of pepper because of their biology and biotic potential (Ben Halima Kamel 1991; Blackman and Eastop 2000. There are several ways of controlling these pests with chemical control being the most widely used. This method has more disadvantages than benefits (Gibson et al. 1982. The use of natural enemies to control aphids is an effective way of improving the yield and quality of protected crops. There are many studies on the following naturally occurring enemies of A. gossypii: Aphidius matricariae Haliday, Lysiphlebus fabarum Marshall, Aphidoletes aphidimyza (Rondani, Episyrphus balteatus (De Geer (Ben Halima Kamel and Ben Hamouda 1998 and Lysiphlebus testaceipes (Cresson (Ben Halima Kamel, unpublished data, 1999. It is now important to evaluate the effectiveness of L. testaceipes as a biocontrol agent of A. gossypii. This parasitoďd was introduced into the Mediterranean area (Carver and Franzmann 2001 and is thought to be an important parasite of A. gossypii (Lopes et al. 2007. The aim of this mainly laboratory study was to determine the factors affecting the establishment and success of a biological control agent, in particular the number of L. testaceďpes relative to the initial density of A. gossypii, needed to control the aphid. In addition, the effect of the L. testaceďpes on structure of A. gossypii populations was evaluated. Furthermore, the effectiveness of L. testaceipes in controlling A. gossypii infesting a protected crop of pepper plants and the subsequent effect on the growth of the pepper plants was also evaluated.

  9. Effects of nitrogen fertilization in cotton crop on Aphis gossypii Glover (Hemiptera: Aphididae) biology

    International Nuclear Information System (INIS)

    Barros, Ricardo; Degrande, Paulo E.; Fernandes, Marcos G.; Nogueira, Rodrigo F.

    2007-01-01

    The cotton aphid, Aphis gossypii Glove, is one of the pests of cotton crop and its relation with the host seem to depend on the amount of nitrogen available to the plant. The biology of A. gossypii using different cotton nitrogen fertility regimes was studied under greenhouse conditions, in Dourados, MS. A completely randomized design with nine replications in a factorial scheme (2x4x2)+1 was used. Two nitrogen sources (sulphate of ammonium and urea), four doses of nitrogen (50, 100, 150 and 200 kg ha-1), two different times of nitrogen application and one additional treatment without nitrogen were taken as factors. The nymphal phases, the pre-reproductive, reproductive and pos-reproductive periods, longevity, the life cycle and fecundity of the cotton aphid were evaluated. The doses of nitrogen influenced the cotton aphid biology in both sources and times of application, favoring its development and fecundity. (author)

  10. Keefektifan fosfin formulasi cair terhadap Aphis gossypii Glover dan Macrosiphoniella sanborni Gillette (Hemiptera: Aphididae pada bunga potong krisan

    Directory of Open Access Journals (Sweden)

    Nur Rachman

    2016-09-01

    Full Text Available Cut flower of chrysanthemum has high aesthetic and economic values. Export volume of chrysanthemums from Indonesia are lower than other countries, due to the impact of insect pest. Insect pests, Aphis gossypii Glover and Macrosiphoniella sanborni Gillette are currently associated with cut flowers  especially chrysanthemum. One control measures usually taken in quarantine is fumigation. Alternative fumigant, liquified phosphine formulations may potentially be applied for quarantine treatment. The objectives of this study were to determine the concentration and exposure time of liquified phosphine against these species and to evaluate the effect of fumigant on the physical quality of cut flowers. The experiment was conducted in four steps: (1 identification and mass rearing of A. gossypii and M. sanborni; (2 preliminary tests on adult and third instar nymphs; (3 determination of liquified phosphine with various concentration and exposure time against adult and third instar nymphs of A. gosspypii and M. sanborni and; (4 validation test of effective concentration of fumigant and exposure time and the effect on quality of cut flowers. The results of study showed concentration of fumigant causing 100% mortality A. gossypii and M. sanborni  ere 500 ppm and 700 ppm, respectively with exposure time 12 hours. Concentrations of 700 ppm and exposure time up to 18 hours did not cause negative impact to the quality of chrysanthemum cut flowers.

  11. [Pathogenicity of hyphomycet fungi to aphids Aphis gossypii Glover and Myzus persicae (Sulzer) (Hemiptera: Aphididae)].

    Science.gov (United States)

    Loureiro, Elisângela de S; oino, Alcides

    2006-01-01

    The aphids Aphis gossypii and Myzus persicae are cosmopolitan, poliphagous and damage cultivated plants. The effects of the entomopathogenic fungi Beauveria bassiana (isolate IBCB 66), Metarhizium anisopliae (isolate IBCB 121), Paecilomyces fumosoroseus (isolate IBCB 141) and Lecanicillium (= Verticillium) lecanii (isolate JAB 02) on third instar nymphs of A. gossypii and M. persicae were evaluated in the laboratory at 25 degrees C, 70 +/- 10% RH and 12h photophase. The aphids were transferred to petri dishes with a foliar disk (cotton or pepper) with a layer of 1 cm tick of agar-water. The fungi were applied in a suspension containing 1.0 x 106 to 1.0 x 108 conidia/ml. In the control treatment 1 ml of sterilized water was added to the foliar disks. The mortality of aphids was evaluated daily. B. bassiana and M. anisopliae caused 100% mortality at the seventh day after inoculation, for both species. L. lecanii was the fungus that provided mortality later in the aphids and M. persicae was more susceptible to both fungi than A. gossypii.

  12. Efeito repelente de azadiractina e óleos essenciais sobre Aphis gossypii Glover (Hemiptera: Aphididae em algodoeiro Repellent effect of azadirachtin and essential oils on Aphis gossypii Glover (Hemiptera: Aphididae in cotton plants

    Directory of Open Access Journals (Sweden)

    Lígia Helena de Andrade

    2013-09-01

    Full Text Available A repelência de inseticidas botânicos tem se destacado como uma tática promissora no controle alternativo de pragas agrícolas e urbanas, podendo ser um dos componentes do manejo integrado de pragas. Objetivou-se com este trabalho identificar a repelência de inseticidas botânicos sobre fêmeas ápteras de Aphis gossypii Glover. Testes com chance de escolha foram realizados com discos de folha de algodoeiro, imersos nas caldas dos inseticidas e testemunha (água destilada com DMSO a 2%. Utilizou-se azadirachtina (0,075% e os óleos essenciais de Piper hispidinervum CDC, P. aduncum L., Cymbopogon winterianus (L., C. citratus (D.C. Stapf, Foeniculum vulgare Mill, Syzygium aromaticum (L. Merrill e Perry, Cinnamomum zeylanicum Blume, Schinus terebinthifolius Raddi e Chenopodium ambrosioides L. na concentração de 0,05%. C. citratus, C. winterianus, P. aduncum, S. terebinthifolius, azadirachtina e C. zeylanicum apresentaram os maiores percentuais de repelência, 100; 84; 66,67; 64; 60,87 e 48% respectivamente e reduziram a produção de ninfas em 100; 92; 42,9; 87,5; 80,65 e 89,74%, apresentando resultados significativos pelo teste do χ2 ao nível de 10% de probabilidade. Nos testes com F. vulgare (χ2 = 3,66, P = 0,05 as fêmeas de A. gossypii foram atraídas significativamente para os discos tratados e ocorreu um aumento na produção de ninfas nos resultados obtidos para F. vulgare (χ2 = 5,87, P = 0,02 e C. ambrosioides (χ2 = 14,31, P = 0,001.The repellence of botanical insecticides has emerged as a promising technique in the alternative control of urban and agricultural pests, being seen as one component of integrated pest management. The aim of this work was to identify the repellence of botanical insecticides on apterous females of Aphis gossypii Glover. Random-choice tests were carried out with discs from the leaves of cotton plants immersed in insecticide solution and in a control (distilled water with 2% DMSO. Azadirachtin was used

  13. Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae

    Directory of Open Access Journals (Sweden)

    Eliana Alcantra

    2011-06-01

    Full Text Available Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae. The aphid Aphis gossypii is an insect pest that causes damage mainly at the beginning of the cotton plant development. The effect of resistance inductors silicon and acibenzolar-s-methyl (ASM on the development of colored cotton plants were researched in the presence and absence of A. gossypii. Three colored cotton cultivars were sown in pots and individually infested with 25 apterous aphids, 13 days after the application of the inductors. Fifteen days after plant emergence, the silicon was applied at a dosage equivalent to 3 t/ha and acibenzolar-s-methyl in 0.2% solution of the product BION 500®. After 21 days of infestation the following parameters were evaluated: plant height, stem diameter, dry matter of aerial part and root, and total number of aphids replaced. It was verified that the plant height was reduced in the presence of aphids and all variables were negatively affected by the application of ASM. However, silicon did not affect plant development.

  14. Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae); Tabela de vida de fertilidade de Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) em Rhopalosiphum maidis (Fitch) e Aphis gossypii Glover (Hemiptera, Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Robson Jose da; Bueno, Vanda Helena Paes; Silva, Diego Bastos [Universidade Federal de Lavras (UFLA), MG (Brazil). Dept. de Entomologia. Lab. de Controle Biologico], e-mail: ecosbio@yahoo.com.br, e-mail: vhpbueno@ufla.br; Sampaio, Marcus Vinicius [Universidade Federal de Uberlandia, Umuarama, MG (Brazil). Inst. de Ciencias Agrarias], e-mail: mvsampaio@iciag.ufu.br

    2008-07-01

    Fertility life table of Lysiphlebus testaceipes (Cresson) (Hymenoptera, Braconidae, Aphidiinae) in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover (Hemiptera, Aphididae). The evaluation of the growth potential of Lysiphlebus testaceipes (Cresson) is important for its use in biological control programs of aphids. This work aimed to evaluate the fertility life table of L. testaceipes in Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover. To determine the immature mortality, development and the sex ratio of the parasitoid, 12 females parasitoid, and 480 nymphs of each aphids were used. To evaluate the longevity and fertility 15 female parasitoid were used. Nymphs of each aphid (3 day old) were offered for each parasitoid female daily, until the female died, being 300 (first day); 250 (second day); 200 (third day); 150 (fourth day) and 50 nymphs in the other days. L. testaceipes showed immature mortality rates of 5.6 % in R. maidis and 9.2 % in A. gossypii. The development time of L. testaceipes in R. maidis and A. gossypii was 10.2 and 10.1 days, and the sex ratio of 0.71 and 0.66, respectively. The female of L. testaceipes had a fecundity of 498.8 eggs in R. maidis and 327.8 eggs in A. gossypii. The growth parameters the L. testaceipes in R. maidis and A. gossypii were, respectively R{sub o}= 205.38 and 164.08 females; r{sub m}= 0.449 and 0.431 females/females/day; {lambda}= 1.57 and 1.54 females/day; T= 11.86 and 11.83 days and TD= 10.78 and 11.27 days. L. testaceipes showed great growth potential on both aphid hosts. R. maidis could be a suitable host for proposals of mass-rearing and open rearing system using L. testaceipes. (author)

  15. Effects of nitrogen fertilization in cotton crop on Aphis gossypii Glover (Hemiptera: Aphididae) biology; Efeitos da adubacao nitrogenada em algodoeiro sobre a biologia de Aphis gossypii Glover (Hemiptera: Aphididae)

    Energy Technology Data Exchange (ETDEWEB)

    Barros, Ricardo; Degrande, Paulo E.; Fernandes, Marcos G.; Nogueira, Rodrigo F. [Universidade Federal da Grande Dourados, MS (Brazil). Faculdade de Ciencias Agrarias]. E-mail: rbarrosufms@yahoo.com.br, degrande@ufgd.edu.br

    2007-09-15

    The cotton aphid, Aphis gossypii Glove, is one of the pests of cotton crop and its relation with the host seem to depend on the amount of nitrogen available to the plant. The biology of A. gossypii using different cotton nitrogen fertility regimes was studied under greenhouse conditions, in Dourados, MS. A completely randomized design with nine replications in a factorial scheme (2x4x2)+1 was used. Two nitrogen sources (sulphate of ammonium and urea), four doses of nitrogen (50, 100, 150 and 200 kg ha-1), two different times of nitrogen application and one additional treatment without nitrogen were taken as factors. The nymphal phases, the pre-reproductive, reproductive and pos-reproductive periods, longevity, the life cycle and fecundity of the cotton aphid were evaluated. The doses of nitrogen influenced the cotton aphid biology in both sources and times of application, favoring its development and fecundity. (author)

  16. Fecundidade e longevidade de Aphis gossypii Glover, 1877 (Hemiptera, Aphididae em diferentes temperaturas e cultivares comerciais de crisântemo (Dendranthema grandiflora Tzvelev

    Directory of Open Access Journals (Sweden)

    Soglia Maria C. de M.

    2003-01-01

    Full Text Available Fecundity and longevity of Aphis gossypii Glover, 1877 (Hemiptera, Aphididae at different temperatures and commercial chrysanthemum cultivars (Dendranthema grandiflora Tzvelev. The aphid A. gossypii is one of the main pests in a number of crops both under field and protected conditions. The objective of the present study was to evaluate the fecundity and longevity of A. gossypii under different temperatures and commercial chrysanthemum cultivars (Yellow Snowdon, White Reagan and Dark Splendid Reagan with different trichomes densities (11.3; 16.6 and 21.6 trichome/mm² of the leaf, respectively The trials were carried out in climatic chambers, at four temperatures (15, 20, 25 and 30 ±1 °C, 70 ± 10% RH and photophase 10h. The reproductive period significantly decreased with increase of temperature in the three cultivars. In Yellow Snowdon cultivar average duration of the reproductive period was 14.3 days at 25 °C. The maximum fecundity was obtained at the temperature of 25 ºC with 3,1; 2,8 and 3,6 nymphs/female/day in the Yellow Snowdon, White Reagan and Dark S. Reagan cultivars, respectively. The total fecundity was reduced by extreme temperatures (15 and 30 °C, and was obtained at 25 °C with 35,9 nymphs/female. Females maintained in Yellow Snowdon cultivar significantly showed superiority (30,7 nymphs/female in total fecundity in relation to White Reagan (22,1 nymphs/female and Dark S. Reagan (22,9 nymphs/female. The Yellow Snowdon cultivar (with a lower trichome density had a significant influence in daily and total capacity of nymphs production, showing a higher fecundity of A. gossypii females. The aphid's longevity was affected by cultivars and temperature, and this longevity decreased whit increase of temperature. The results showed that there was an interaction between the temperature and host plant on reproductive parameters of A. gossypii.

  17. Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae

    Directory of Open Access Journals (Sweden)

    Eliana Alcantra

    2011-06-01

    Full Text Available Effect of silicon and acibenzolar-s-methyl on colored cotton plants infested or not with Aphis gossypii Glover (Hemiptera, Aphididae. The aphid Aphis gossypii is an insect pest that causes damage mainly at the beginning of the cotton plant development. The effect of resistance inductors silicon and acibenzolar-s-methyl (ASM on the development of colored cotton plants were researched in the presence and absence of A. gossypii. Three colored cotton cultivars were sown in pots and individually infested with 25 apterous aphids, 13 days after the application of the inductors. Fifteen days after plant emergence, the silicon was applied at a dosage equivalent to 3 t/ha and acibenzolar-s-methyl in 0.2% solution of the product BION 500®. After 21 days of infestation the following parameters were evaluated: plant height, stem diameter, dry matter of aerial part and root, and total number of aphids replaced. It was verified that the plant height was reduced in the presence of aphids and all variables were negatively affected by the application of ASM. However, silicon did not affect plant development.Efeito do silício e do acibenzolar-s-methyl em plantas de algodão colorido infestadas ou não com Aphis gossypii Glover (Hemiptera, Aphididae. O pulgão Aphis gossypii é um inseto-praga que causa danos principalmente no início do ciclo do algodoeiro. Foram pesquisados os efeitos dos indutores silício e acibenzolar-s-methyl (ASM no desenvolvimento de plantas de algodão colorido, na presença e ausência de A. gossypii. Três cultivares de algodão colorido foram semeadas em vasos e individualmente infestadas com 25 pulgões ápteros, 13 dias após a aplicação dos indutores. Quinze dias após emergência das plantas o silício foi aplicado na dosagem equivalente a 3 t/ha e o acibenzolar-s-methyl (ASM na solução 0,2% do produto BION 500®. Após 21 dias da infestação foram avaliados os seguintes parâmetros: altura da planta, diâmetro do caule

  18. Tanggap fungsional Menochilus sexmaculatus Fabricius (Coleoptera: Coccinellidae terhadap Aphis gossypii (Glover (Homoptera: Aphididae pada umur tanaman cabai berbeda

    Directory of Open Access Journals (Sweden)

    Novri Nelly

    2015-09-01

    Full Text Available The lady beetle, Menochilus sexmaculatus is one of the biological control agents that can be used to control aphids. Presently, there is a lack of information about the effectiveness of this beetle to control aphids. The objective of this research was to study the functional response of M. sexmaculatus on Aphis gossypii at different ages of plants. All preys were exposed to one M. sexmaculatus adult for an hour at five different densities of aphids (10, 20, 30, 40, and 50 individuals is four different ages of chilli plants (2,4,6, and 8 weeks. Data were analyzed by ANOVA and logistic regression to determine the type of functional response. The results showed that the ability of M. sexmaculatus to prey was not significant at 2 to 4 and 6 to 8 weeks old chilli plants. At 2 week old chilli plants M. sexmaculatus showed type I of functional response, while at 4, 6 and 8 weeks the functional response were type III.

  19. Duração e viabilidade das fases pré-imaginais de Chrysoperla externa (Hagen alimentadas com Aphis gossypii Glover e Sitotroga cerealella (Olivier Duration and viability of Chrysoperla externa (Hagen pre-imago phases, fed with Aphis gossypii (Glover and Sitotroga cerealella (Olivier

    Directory of Open Access Journals (Sweden)

    Luciano Pacelli Medeiros Macedo

    2002-05-01

    Full Text Available Estudou-se a duração e a viabilidade das fases imaturas de Chrysoperla externa (Hagen (Neuroptera, Chrysopidae alimentadas com o pulgão do algodoeiro, Aphis gossypii Glover (Homoptera, Aphididae, e com a traça do milho, Sitotroga cerealella (Olivier (Lepidoptera: Gelechiidae. A pesquisa foi conduzida no Laboratório de Entomologia da Embrapa - CNPA, em Campina Grande, Paraíba, em 1998/99 em condições controladas sob temperatura de 25±2ºC, 70±10% UR e fotofase de 12 horas. O desenvolvimento pré-imaginal de C. externa decorreu normalmente: fase larval com três ínstares, pré-pupa e pupa. De acordo com os resultados, pode-se concluir que as larvas de C. externa alimentadas com A. gossypii apresentam uma duração significativamente maior para o primeiro e terceiro ínstares, que às alimentadas com S. cerealella. Entretanto, não há efeito dessas presas na viabilidade das fases desse predador, exceto para a de pré-pupa. C. externa pode ser criado em A. gossypii ou S. cerealella sem risco de perda de viabilidade, embora algumas fases possam ser mais longas.This work was carried out at the Laboratório de Entomologia da Embrapa - CNPA, in Campina Grande, state of Paraíba, Brazil, in 1998/99, to study the duration and viability of Chrysoperla externa (Hagen (Neuroptera, Chrysopidae larvae, fed with Aphis gossypii (Homoptera, Aphididae and Sitotroga cerealella (Lepidoptera: Gelechiidae, under controlled conditions. The temperature was 25+-2º C, 70+-10% UR and 12-hour photophase. The C. externa pre-imaginal development was normal: larval phase with three instars, pre-pupa and pupa. The results showed that C. externa larvae fed on A. gossypii had a first and third instar longer than the ones fed with S. cerealella. However, no effect was observed in the phases' viability, excepting the pre-pupa. C. externa can feed on both preys without viability loss, although this may enhance some phases' duration.

  20. Molecular and morphological differentiation between Aphis gossypii Glover (Hemiptera, Aphididae) and related species, with particular reference to the North American Midwest

    OpenAIRE

    Lagos-Kutz,Doris; Favret,Colin; Giordano,Rosanna; Voegtlin,David

    2014-01-01

    Abstract The cotton aphid, Aphis gossypii , is one of the most biologically diverse species of aphids; a polyphagous species in a family where most are host specialists. It is economically important and belongs to a group of closely related species that has challenged aphid taxonomy. The research presented here seeks to clarify the taxonomic relationships and status of species within the Aphid gossypii group in the North American Midwest. Sequences of the mitochondrial cytochrome oxidase 1 (C...

  1. Factors affecting colonization and abundance of Aphis gossypii glover (hemiptera: aphididae on okra plantations Fatores que afetam a colonização e abundância de Aphis gossypii glover (Hemiptera: Aphididae em plantações de quiabeiro

    Directory of Open Access Journals (Sweden)

    Germano Leão Demolin Leite

    2007-04-01

    Full Text Available The control of Aphis gossypii Glover (Hemiptera: Aphididae on okra Abelmoschus esculentus (L. (Malvaceae consist primarily in the use of insecticides, due to the lack of information on other mortality factors. The objective of this study was to determine the effects of predators and parasitoids, height of canopy, plant age, leaf areas, organic compounds leaves, levels of leaf nitrogen and potassium, density of leaf trichomes, total rainfall and median temperature on attack intensity of A. gossypii on two successive A. esculentus var. Santa Cruz plantations. Monthly number estimates of A. gossypii and natural enemies (visual inspection occurred on bottom, middle and apical parts of 30 plants/plantation (one leaf/plant. Plants senescence, leaf areas and natural enemies, mainly Adialytus spp., spiders and Coccinellidae, were some of the factors that most contributed to aphid reduction. A higher number of aphids was found on the bottom part than medium and apical parts of okra plants. Total rainfall can reduce the aphid population. Trichomes non-glandular or low density, organic compounds leaves and levels of N and K were not important for reducing aphid population.O controle de Aphis gossypii Glover (Hemiptera: Aphididae em quiabeiro Abelmoschus esculentus (L. (Malvaceae consiste principalmente no uso de inseticidas, em virtude da falta de informação sobre outros fatores de mortalidade. Objetivou-se com este estudo determinar os efeitos de predadores e parasitóides, altura de dossel, idade da planta, área foliar, compostos orgânicos foliares, níveis de nitrogênio e potássio, densidade de tricomas, pluviosidade e temperatura na intensidade de ataque de A. gossypii em dois cultivos sucessivos de Abelmoschus esculentus var. Santa Cruz. Estimou-se, mensalmente, o número de A. gossypii e de inimigos naturais (inspeção visual ocorridos nas folhas (uma folha/planta localizadas nas partes basal, mediana e apical de 30 plantas/plantação. Os

  2. Both point mutations and low expression levels of the nicotinic acetylcholine receptor β1 subunit are associated with imidacloprid resistance in an Aphis gossypii (Glover) population from a Bt cotton field in China.

    Science.gov (United States)

    Chen, Xuewei; Li, Fen; Chen, Anqi; Ma, Kangsheng; Liang, Pingzhuo; Liu, Ying; Song, Dunlun; Gao, Xiwu

    2017-09-01

    Aphis gossypii Glover is a destructive pest of numerous crops throughout the world. Although the expansion of Bt cotton cultivation has helped to control some insect pests, the damage from cotton aphids has not been mitigated. The evolution of aphid resistance to imidacloprid has made its chemical control more difficult since its introduction in 1991. Field populations of A. gossypii that were collected from different transgenic (Bt) cotton planting areas of China in 2014 developed different levels of resistance to imidacloprid. The IMI_R strain has developed high resistance to imidacloprid with the resistance ratio >1200-fold. Compared with the susceptible IMI_S strain, the IMI_R strain also developed a high level cross resistance to sulfoxaflor and acetamiprid. The limited synergism with either PBO or DEF suggests that resistance may be due to the site mutation of molecular target rather than to enhanced detoxification. Three target-site mutations within the nicotinic acetylcholine receptor (nAChR) β1 subunit were detected in the IMI_R strain. The R81T mutation has been reported to be responsible for imidacloprid resistance in A. gossypii and M. persicae. Both V62I and K264E were first detected in A. gossypii. These point mutations are also present in field populations, suggesting that they play a role in the resistance to imidacloprid. Furthermore, the expression level of transcripts encoding β1 subunit was decreased significantly in the IMI_R strain compared with the IMI_S strain, suggesting that both point mutations and the down-regulation of nAChR β1 subunit expression may be involved in the resistance mechanism for imidacloprid in A. gossypii. These results should be useful for the management of imidacloprid-resistant cotton aphids in Bt cotton fields in China. Copyright © 2016 Elsevier B.V. All rights reserved.

  3. Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt Spatial distribution of Aphis gossypii (Glover (Hemiptera, Aphididae and Bemisia tabaci (Gennadius biotype B (Hemiptera, Aleyrodidae on Bt and non-Bt cotton

    Directory of Open Access Journals (Sweden)

    Tatiana Rojas Rodrigues

    2010-03-01

    Full Text Available Distribuição espacial de Aphis gossypii (Glover (Hemiptera, Aphididae e Bemisia tabaci (Gennadius biótipo B (Hemiptera, Aleyrodidae em algodoeiro Bt e não-Bt. O estudo da distribuição espacial de adultos de Bemisia tabaci e de Aphis gossypii nas culturas do algodoeiro Bt e não-Bt é fundamental para a otimização de técnicas de amostragens, além de revelar diferenças de comportamento de espécies não-alvo dessa tecnologia Bt entre as duas cultivares. Nesse sentido, o experimento buscou investigar o padrão da distribuição espacial dessas espécies de insetos no algodoeiro convencional não-Bt e no cultivar Bt. As avaliações ocorreram em dois campos de 5.000 m² cada, nos quais se realizou 14 avaliações com contagem de adultos da mosca-branca e colônias de pulgões. Foram calculados os índices de agregação (razão variância/média, índice de Morisita e Expoente k da Distribuição Binomial Negativa e realizados os testes ajustes das classes numéricas de indivíduos encontradas e esperadas às distribuições teóricas de freqüência (Poisson, Binomial Negativa e Binomial Positiva. Todas as análises mostraram que, em ambas as cultivares, a distribuição espacial de B. tabaci ajustou-se a distribuição binomial negativa durante todo o período analisado, indicando que a cultivar transgênica não influenciou o padrão de distribuição agregada desse inseto. Já com relação às análises para A. gossypii, os índices de agregação apontaram distribuição agregada nas duas cultivares, mas as distribuições de freqüência permitiram concluir a ocorrência de distribuição agregada apenas no algodoeiro convencional, pois não houve nenhum ajuste para os dados na cultivar Bt. Isso indica que o algodão Bt alterou o padrão normal de dispersão dos pulgões no cultivo.The study of spatial distribution of the adults of Bemisia tabaci and the colonies of Aphis gossypii on Bt and non-Bt cotton crop is fundamental for

  4. The Joint Action of Destruxins and Botanical Insecticides (Rotenone, Azadirachtin and Paeonolum Against the Cotton Aphid, Aphis gossypii Glover

    Directory of Open Access Journals (Sweden)

    Meiying Hu

    2012-06-01

    Full Text Available The joint action of destruxins and three botanical insecticides, rotenone (Rot, azadirachtin (Aza and paeonolum (Pae against the cotton aphid, Aphis gossypii, was bioassayed. In laboratory experiment, several synergistic groups of destruxins with botanical insecticides were found by means of Sun’s Co-toxicity Coefficients (CTC and Finney’s Synergistic Coefficient (SC. The best synergistic effect was discovered in the ratio group Des/Rot 1/9 with the CTC or SC and LC50 values of 479.93 or 4.8 and 0.06 μg/mL, respectively. The second and third synergistic effects were recorded in the ratio groups Des/Rot 7/3 and 9/1. Although the ratio groups Des/Aza 6/4, Des/Pae 4/6, 3/7 and 2/8 indicated synergism by Sun’s CTC, they were determined as additive actions by Finney’s SC. Additive actions were also found in most of the ratio groups, but antagonism were recorded only in three ratio groups: Des/Pae 9/1, 7/3 and 6/4. In greenhouse tests, the highest mortality was 98.9% with the treatment Des/Rot 1/9 at 0.60 μg/mL, meanwhile, the treatments Des/Pae 4/6 and Des/Aza 6/4 had approximately 88% mortality.

  5. Molecular characterization of the Aphis gossypii olfactory receptor gene families.

    Directory of Open Access Journals (Sweden)

    Depan Cao

    Full Text Available The cotton aphid, Aphis gossypii Glover, is a polyphagous pest that inflicts great damage to cotton yields worldwide. Antennal olfaction, which is extremely important for insect survival, mediates key behaviors such as host preference, mate choice, and oviposition site selection. In insects, odor detection is mediated by odorant receptors (ORs and ionotropic receptors (IRs, which ensure the specificity of the olfactory sensory neuron responses. In this study, our aim is to identify chemosensory receptors in the cotton aphid genome, as a means to uncover olfactory encoding of the polyphagous feeding habits as well as to aid the discovery of new targets for behavioral interference. We identified a total of 45 candidate ORs and 14 IRs in the cotton aphid genome. Among the candidate AgoORs, 9 are apparent pseudogenes, while 19 can be clustered with ORs from the pea aphid, forming 16 AgoOR/ApOR orthologous subgroups. Among the candidate IRs, we identified homologs of the two highly conserved co-receptors IR8a and IR25a; no AgoIR retain the complete glutamic acid binding domain, suggesting that putative AgoIRs bind different ligands. Our results provide the necessary information for functional characterization of the chemosensory receptors of A. gossypii, with potential for new or refined applications of semiochemicals-based control of this pest insect.

  6. Susceptibilities of two populations of Aphis gossiper Glover to ...

    African Journals Online (AJOL)

    user

    2011-01-24

    Jan 24, 2011 ... Two populations of Aphis gossypii were collected from cotton and melon crops treated with insecticides to control this aphid species. The susceptibility of both aphid populations to pymetrozine,. Pirimicarb, Oxydemeton-methyl and Imidacloprid was evaluated using leaf deep bioassays in. Laboratory which ...

  7. Susceptibilities of two populations of Aphis gossiper Glover to ...

    African Journals Online (AJOL)

    Two populations of Aphis gossypii were collected from cotton and melon crops treated with insecticides to control this aphid species. The susceptibility of both aphid populations to pymetrozine, Pirimicarb, Oxydemeton-methyl and Imidacloprid was evaluated using leaf deep bioassays in Laboratory which were commonly ...

  8. Resistance of squash cultivars to Aphis gossypii Resistência de cultivares de abobrinha italiana a Aphis gossypii

    Directory of Open Access Journals (Sweden)

    Edson LL Baldin

    2009-09-01

    Full Text Available The Cucurbitaceae plants are damaged by attack of a wide spectrum of insects and microorganisms. Among the sucker insects causing damages on squash Cucurbita pepo (L., the aphid Aphis gossypii (Glover (Hemiptera: Aphididae is pointed as one of the most important, once their nymphs and adults suck the sap of the leaves continuously, besides being potential vector of virus. The present research evaluated different cultivars, aiming to identify the resistance against this aphid. The cultivars Novita, Sandy, Caserta Cac Melhorada, Novita Plus, Samira, AF-2858 and Caserta TS were used in laboratory assays (T= 25±2ºC; RH= 70±10% and fotophase= 12 h. In the immature phase the duration of nymphal instars was evaluated, the total duration and their viability, confining individuals on leaf disks from cultivars. In the adult phase the duration of reproductive period, the fecundity and the biological cycle were observed. The cultivar 'Sandy' expressed high level of antibiosis and feeding non-preference against A. gossypii, increasing the nymphal stage and causing mortality near to 70%. Besides, this cultivar reduced the production of nymphs and the longevity of the insects. The 'Novita Plus' cultivar also induced significant nymphal mortality, however in lower levels than those verified in 'Sandy', indicating a moderate resistance.As plantas da família Cucurbitaceae são prejudicadas pelo ataque de um amplo espectro de insetos e microrganismos. Dentre os insetos sugadores que atacam a abobrinha Cucurbita pepo (L., o pulgão Aphis gossypii (Glover (Hemiptera: Aphididae merece destaque, uma vez que suas ninfas e adultos sugam a seiva das folhas constantemente, além de ser potencial vetor de vírus. A presente pesquisa foi realizada com o objetivo de avaliar diferetes cultivares de abobrinha italiana quanto à resistência a esse pulgão. Utilizaram-se as cultivares Novita, Sandy, Caserta Cac Melhorada, Novita Plus, Samira, AF-2858 e Caserta TS em ensaios

  9. Performance of the Natural Mortality Factors of Aphis gossypii (Hemiptera: Aphididae) as a Function of Cotton Plant Variety and Phenology.

    Science.gov (United States)

    Chamuene, António; Araújo, Tamíris Alves; Silva, Gerson; Costa, Thiago Leandro; Berger, Paulo Geraldo; Picanço, Marcelo Coutinho

    2018-02-07

    Natural mortality factors are responsible for regulating pest populations in the field. However, plant attributes such as the variety and phenological stage can influence the performance of these factors. Therefore, we investigated the performance of the natural mortality factors of Aphis gossypii (Glover; Hemiptera: Aphididae) as a function of the plant variety and phenology. To investigate the performance of these factors, we evaluated the mortality of A. gossypii caused by natural mortality factors for 2 yr in field conditions in transgenic (Bacillus thuringiensis/Roundup Ready) and non-transgenic cotton crops during vegetative, flowering, and fruiting stages. The natural mortality factors were affected similarly between the transgenic and non-transgenic plants; however, differences were observed in their performance, depending on the phenological stage of the cotton plant. Compared with other stages, predation was higher in the flowering stage, whereas the mortality caused by rainfall was higher in the vegetative stage. Coccinellid beetles were primarily responsible for the predation on A. gossypii. These findings highlight that the performance of the natural mortality factors of A. gossypii varied more as a function of the phenological stage of cotton than of the variety. © The Author(s) 2018. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  10. Host Races of the Cotton Aphid, Aphis gossypii, in Asexual Populations from Wild Plants of Taro and Brinjal

    Science.gov (United States)

    Agarwala, B.K.; Choudhury, Parichita Ray

    2013-01-01

    Worldwide, several studies have shown that adaptation to different host plants in phytophagous insects can promote speciation. The cotton aphid, Aphis gossypii Glover (Homoptera: Aphididae: Aphidini), is a highly polyphagous species, but its populations increase by parthenogenetic reproduction alone in Indian subcontinent. This study showed that genotypes living in wild plants of taro, Colocasia esculenta var. esculenta (L.) Schott (Alismatales: Araceae), and brinjal, Solanum torvum Swartz (Solanales: Solanaceae), behave as distinct host races. Success rates of colonization after reciprocal host transfers were very poor. Clones of A. gossypii from wild taro partly survived in the first generation when transferred to wild brinjal, but nymph mortality was 100% in the second generation. In contrast, brinjal clones, when transferred to taro, could not survive even in the first generation. Significant differences between the clones from two host species were also recorded in development time, generation time, fecundity, intrinsic rate of increase, net reproductive rate, and mean relative growth rate. Morphologically, aphids of wild taro clones possessed longer proboscis and fore-femora than the aphids of the brinjal clones. The results showed that A. gossypii exists as distinct host races with different abilities of colonizing host plants, and its populations appear to have more potential of sympatic evolution than previously regarded. PMID:23895554

  11. Host races of the cotton aphid, Aphis gossypii, in asexual populations from wild plants of taro and brinjal.

    Science.gov (United States)

    Agarwala, B K; Choudhury, Parichita Ray

    2013-01-01

    Worldwide, several studies have shown that adaptation to different host plants in phytophagous insects can promote speciation. The cotton aphid, Aphis gossypii Glover (Homoptera: Aphididae: Aphidini), is a highly polyphagous species, but its populations increase by parthenogenetic reproduction alone in Indian subcontinent. This study showed that genotypes living in wild plants of taro, Colocasia esculenta var. esculenta (L.) Schott (Alismatales: Araceae), and brinjal, Solanum torvum Swartz (Solanales: Solanaceae), behave as distinct host races. Success rates of colonization after reciprocal host transfers were very poor. Clones of A. gossypii from wild taro partly survived in the first generation when transferred to wild brinjal, but nymph mortality was 100% in the second generation. In contrast, brinjal clones, when transferred to taro, could not survive even in the first generation. Significant differences between the clones from two host species were also recorded in development time, generation time, fecundity, intrinsic rate of increase, net reproductive rate, and mean relative growth rate. Morphologically, aphids of wild taro clones possessed longer proboscis and fore-femora than the aphids of the brinjal clones. The results showed that A. gossypii exists as distinct host races with different abilities of colonizing host plants, and its populations appear to have more potential of sympatic evolution than previously regarded.

  12. National Plant Diagnostic Network, Taxonomic training videos: Aphids under the microscope - Aphis gossypii

    Science.gov (United States)

    Training is a critical part of aphid (Hemiptera: Aphididae) identification. This video provides provides training to identify the cotton aphid, Aphis gossypii, using a compound microscope and an electronic identification key called “LUCID.” The video demonstrates key morphological structures that ca...

  13. Identification of semiochemicals released by cotton, Gossypium hirsutum, upon infestation by the cotton aphid, Aphis gossypii.

    Science.gov (United States)

    Hegde, Mahabaleshwar; Oliveira, Janser N; da Costa, Joao G; Bleicher, Ervino; Santana, Antonio E G; Bruce, Toby J A; Caulfield, John; Dewhirst, Sarah Y; Woodcock, Christine M; Pickett, John A; Birkett, Michael A

    2011-07-01

    The cotton aphid, Aphis gossypii (Homoptera: Aphididae), is increasing in importance as a pest worldwide since the introduction of Bt-cotton, which controls lepidopteran but not homopteran pests. The chemical ecology of interactions between cotton, Gossypium hirsutum (Malvaceae), A. gossypii, and the predatory lacewing Chrysoperla lucasina (Neuroptera: Chrysopidae), was investigated with a view to providing new pest management strategies. Behavioral tests using a four-arm (Pettersson) olfactometer showed that alate A. gossypii spent significantly more time in the presence of odor from uninfested cotton seedlings compared to clean air, but significantly less time in the presence of odor from A. gossypii infested plants. A. gossypii also spent significantly more time in the presence of headspace samples of volatile organic compounds (VOCs) obtained from uninfested cotton seedlings, but significantly less time with those from A. gossypii infested plants. VOCs from uninfested and A. gossypii infested cotton seedlings were analyzed by gas chromatography (GC) and coupled GC-mass spectrometry (GC-MS), leading to the identification of (Z)-3-hexenyl acetate, (E)-4,8-dimethyl-1,3,7-nonatriene (DMNT), methyl salicylate, and (E,E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene (TMTT), which were produced in larger amounts from A. gossypii infested plants compared to uninfested plants. In behavioral tests, A. gossypii spent significantly more time in the control (solvent) arms when presented with a synthetic blend of these four compounds, with and without the presence of VOCs from uninfested cotton. Coupled GC-electroantennogram (EAG) recordings with the lacewing C. lucasina showed significant antennal responses to VOCs from A. gossypii infested cotton, suggesting they have a role in indirect defense and indicating a likely behavioral role for these compounds for the predator as well as the aphid.

  14. Separate and Combined Effects of Mentha piperata and Mentha pulegium Essential Oils and a Pathogenic Fungus Lecanicillium muscarium Against Aphis gossypii (Hemiptera: Aphididae).

    Science.gov (United States)

    Ebadollahi, Asgar; Davari, Mahdi; Razmjou, Jabrael; Naseri, Bahram

    2017-06-01

    In the present study, the toxicity of essential oils of Mentha piperata L. and Mentha pulegium L. and pathogenicity of Lecanicillium muscarium (Zare & Gams) were studied in the melon aphid, Aphis gossypii Glover. Analyses of the essential oils by GC-MS indicated limonene (27.28%), menthol (24.71%), menthone (14.01%), and carvol (8.46%) in the M. piperata essential oil and pulegone (73.44%), piperitenone (5.49%), decane (4.99%), and limonene (3.07%) in the essential oil of M. pulegium as the main components. Both essential oils and the pathogenic fungus had useful toxicity against A. gossypii. Probit analysis indicated LC50 values (lethal concentrations to kill 50% of population; 95% confidence limits in parentheses) of M. piperata and M. pulegium essential oils as 15.25 (12.25-19.56) and 23.13 (19.27-28.42) µl/liter air, respectively. Susceptibility to the pathogenic fungus increased with exposure time. Aphid mortality also increased when the essential oils were combined with L. muscarium, although the phenomena was additive rather than synergistic. Mycelial growth inhibition of L. muscarium exposed to the essential oils was also very low. Based on our results, M. piperata and M. pulegium essential oils and the pathogenic fungus L. muscarium have some potential for management of A. gossypii. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  15. The Vat locus encodes for a CC-NBS-LRR protein that confers resistance to Aphis gossypii infestation and A. gossypii-mediated virus resistance.

    Science.gov (United States)

    Dogimont, Catherine; Chovelon, Veronique; Pauquet, Jerome; Boualem, Adnane; Bendahmane, Abdelhafid

    2014-12-01

    Aphis gossypii is a polyphagous sucking aphid and a vector for many viruses. In Cucumis melo, a dominant locus, Vat, confers a high level of resistance to Aphis gossypii infestation and to viruses transmitted by this vector. To investigate the mechanism underlying this double resistance, we first genetically dissected the Vat locus. We delimited the double resistance to a single gene that encodes for a coiled-coil-nucleotide-binding-site-leucine-rich repeat (CC-NBS-LRR) protein type. To validate the genetic data, transgenic lines expressing the Vat gene were generated and assessed for the double resistance. In this analysis, Vat-transgenic plants were resistant to A. gossypii infestation as well as A. gossypii-mediated virus transmission. When the plants were infected mechanically, virus infection occurred on both transgenic and non-transgenic control plants. These results confirmed that the cloned CC-NBS-LRR gene mediates both resistance to aphid infestation and virus infection using A. gossypii as a vector. This resistance also invokes a separate recognition and response phases in which the recognition phase involves the interaction of an elicitor molecule from the aphid and Vat from the plant. The response phase is not specific and blocks both aphid infestation and virus infection. Sequence analysis of Vat alleles suggests a major role of an unusual conserved LRR repeat in the recognition of A. gossypii. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.

  16. Interspecific Associations between Cycloneda sanguinea and Two Aphid Species (Aphis gossypii and Hyadaphis foeniculi) in Sole-Crop and Fennel-Cotton Intercropping Systems.

    Science.gov (United States)

    Fernandes, Francisco S; Ramalho, Francisco S; Malaquias, José B; Godoy, Wesley A C; Santos, Bárbara Davis B

    2015-01-01

    Aphids cause significant damage to crop plants. Studies regarding predator-prey relationships in fennel (Foeniculum vulgare Mill.) and cotton (Gossypium hirsutum L.) crops are important for understanding essential ecological interactions in the context of intercropping and for establishing pest management programs for aphids. This study evaluated the association among Hyadaphis foeniculi (Passerini) (Hemiptera: Aphididae), Aphis gossypii Glover (Hemiptera: Aphididae) and Cycloneda sanguinea (L.) (Coleoptera: Coccinellidae) in cotton with coloured fibres, fennel and cotton intercropped with fennel. Association analysis was used to investigate whether the presence or absence of prey and predator species can indicate possible interactions between aphids and ladybugs. Significant associations among both apterous and alate H. foeniculi and C. sanguinea were observed in both the fennel and fennel-cotton intercropping systems. The similarity analysis showed that the presence of aphids and ladybugs in the same system is significantly dependent on the type of crop. A substantial amount of evidence indicates that the presence of the ladybug C. sanguinea, is associated with apterous or alate A. gossypii and H. foeniculi in fennel-cotton intercropping system. We recommend that future research vising integrated aphid management taking into account these associations for take decisions.

  17. Antibiosis and antixenosis to Aphis gossypii (Homoptera: Aphididac) in Colocasia esculenta.

    Science.gov (United States)

    Coleson, Jenifer L; Miller, Ross H

    2005-06-01

    Fifty cultivars of taro, Colocasia esculenta (L.) Schott (Araceae), collected from islands in Micronesia and Polynesia, eight cultivars from the University of Hawaii's taro germplasm collection, and a closely related aroid, Xanthosorna sagittifolium (L.) (Araceae), were screened for antibiosis and antixenosis to Aphis gossypii Clover. Life history data for A. gossypii were collected by assessing survivorship and fecundity of aphids caged on taro leaves in the field. Significant differences in aphid reproductive rate and longevity were observed among the taro cultivars, and cultivars were ranked from most resistant to most susceptible. Antixenosis was assayed in the laboratory in a multiround choice test where A. gossypii were offered four leaf discs excised from different taro cultivars. Additionally, field observations of aphid abundance on taro cultivars were made to corroborate clip cage studies and laboratory experiments. 'Iliuaua','Rumung Mary','Maria', 'Ketan 36', and'Agaga' were the most resistant in terms of reducing aphid fecundity and survivorship, whereas the Iliuana,'Purple', 'TC-83001', and 'Putih 24' were least preferred in aphid choice tests. X. sagittifolium consistently exhibited strong aphid resistance. Resistant cultivars identified in this study may form the basis of breeding programs seeking to combine aphid resistance with other desirable agronomic traits in taro.

  18. Demography and Mass-Rearing Harmonia dimidiata (Coleoptera: Coccinellidae) Using Aphis gossypii (Hemiptera: Aphididae) and Eggs of Bactrocera dorsalis (Diptera: Tephritidae).

    Science.gov (United States)

    Yu, Jih-Zu; Chen, Bing Huei; Güncan, Ali; Atlihan, Remzi; Gökçe, Ayhan; Smith, Cecil L; Gümüs, Ebru; Chi, Hsin

    2018-04-02

    We compared rearing Harmonia dimidiata (F.) (Coleoptera: Coccinellidae) on four combinations of Aphis gossypii Glover (Hemiptera: Aphididae), and eggs of Bactrocera dorsalis Hendel (Diptera: Tephritidae), using the age-stage, two-sex life table. The four combinations were: both larvae and adults were reared on aphids; larvae were reared on aphids and adults were reared on fresh fruit fly eggs; larvae were reared on lyophilized fruit fly eggs and adults were reared on aphids; and larvae were reared on lyophilized eggs and adults were reared on fresh eggs. The highest intrinsic rate of increase (r = 0.1125 d-1) and net reproductive rate (R0 = 260.7 offspring) were observed when both larval and adult stages of H. dimidiata were reared on A. gossypii. When B. dorsalis eggs were used as rearing media for larvae, adults, or both, the values of r and R0 were significantly decreased. The lowest values (r = 0.0615 d-1 and R0 = 38.6 offspring) were observed when both larvae and adults were reared entirely on B. dorsalis eggs. Despite the lower r and R0 values, our results showed that B. dorsalis eggs could be considered as an adequate, less expensive alternative diet for rearing H. dimidiata because of the time and labor savings resulting from the ease of preparation and the ability to store the eggs for timely usage. The mass-rearing analysis showed that the most economical rearing system was to rear larvae on A. gossypii and adults on B. dorsalis eggs.

  19. An Attractant of the Aphidophagous Gall Midge Aphidoletes aphidimyza From Honeydew of Aphis gossypii.

    Science.gov (United States)

    Watanabe, Hiroshi; Yano, Eizi; Higashida, Keita; Hasegawa, Syouichi; Takabayashi, Junji; Ozawa, Rika

    2016-02-01

    Many natural enemies of insects use honeydew as a volatile cue to locate hosts or prey, as an oviposition stimulant, and as an arrestant for foraging. The aphidophagous gall midge Aphidoletes aphidimyza (Rondani) (Diptera: Cecidomyiidae) has predacious larval stages and can be used to control aphid populations, especially in greenhouses. Previous studies have shown that the honeydew, excreted by the aphid Myzus persicae, attracts A. aphidimyza, but the crucial attractants have not been identified. Using an olfactometer, we studied behavioral responses of female A. aphidimyza to volatiles emitted from honeydew excreted by the aphid Aphis gossypii on eggplants. The volatiles attracted female midges and induced oviposition. Moreover, using gas chromatography coupled with mass spectrometry (GC/MS), we identified phenylacetaldehyde as the attractant compound in the honeydew, although it did not induce oviposition in olfactometer experiments.

  20. Nano-formulation enhances insecticidal activity of natural pyrethrins against Aphis gossypii (Hemiptera: Aphididae) and retains their harmless effect to non-target predators.

    Science.gov (United States)

    Papanikolaou, Nikos E; Kalaitzaki, Argyro; Karamaouna, Filitsa; Michaelakis, Antonios; Papadimitriou, Vassiliki; Dourtoglou, Vassilis; Papachristos, Dimitrios P

    2018-04-01

    The insecticidal activity of a new nano-formulated natural pyrethrin was examined on the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae), and the predators Coccinella septempunctata L. (Coleoptera: Coccinellidae) and Macrolophus pygmaeus Rambur (Hemiptera: Miridae), in respect with the nano-scale potential to create more effective and environmentally responsible pesticides. Pyrethrin was nano-formulated in two water-in-oil micro-emulsions based on safe biocompatible materials, i.e., lemon oil terpenes as dispersant, polysorbates as stabilizers, and mixtures of water with glycerol as the dispersed aqueous phase. Laboratory bioassays showed a superior insecticidal effect of the pyrethrin micro-emulsions compared to two commercial suspension concentrates of natural pyrethrins against the aphid. The nano-formulated pyrethrins were harmless, in terms of caused mortality and survival time, to L3 larvae and four-instar nymphs of the predators C. septempunctata and M. pygmaeus, respectively. We expect that these results can contribute to the application of nano-technology in optimization of pesticide formulation, with further opportunities in the development of effective plant protection products compatible with integrated pest management practices.

  1. The R81T mutation in the nicotinic acetylcholine receptor of Aphis gossypii is associated with neonicotinoid insecticide resistance with differential effects for cyano- and nitro-substituted neonicotinoids.

    Science.gov (United States)

    Hirata, Koichi; Jouraku, Akiya; Kuwazaki, Seigo; Kanazawa, Jun; Iwasa, Takao

    2017-11-01

    The cotton aphid, Aphis gossypii Glover, is one of the most agriculturally important insect pests. Neonicotinoid insecticides and sulfoxaflor have generally shown excellent control of A. gossypii, but these aphids have recently developed resistance against neonicotinoid insecticides. We previously characterized a field-collected A. gossypii Kushima clone that showed higher resistance to nitro-substituted neonicotinoids, such as imidacloprid, than to cyano-substituted neonicotinoids, such as acetamiprid. This Kushima clone harbors the R81T mutation in the nicotinic acetylcholine receptor (nAChR) β1 subunit; this mutation is the source of neonicotinoid insecticide resistance. In the present study, electrophysiological analyses and molecular modeling were employed to investigate the differential effects of the R81T mutation on cyano- and nitro-substituted neonicotinoids and sulfoxaflor. We isolated full-length coding sequences of A. gossypii nAChR α1, α2, and β1 subunits. When co-expressed in Xenopus laevis oocytes with chicken β2 nAChR, A. gossypii α1 evoked inward currents in a concentration-dependent manner in response to acetylcholine (ACh) and showed sensitivity to neonicotinoid and sulfoxaflor. Additionally, the chicken β2 T77R+E79V (equivalent double mutant of R81T) mutation resulted in a lower effect to cyano-substituted neonicotinoids and sulfoxaflor than to nitro-substituted neonicotinoids. Electrophysiological data and nAChR homology modeling analysis suggested that the Kushima clone exhibited different levels of resistance to cyano- and nitro-substituted neonicotinoid insecticides. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. The behavior of Aphis gossypii and Aphis craccivora (Hemiptera: Aphididae and of their predator Cycloneda sanguinea (Coleoptera: Coccinellidae in cotton-cowpea intercropping systems

    Directory of Open Access Journals (Sweden)

    FRANCISCO S. FERNANDES

    2018-02-01

    Full Text Available ABSTRACT The intercropping is an important cultural practice commonly used in pest management. It is based on the principle that increased plant diversity in the agro-ecosystem can lead to reductions of pest populations in the crop. The current study aimed to assess the impact the colored fiber cotton-cowpea intercropped systems on Aphis gossypii and Aphis craccivora and on their predator Cycloneda sanguinea and the losses and the dispersion behavior of these aphids and their predator in these cropping systems. The experiment had a randomized block experimental design with two bioassays and four treatments. The number of apterous and alate aphids (A. gossypii per cotton plant was 1.46 and 1.73 or 1.97 and 2.19 times highest in the solid cotton system than that found in the cotton-cowpea intercropped systems (S1 and (S2, respectively. On the other hand, the cotton-cowpea intercropped systems (S1 and S2 reduced, respectively, in 43% and 31% the number of apterousA. gossypiiper cotton plant compared to the control. Implementing cotton-cowpea intercropped system in the S1 scheme reduced A. gossypii infestation, favored the multiplication of C. sanguinea, and allowed obtaining heavier open bolls.

  3. The behavior of Aphis gossypii and Aphis craccivora (Hemiptera: Aphididae) and of their predator Cycloneda sanguinea (Coleoptera: Coccinellidae) in cotton-cowpea intercropping systems.

    Science.gov (United States)

    Fernandes, Francisco S; Godoy, Wesley A C; Ramalho, Francisco S; Malaquias, José B; Santos, Bárbara D B

    2018-02-01

    The intercropping is an important cultural practice commonly used in pest management. It is based on the principle that increased plant diversity in the agro-ecosystem can lead to reductions of pest populations in the crop. The current study aimed to assess the impact the colored fiber cotton-cowpea intercropped systems on Aphis gossypii and Aphis craccivora and on their predator Cycloneda sanguinea and the losses and the dispersion behavior of these aphids and their predator in these cropping systems. The experiment had a randomized block experimental design with two bioassays and four treatments. The number of apterous and alate aphids (A. gossypii) per cotton plant was 1.46 and 1.73 or 1.97 and 2.19 times highest in the solid cotton system than that found in the cotton-cowpea intercropped systems (S1) and (S2), respectively. On the other hand, the cotton-cowpea intercropped systems (S1 and S2) reduced, respectively, in 43% and 31% the number of apterousA. gossypiiper cotton plant compared to the control. Implementing cotton-cowpea intercropped system in the S1 scheme reduced A. gossypii infestation, favored the multiplication of C. sanguinea, and allowed obtaining heavier open bolls.

  4. Leaf endophytic fungi of chili (Capsicum annuum and their role in the protection against Aphis gossypii (Homoptera: Aphididae

    Directory of Open Access Journals (Sweden)

    HENY HERNAWATI

    2011-10-01

    Full Text Available Hernawati H, Wiyono S, Santoso S (2011 Leaf endophytic fungi of chili (Capsicum annuum and their role in the protection against Aphis gossypii (Homoptera: Aphididae. Biodiversitas 12: 187-191. The objectives of the research were to study the diversity of leaf endophytic fungi of chili, and investigate its potency in protecting host plants against Aphis gossypii Glov. Endophytic fungi were isolated from chili leaves with two categories: aphid infested plants and aphid-free plants, collected from farmer’s field in Bogor, West Java. Abundance of each fungal species from leave samples was determined by calculating frequency of isolation. The isolated fungi were tested on population growth of A. gossypii. The fungal isolates showed suppressing effect in population growth test, was further tested on biology attributes i.e. life cycle, fecundity and body length. Five species of leaf endophytic fungi of chili were found i.e. Aspergillus flavus, Nigrospora sp., Coniothyrium sp., and SH1 (sterile hypha 1, SH2 (sterile hypha 2. Eventhough the number of endophytic fungi species in aphid-free and aphid-infested plant was same, the abundance of each species was different. Nigrospora sp., sterile hyphae 1 and sterile hyphae 2 was more abundant in aphid-free plants, but there was no difference in dominance of Aspergillus flavus and Coniothyrium sp. Nigrospora sp., SH1 and SH2 treatment reduced significantly fecundity of A. gossypii. Only SH2 treatment significantly prolonged life cycle and suppress body length, therefore the fungus had the strongest suppressing effect on population growth among fungi tested. The abundance and dominance of endophytic fungal species has relation with the infestation of A. gossypii in the field.

  5. Effects on the non-target aphid Aphis Gossypii Glover (Homoptera ...

    African Journals Online (AJOL)

    bych76-zhjh77

    2012-05-22

    May 22, 2012 ... parasitoids and their honeydew is an important energy source for several arthropods. Analyses of the impact of transgenic plants expressing Cry toxins on aphids gave variable results ranging from minor negative effects on aphid survival and fecundity to significant beneficial effects on aphid populations ...

  6. KELIMPAHAN DAN KEANEKARAGAMAN SPESIES SERANGGA PREDATOR DAN PARASITOID Aphis gossypii DI SUMATERA SELATAN

    Directory of Open Access Journals (Sweden)

    . Riyanto

    2011-11-01

    Full Text Available This study was aimed to analysis abundance and species diversity of predatory insects and parasitoid of Aphis gossypii from lowland and highland areas of South Sumatra.    Survey of was conducted in 11 vegetable centers of  South Sumatra.  The results showed that 20 species of predatory insects and 3 species of parasitoids were found from the survey. The predatory insects consisted of 15 species of coccinellid beetles, two species of syrphids, and  one species of chamaemyiid, mantid and staphylinid.  Parasitoid found were 2 species of Aphidiidae (Diaretiella rapae and Aphidius sp. and a species of Aphelinidae (Aphelinus sp..  The highest abundance of the predator was found in Soak (42.61 larvae and adults and the highest abundance of the parasitoid was found in Talang Buruk (25.99 adults.  The highest species diversity of the predator and the parasitoid were found in Soak (15 species and H’= 0.94 and in Talang Buruk (2 species and H’ = 0.27, respectively.  Abundance and species diversity of the predators and parasitoids were higher in the dry season than those in rainy season. Thus, the abundance and species diversity of the predators and parasiotids were higher in the lowland than highland areas in South Sumatra, while the seasons affected the abundance and species diversity of the predators and parasitoids.

  7. Molecular screening of insecticides with sigma glutathione S-transferases (GST) in cotton aphid Aphis gossypii using docking.

    Science.gov (United States)

    Gawande, Nilesh Dinkar; Subashini, Swaminathan; Murugan, Marimuthu; Subbarayalu, Mohankumar

    2014-01-01

    Glutathione S-transferases (GSTs) are one of the major families of detoxifying enzymes that detoxifies different chemical compounds including insecticides in different insect species. Among the GST subclasses, sigma GSTs are found to be the most abundant and conserved among different insect orders. These GSTs are found to play an important role in lipid peroxidation as well as detoxification. Cotton aphid, Aphis gossypii is the most damaging sucking pest with a wide range of hosts and vector of more than 50 plant viruses. Resistance to insecticides in A. gossypii is reported in India and in other countries. Glutathione S transferases (GSTs), an oxidative enzyme is understood to have a role in insecticide resistance and plant resistance breakdown. In relation to this, we have focused on the sigma 1 (GenBank Accession No: JN989964.1) and sigma 2 (GenBank Accession No: JN989965.1) GSTs of A. gossypii and their interaction with plant natural compounds and insecticides. Molecular screening of different insecticides (Chlorphinamidine, Mevinphos, Nitenpyrum, Piperonyl butoxide, Tetrachlorovinphos, Pyrethrins, Resmetrin, Pirimicarb and Dinotefuran) and known plant derived natural compounds (Catechin, Gossypol, Myrcene, Kaempferol, P-coumaric acid, Quercetin, Tannins, α-mangostin, Capsaicin, Cinnamic acid, Citronellal, Curcumin, Dicumarol, Ellagic acid, Eugenol, Geriniol, Isoeugenol, Juglone, Menadione, Methyl jasmonate, Morin, Myricetin, Myristicin, Piperine, Plumbagin, Tangitinin C, Thymol, Vanillin, Alpha pipene, α-terpineol Apigenin and β-Caryophyllene) with sigma 1 and sigma 2 GST protein models was completed using Maestro 9.3 (Schrodinger, USA). This exercise showed the binding of piperonyl butoxide with sigma 1 GST and tannin with sigma 2 GST for further consideration.

  8. Pathogenicity of conidia-based preparations of entomopathogenic fungi against the greenhouse pest aphids Myzus persicae, Aphis gossypii, and Aulacorthum solani (Hemiptera: Aphididae).

    Science.gov (United States)

    Jandricic, S E; Filotas, M; Sanderson, J P; Wraight, S P

    2014-05-01

    Seeking new isolates of entomopathogenic fungi with greater virulence against greenhouse aphid pests than those currently registered in North America for control of these insects, single-dose screening assays of 44 selected fungal isolates and 4 commercially available strains were conducted against first-instar nymphs of Myzus persicae and Aphis gossypii. The assays identified a number of Beauveria and Metarhizium isolates with virulence equal to or greater than that of the commercial strains against the nymphal aphids, but none exhibited exceptionally high virulence. Virulence of Isaria isolates was unexpectedly low (1000conidia/mm(2)). In dose-response assays, Beauveria ARSEF 5493 proved most virulent against M. persicae and A. gossypii; however, LC50s of this isolate did not differ significantly from those of B. bassiana commercial strain JW-1. Dose-response assays were also conducted with Aulacorthum solani, the first reported evaluations of Beauveria and Metarhizium against this pest. The novel isolate Metarhizium 5471 showed virulence⩾that of Beauveria 5493 in terms of LC25 and LC50, but 5493 produced a steeper dose response (slope). Additional tests showed that adult aphids are more susceptible than nymphs to fungal infection but confirmed that infection has a limited pre-mortem effect on aphid reproduction. Effects of assay techniques and the potential of fungal pathogens as aphid-control agents are discussed. Copyright © 2014 Elsevier Inc. All rights reserved.

  9. Ability of Aphis gossypii and Myzus persicae to Transmit Cucumber mosaic virus in Single and Mixed Infection with Two Potyviruses to Zucchini Squash Eficiência dos afídeos Aphis gossypii e Myzus persicae na transmissão do Cucumber mosaic virus em infecção simples e mista com dois Potyvirus para abobrinha de moita

    Directory of Open Access Journals (Sweden)

    Zayame Vegette Pinto

    2008-06-01

    Full Text Available The main objective of this work was to investigate the ability of Aphis gossypii and Myzus persicae to transmit Cucumber mosaic virus (CMV singly and mixed with two potyviruses (Papaya ringspot virus - type W, PRSV-W and Zucchini yellow mosaic virus, ZYMV, to zucchini squash plants (Cucurbita pepo. The results showed that the potyviruses in general were more efficiently transmitted by both species of aphids as compared to CMV. The transmission of PRSV-W, ZYMV and CMV separately was more efficient than in mixture.O objetivo desse trabalho foi estudar a eficiência de Aphis gossypii e Myzus persicae na transmissão do vírus do mosaico do pepino (Cucumber mosaic virus, CMV, isoladamente e em mistura com duas espécies de potyvirus (Vírus do mosaico do mamoeiro = Papaya ringspot virus - type W, PRSV-W e Vírus do mosaico amarelo da abobrinha = Zucchini yellow mosaic virus, ZYMV, para planta-testes de abobrinha de moita (Cucurbita pepo. Os dois potyvirus em geral foram transmitidos com mais eficiência pelas duas espécies de afídeos do que o CMV. A transmissão do PRSV-W, ZYMV e CMV, separadamente, foi mais eficiente do que em mistura.

  10. The effect of Chrysoperla carnea (Neuroptera: Chrysopidae) and Adalia bipunctata (Coleoptera: Coccinellidae) on the spread of cucumber mosaic virus (CMV) by Aphis gossypii (Hemiptera: Aphididae).

    Science.gov (United States)

    Garzón, A; Budia, F; Medina, P; Morales, I; Fereres, A; Viñuela, E

    2015-02-01

    The effects of two aphidophagous predators, the larvae of Chrysoperla carnea and adults of Adalia bipunctata, on the spread of cucumber mosaic virus (CMV) transmitted in a non-persistent manner by the cotton aphid Aphis gossypii were studied under semi-field conditions. Natural enemies and aphids were released inside insect-proof cages (1 m × 1 m × 1 m) with a central CMV-infected cucumber plant surrounded by 48 healthy cucumber seedlings, and the spatiotemporal dynamics of the virus and vector were evaluated in the short and long term (1 and 5 days) in the presence and absence of the natural enemy. The spatial analysis by distance indices methodology together with other indices measuring the dispersal around a single focus was used to assess the spatial pattern and the degree of association between the virus and its vector. Both natural enemies significantly reduced the number of aphids in the CMV-source plant after 5 days but not after 1 day. The CMV transmission rate was generally low, especially after 1 day, due to the limited movement of aphids from the central CMV-source plant, which increased slightly after 5 days. Infected plants were mainly located around the central virus-infected source plant, and the percentage of aphid occupation and CMV-infected plants did not differ significantly in absence and presence of natural enemies. The distribution patterns of A. gossypii and CMV were only coincident close to the central plant. The complexity of multitrophic interactions and the role of aphid predators in the spread of CMV are discussed.

  11. The influence of natural enemies on wing induction in Aphis fabae and Megoura viciae (Hemiptera: Aphididae).

    Science.gov (United States)

    Kunert, G; Schmoock-Ortlepp, K; Reissmann, U; Creutzburg, S; Weisser, W W

    2008-02-01

    Previous studies have shown that the aphid species, Aphis fabae Scopoli and Megoura viciae Buckton, do not produce winged offspring in the presence of natural enemies, in contrast to results for the pea aphid (Acyrthosiphon pisum (Harris)) and the cotton aphid (Aphis gossypii Glover); but these studies did not involve exposing aphids directly to natural enemies. We exposed colonies of both A. fabae and M. viciae to foraging lacewing (Chrysoperla carnea (Stephens)) larvae and found that the predators did not induce winged morphs among offspring compared to unexposed controls. Colonies of A. fabae responded to an increase in aphid density with increasing winged morph production, while such response was not found for M. viciae. We suggest that different aphid species differ in their susceptibility to natural enemy attack, as well as in their sensitivity to contact.

  12. Status Of Cotton Aphid, Aphis gssypiiGlover (Homoptera ...

    African Journals Online (AJOL)

    They call for a strict national effort to regulate the influx of pesticides on the market, and ensure safe insecticide types and usage, as well as manage resistance in all concerned major insect pests. Les caractéristiques de répartition en groupes électrophorétiques et les analyses quantitatives de carboxylestérases de l'aphidé ...

  13. Caracterização da transmissão do vírus do mosaico-das-nervuras do algodoeiro pelo pulgão Aphis gossyphii com relação à persistência e ao tempo necessário para inoculação Characterization of cotton vein mosaic vírus by Aphis gossyphii transmission with relation to persistence and time necessary for inoculation

    Directory of Open Access Journals (Sweden)

    Marcos Doniseti Michelotto

    2007-01-01

    Full Text Available Na cultura do algodoeiro, Gossypium hirsutum L., o pulgão Aphis gossypii Glover, 1877 (Hemiptera: Aphididae destaca-se pela transmissão do vírus do mosaico-das-nervuras do algodoeiro. O objetivo deste trabalho foi avaliar a persistência da transmissão desse vírus por A. gossypii e determinar o período necessário para sua inoculação. No ensaio de persistência, 20 pulgões ápteros virulíferos foram individualizados e transferidos diariamente para plantas de algodoeiro sadias. O período necessário para inoculação foi determinado em adultos ápteros e alados virulíferos, que permaneceram confinados isoladamente em plantas sadias por períodos de 40 segundos, 45 minutos, 1,5 hora, 3, 6, 12, 24 e 48 horas. Observou-se que 35% dos pulgões transmitiram o vírus por mais de cinco plantas sucessivamente, no ensaio de persistência. Verificou-se transmissão por um período máximo de 12 dias após a aquisição, o que caracteriza a relação vírus-vetor como persistente. Os adultos ápteros transmitiram o vírus para maior percentual de plantas (75,0% quando o período de acesso à inoculação foi de 24 horas. Os alados transmitiram o vírus em todos os períodos de acesso à inoculação, com porcentagens variando de 5,0% (40 segundos a 60,0% (48 horas. A persistência da transmissão do vírus pelo pulgão e o aumento na eficiência de transmissão em função do aumento do período de acesso à inoculação revelam que a transmissão é do tipo circulativa.In cotton crops (Gossypium hirsutum L., the aphid Aphis gossypii Glover, 1877 (Hemiptera: Aphididae is a major sanitary factor due forts efficiency on transmission of cotton vein mosaic virus (CVMV. The objective of this work was to evaluate the persistence of CVMV on transmission by A. gossypii and to determine the necessary feeding period for inoculation. In the persistence assay, individual aphids wingless viruliferous were separately transferred daily to successive series of

  14. Evaluation du potentiel insecticide de l'huile essentielle de Ocimum ...

    African Journals Online (AJOL)

    Evaluation du potentiel insecticide de l'huile essentielle de Ocimum canum Sims sur Aphis gossypii Glover (Homoptera : Aphididae) au Togo. PK Akantetou, K Koba, AY Nenonene, WP Poutouli, C Raynaud, K Sanda ...

  15. Evaluation and application of parasitoids for biological control of Aphis gossypii in glasshouse cucumber crops

    NARCIS (Netherlands)

    Steenis, van M.

    1995-01-01

    Introduction
    Aphids are an important problem in glasshouse vegetables. Already at low aphid densities fruits can get contaminated with honeydew, which decreases the economical value of the fruits. When aphids feed on the growing tips of the plants, the new shoots can get heavily

  16. Evaluation and application of parasitoids for biological control of Aphis gossypii in glasshouse cucumber crops

    NARCIS (Netherlands)

    Steenis, van M.

    1995-01-01

    Introduction
    Aphids are an important problem in glasshouse vegetables. Already at low aphid densities fruits can get contaminated with honeydew, which decreases the economical value of the fruits. When aphids feed on the growing tips of the plants, the new shoots can

  17. Molecular Mechanisms Regulating Sporulation in the Filamentous Fungus Ashbya gossypii

    DEFF Research Database (Denmark)

    Wasserstrom, Lisa

    , which is regulated by the pheromone response pathway. Most ascomycetes have been reported to produce meiotic spores, however, a sexual cycle has not yet been identified in the filamentous fungus Ashbya gossypii. The main focus of my doctoral thesis has therefore been to understand the mechanisms behind...... sporulation in this fungus.  The lifecycle of A. gossypii starting with a haploid spore that matures into spore-containing mycelia can be completed without the need for a mating partner. Spores in A. gossypii are thought to be derived sexually like all other Saccharomycetaceae species, but the sexual cycle...... suggesting that other proteins generate DSBs in this fungus. In summary, this work has led to better understanding of the components regulating sporulation in A. gossypii and their hierarchical organization....

  18. Partial leaf chemical profiles of a desert watermelon species (Citrullus colocynthis) and heirloom watermelon cultivars (Citrullus lanatus var. lanatus)

    Science.gov (United States)

    Whiteflies [Bemisia tabaci (Gennadius)] and aphids [Aphis gossypii Glover and Myzus persicae (Sulzer)] are serious threats to watermelon by direct feeding and by transmitting viruses of important virus diseases. The desert watermelon Citrullus colocynthis (L.) has been shown to exhibit resistance t...

  19. 2018-02-20T22:04:06Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    article/75931 2018-02-20T22:04:06Z ijbcs:ART Evaluation du potentiel insecticide de l'huile essentielle de Ocimum canum Sims sur Aphis gossypii Glover (Homoptera : Aphididae) au Togo Akantetou, PK Koba, K Nenonene, AY Poutouli, WP ...

  20. Toxicity of pymetrozine and thiamethoxam to Aphelinus gossypii and Delphastus pusillus Toxicidade de pimetrozine e tiametoxam a Aphelinus gossypii e Delphastus pusillus

    OpenAIRE

    Jorge Braz Torres; Christian Sherley Araujo Silva-Torres; José Vargas de Oliveira

    2003-01-01

    The objective of this work was to study the toxicity of pymetrozine and thiamethoxam to the cotton aphid parasitoid Aphelinus gossypii Timberlake and to the whitefly predator Delphastus pusillus (LeConte). Cotton leaves containing mummies of the parasitoid A. gossypii were collected and treated with seven concentrations of both insecticides. Parasitoid emergence was not affected by pymetrozine and ranged from 59.9% to 75.0%, but decreased with the increase of thiamethoxam concentrations rangi...

  1. Hábito de crescimento de Colletotrichum gossypii e C. gossypii var. Cephalosporioides em sementes de algodoeiro Growth habit of Colletotrichum gossypii and C. Gossypii var. Cephalosporioides on cotton seeds

    Directory of Open Access Journals (Sweden)

    Maria Aparecida de Souza Tanaka

    1996-01-01

    Full Text Available Observações sobre o hábito de crescimento de Colletotrichum gossypii e C. gossypii var. cephalosporioides em sementes de algodoeiro, inoculadas artificialmente e incubadas a 20-22°C durante cinco a sete dias, evidenciaram as seguintes características: (a em raízes: acérvulos isolados ou em grupos, massa conidial cor branco-suja, alaranjada ou salmão (mais freqüente, setas marrom-escuras, muitas vezes encobertas pela matriz gelatinosa; conídios produzidos também no micélio aéreo ou nas extremidades das setas, onde ficam aderidos, formando pequenos aglomerados; (b na superfície das sementes: conídios produzidos nos ápices de setas que emergem diretamente do tegumento, ficando aderidos uns aos outros, formando cachos, semelhantes a cadeias, que são vistos brilhantes sob a luz, em estereomicroscópio. As setas férteis são formadas também no micélio aéreo que recobre as sementes, geralmente após cinco dias de incubação. Os acérvulos com massa conidial raramente são visíveis, exceto em sementes danificadas ou mortas. Como característica de C. gossypii, observou-se que as sementes exibem, de modo geral, uma coloração rosada, em decorrência da abundante esporulação; a ausência ou escassez de micélio aéreo e as setas curtas resultam em um crescimento rente ao tegumento e aspecto compacto. Comparativamente, nas sementes com C. gossypii var. cephalosporioides, as setas são mais longas e menos densas; o micélio aéreo com setas férteis ocorre com mais freqüência, conferindo às sementes tonalidades acinzentadas e aspecto solto. A constatação de setas férteis em lesões foliares de ramulose evidencia que, no campo, essas estruturas podem funcionar como autênticos conidióforos, desempenhando um importante papel epidemiológico, ao possibilitar a disseminação dos esporos pelos ventos, a longas distâncias.The growth habit of Colletotrichum gossypii and C. gossypii var. cephalosporioides on artificially

  2. Molecular Mechanisms Regulating Sporulation in the Filamentous Fungus Ashbya gossypii

    DEFF Research Database (Denmark)

    Wasserstrom, Lisa

    , which is regulated by the pheromone response pathway. Most ascomycetes have been reported to produce meiotic spores, however, a sexual cycle has not yet been identified in the filamentous fungus Ashbya gossypii. The main focus of my doctoral thesis has therefore been to understand the mechanisms behind...... remains unidentified. In this thesis I provide a comprehensive functional analysis of genes important for sporulation in A. gossypii. Previous results, together with findings presented in this work show that the role of the pheromone response pathway in A. gossypii has been rewired to regulate sporulation...... recombination that allows cross-over between homologous chromosomes. In S. cerevisiae, this requires double strand break (DSB) formation and subsequent repair via the components Spo11 and Dmc1. The work in this thesis show that the A. gossypii Spo11 and Dmc1 homologs are not required for sporulation, thus...

  3. Toxicity of pymetrozine and thiamethoxam to Aphelinus gossypii and Delphastus pusillus

    OpenAIRE

    Torres,Jorge Braz; Silva-Torres,Christian Sherley Araujo; Oliveira,José Vargas de

    2003-01-01

    The objective of this work was to study the toxicity of pymetrozine and thiamethoxam to the cotton aphid parasitoid Aphelinus gossypii Timberlake and to the whitefly predator Delphastus pusillus (LeConte). Cotton leaves containing mummies of the parasitoid A. gossypii were collected and treated with seven concentrations of both insecticides. Parasitoid emergence was not affected by pymetrozine and ranged from 59.9% to 75.0%, but decreased with the increase of thiamethoxam concentrations rangi...

  4. Blockage of the pyrimidine biosynthetic pathway affects riboflavin production in Ashbya gossypii.

    Science.gov (United States)

    Silva, Rui; Aguiar, Tatiana Q; Domingues, Lucília

    2015-01-10

    The Ashbya gossypii riboflavin biosynthetic pathway and its connection with the purine pathway have been well studied. However, the outcome of genetic alterations in the pyrimidine pathway on riboflavin production by A. gossypii had not yet been assessed. Here, we report that the blockage of the de novo pyrimidine biosynthetic pathway in the recently generated A. gossypii Agura3 uridine/uracil auxotrophic strain led to improved riboflavin production on standard agar-solidified complex medium. When extra uridine/uracil was supplied, the production of riboflavin by this auxotroph was repressed. High concentrations of uracil hampered this (and the parent) strain growth, whereas excess uridine favored the A. gossypii Agura3 growth. Considering that the riboflavin and the pyrimidine pathways share the same precursors and that riboflavin overproduction may be triggered by nutritional stress, we suggest that overproduction of riboflavin by the A. gossypii Agura3 may occur as an outcome of a nutritional stress response and/or of an increased availability in precursors for riboflavin biosynthesis, due to their reduced consumption by the pyrimidine pathway. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. INDUCING RESISTANCE IN COTTON AGAINST COLLETOTRICHUM GOSSYPII VAR. CEPHALOSPORIOIDES WITH ESSENTIAL OILS

    Directory of Open Access Journals (Sweden)

    B. T. Santos

    2016-11-01

    Full Text Available This study aimed to evaluate the potential of essential oils of rosemary (Rosmarinus officinalis, baccharis (Baccharis trimera, lemon grass (Cymbopogon citratus, basil (Ocimum basilicum and eucalyptus (Corymbia citriodora in inducing resistance in cotton plants against C. gossypii var. cephalosporioides. The inductive effect of the essential oils was evaluated in plants growing in pots in the environment, which were treated with 1% essential oil at 47 days of age. 24 hours after elicitor treatment the plants were inoculated with a suspension of 1.5 x 105 conidia mL-1 of C. gossypii var. cephalosporioides. Five evaluations were performed disease and calculated the area under the disease progress curve. All essential oils showed potential for inducing resistance against cotton C. gossypii var. cephalosporioides.

  6. Toxicity of pymetrozine and thiamethoxam to Aphelinus gossypii and Delphastus pusillus Toxicidade de pimetrozine e tiametoxam a Aphelinus gossypii e Delphastus pusillus

    Directory of Open Access Journals (Sweden)

    Jorge Braz Torres

    2003-04-01

    Full Text Available The objective of this work was to study the toxicity of pymetrozine and thiamethoxam to the cotton aphid parasitoid Aphelinus gossypii Timberlake and to the whitefly predator Delphastus pusillus (LeConte. Cotton leaves containing mummies of the parasitoid A. gossypii were collected and treated with seven concentrations of both insecticides. Parasitoid emergence was not affected by pymetrozine and ranged from 59.9% to 75.0%, but decreased with the increase of thiamethoxam concentrations ranging from 30.2% to 69.6%. Cotton leaves infested by whitefly and treated with recommended rates of both insecticides were collected three hours, three days and six days after spraying and colonized with larvae and adults of D. pusillus. Predators released on thiamethoxam-treated leaves experienced mortality from 70% to 100%, while those released on pymetrozine-treated leaves showed mortality from 0% to 20%. Topical toxicity from both insecticides was studied on larvae, pupae and adults of D. pusillus. The survival of predator after six days of exposure to 400, 600 and 800 mg/L of pymetrozine a.i. was higher than 69.6%, and to 25, 100 and 200 mg/L of thiamethoxam a.i. was lower than 8.7%. The toxicity data for A. gossypii and D. pusillus characterize the pymetrozine as harmless for both species, and thiamethoxam of low to moderate toxicity for A. gossypii treated mummies, and high toxicity for D. pusillus.O objetivo deste trabalho foi estudar a toxicidade de pimetrozine e tiametoxam ao parasitóide do pulgão-do-algodoeiro Aphelinus gossypii Timberlake e ao predador da mosca-branca Delphastus pusillus (LeConte. Folhas de algodoeiro contendo múmias do parasitóide A. gossypii foram coletadas e tratadas com sete concentrações de ambos inseticidas. A emergência do parasitóide não foi afetada pelo pimetrozine e variou de 59,9% a 75%, enquanto as múmias tratadas com tiametoxam produziram emergência de A. gossypii variando de 30,2% a 69,6%. Plantas infestadas

  7. Metabolic engineering of riboflavin production in Ashbya gossypii through pathway optimization.

    Science.gov (United States)

    Ledesma-Amaro, Rodrigo; Serrano-Amatriain, Cristina; Jiménez, Alberto; Revuelta, José Luis

    2015-10-14

    The industrial production of riboflavin mostly relies on the microbial fermentation of flavinogenic microorganisms and Ashbya gossypii is the main industrial producer of the vitamin. Accordingly, bioengineering strategies aimed at increasing riboflavin production in A. gossypii are highly valuable for industry. We analyze the contribution of all the RIB genes to the production of riboflavin in A. gossypii. Two important metabolic rate-limiting steps that limit the overproduction of riboflavin have been found: first, low mRNA levels of the RIB genes hindered the overproduction of riboflavin; second, the competition of the AMP branch for purinogenic precursors also represents a limitation for riboflavin overproduction. Thus, overexpression of the RIB genes resulted in a significant increase in riboflavin yield. Moreover, both the inactivation and the underexpression of the ADE12 gene, which controls the first step of the AMP branch, also proved to have a positive effect on riboflavin production. Accordingly, a strain that combines both the overexpression of the RIB genes and the underexpression of the ADE12 gene was engineered. This strain produced 523 mg/L of riboflavin (5.4-fold higher than the wild-type), which is the highest titer of riboflavin obtained by metabolic engineering in A. gossypii so far. Riboflavin production in A. gossypii is limited by a low transcription activity of the RIB genes. Flux limitation towards AMP provides committed substrate GTP for riboflavin overproduction without detrimental effects on biomass formation. A multiple-engineered Ashbya strain that produces up to 523 mg/L of riboflavin was generated.

  8. Resistance source to cowpea aphid (Aphis craccivora Koch) in ...

    African Journals Online (AJOL)

    The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854. These landraces from the region of Biskra (in the south of Algeria) were selected in an initial field trial and subjected to further testing in the greenhouse. Landrace V51 proved to be the ...

  9. 75 FR 75170 - APHIS User Fee Web Site

    Science.gov (United States)

    2010-12-02

    ... information about APHIS' user fees, contact Mrs. Kris Caraher, Section Head, User Fees Section, Financial... contains information about the Agency's user fees. ADDRESSES: The Agency's user fee Web site is located at.... SUPPLEMENTARY INFORMATION: A user fee is a charge to identifiable recipients (e.g., individuals or firms)--users...

  10. Resistance source to cowpea aphid (Aphis craccivora Koch) in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-18

    Jul 18, 2008 ... The present study evaluated the resistance of 7 varieties of the broad bean Vicia faba L. to cowpea aphid, Aphis craccivora Koch, 1854. These landraces from the region of Biskra (in the south of Algeria) were selected in an initial field trial and subjected to further testing in the greenhouse. Landrace V51.

  11. 7 CFR 322.15 - APHIS review of permit applications; denial or cancellation of permits.

    Science.gov (United States)

    2010-01-01

    ... (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE BEES, BEEKEEPING BYPRODUCTS, AND BEEKEEPING EQUIPMENT Importation of Restricted Organisms § 322.15 APHIS review of permit...

  12. Variabilidade genética entre isolados de Colletotrichum gossypii do algodoeiro Genetic variability among the isolates of Colletotrichum gossypii of cotton

    Directory of Open Access Journals (Sweden)

    Yeshwant R. Mehta

    2010-03-01

    Full Text Available O algodoeiro é atacado por Colletotrichum gossypii (CG e C. gossypii var. cephalosporioides (CGC. Ambos os patógenos são transmitidos pela semente e sua distinção morfológica é extremamente difícil e inconsistente. Tentativas foram feitas no presente trabalho para verificar a variabilidade genética entre CG e CGC através de RAPD-PCR, ERIC- e REP-PCR e PCR-RFLP da região ITS rDNA. Foram utilizados 53 isolados coletados de sementes e folhas de plantas de diferentes cultivares nos estados do Paraná, São Paulo, Mato Grosso, Minas Gerais, e Paraiba, entre 1999 e 2003. Baseado em testes de patogenicidade, vinte e um isolados foram classificados como CG e 32 como CGC. Os resultados obtidos por RAPD-PCR, utilizando-se oito primers, revelaram dois grupos distintos sendo que o primeiro foi formado por 94% dos isolados de sementes e o segundo por 95% dos isolados de folhas. Na análise de ERIC- e REP-PCR, resultados semelhantes a RAPD foram obtidos, sendo que o primeiro grupo foi formado por 93% dos isolados provenientes das sementes e o segundo por 78% dos isolados provenientes das folhas. Quando o produto de amplificação da região ITS rDNA foi digerido com oito enzimas de restrição, um perfil de bandas semelhante para todos os isolados foi obtido. Resultados de RAPD, ERIC- e REP-PCR demonstraram que existem diferenças genéticas entre os isolados provenientes das sementes e aqueles provenientes de parte aérea, e esses dois grupos foram claramente distintos. Estudos futuros devem ser realizados utilizando outras técnicas moleculares para a obtenção de marcadores capazes de distinguir entre isolados de CG e CGC.Cotton is attacked by Colletotrichum gossypii (CG and C. gossypii var. cephalosporioides (CGC. Both the pathogens are transmitted by seed and their morphological distinction is extremely difficult and inconsistent. In the present study, attempts were made to verify the genetic variability among 53 isolates of CG and CGC using

  13. Evaluation of antifungal metabolites activity from bacillus licheniformis OE-04 against Colletotrichum gossypii.

    Science.gov (United States)

    Nawaz, Hafiz Husnain; Nelly Rajaofera, M J; He, Qiguang; Anam, Usmani; Lin, Chunhua; Miao, Weiguo

    2018-04-01

    Anthracnose disease in the cotton plant caused by fungal pathogen Colletotrichum gossypii. It is supposed to be most critical diseases in the cotton crop as it causes infection and leads to complete damaging of the cotton crop by infecting the leaves, stems, and bolls in the field. The disease control is challenging due to the absence of an effective fungicide without damaging the farmer health and environment. So the series of experiments were designed to assess the antagonistic activity of biosurfactant released by strain Bacillus licheniformis OE-04 against the anthracnose causing agent in cotton and this strain was screened out from forty eight strain of rhizobacteria. We also estimated the heat stability and pH range and toxicity of biosurfactant produced by strain 0E-04. The results showed that biosurfactant has maximum antifungal activity against C. gossypii. In vitro study concluded that the biosurfactant can reduce fungal activity by inhibiting the spore germination of C. gossypii. Moreover, the biosurfactant also has wide pH and temperature range. We observed Antifungal activity of biosurfactant at 5 to 10 pH range and temperature range was also wide from room temperature to 100 °C. We also observed the toxicity of biosurfactant produced by Bacillus licheniformis against zebra fish (Danio rerio). We were noticed that biosurfactant have least harmful effect with maximum concentration. The study confirmed that biosurfactant of Bacillus licheniformis have high pH and heat stability range with least harmful effects so it can be a good replacement of chemical pesticides for cotton anthracnose control. Copyright © 2018 Elsevier Inc. All rights reserved.

  14. 77 FR 15033 - Privacy Act Systems of Records; APHIS Veterinary Services User Fee System

    Science.gov (United States)

    2012-03-14

    ... Foundation Financial Information System (FFIS), the official APHIS financial system. The UFS database... Fort Collins, CO, and a backup of the system is maintained in APHIS offices in Riverdale, MD... for admittance at all times. Backup media is taken weekly to an offsite storage facility and stored on...

  15. Relationships between benthic cover, current strength, herbivory, and a fisheries closure in Glovers Reef Atoll, Belize

    Science.gov (United States)

    McClanahan, T.; Karnauskas, M.

    2011-03-01

    Benthic cover, current strengths, and fish abundance and diversity were examined on 150 lagoonal patch reefs and mapped to determine their distribution, inter-relationships, and relationship to the fisheries closure in Glovers Reef Atoll. Current strength was highest at both the northern and southern ends of the atoll and largely controlled by local wind and weakly by tidal forcing. Benthic functional group distributions varied throughout the atoll and had distinct areas of dominance. In contrast, dominance of coral species was weaker, reflecting the lost cover and zonation of Acropora, Porites, and Montastraea that were reported in the 1970s. Hard and soft corals dominated the windward rim, while the central and leeward lagoon had lower current strengths and sea grass and fleshy green algae were relatively more abundant. Brown erect algae were relatively more common in the north and calcifying green and red algae the southern ends of the atoll. Only Montastraea- Agaricia agaricites distributions were similar to reports from the 1970s with high relative dominance in the southern and northeast atoll. The central-northern zone, which was described as an Acropora zone in the 1970s, was not recognizable, and Porites porites, P. astreoides, Millepora alcicornis, and Favia fragum were the most abundant species during this survey . Hard and soft coral cover abundance declined away from the reef rim and tidal channels and was associated with fast seawater turnover and high surgeonfish abundance. Consequently, the windward rim area has retained the most original and persistent hard-soft coral and surgeonfish community and is considered a priority for future management, if the goal is to protect coral from fishing impacts.

  16. Dicty_cDB: Contig-U15920-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t... 44 10.0 1 ( EU019869 ) Aphis gossypii from Hibiscus elongation factor 1 ... ...44 10.0 1 ( EU019868 ) Aphis gossypii from Hibiscus mutabilis elongation... 44 10.0 1 ( EF660855 ) Myzus per

  17. Diversidade de afídeos na cultura do algodoeiro no município de Campo Verde (MT

    Directory of Open Access Journals (Sweden)

    Michelotto Marcos Doniseti

    2003-01-01

    Full Text Available O objetivo deste trabalho foi verificar a diversidade de afídeos (Hemiptera: Aphididae na cultura do algodoeiro (Gossypium hirsutum L. no município de Campo Verde (MT. Os afídeos foram amostrados diretamente nas plantas e através de armadilhas tipo Moericke. As amostragens foram realizadas a cada dois dias, até 60 dias após a germinação das plantas. A espécie Aphis gossypii Glover prevaleceu nas amostragens realizadas sobre as plantas. Formas aladas, de ocorrência acidental na cultura, tais como Aphis spiraecola Patch e Rhopalosiphum padi (Linnaeus também foram observadas. Com as armadilhas tipo Moericke foram capturados 2280 afídeos alados, pertencentes a 13 espécies: R. padi (52,6% do total, A. spiraecola (26,4%, A. gossypii (8,9%, Rhopalosiphum maidis (Fitch (5,3%, Geopemphigus floccosus (Moreira (3,1%, Uroleucon ambrosiae (Thomas (1,5%, Rhopalosiphum rufiabdominalis (Sasaki (1,3%, Myzus persicae (Sulzer (0,4%, Sipha flava (Forbes (0,3%, Pentalonia nigronervosa Coquerel, Tetraneura nigriabdominalis (Sasaki, Lizerius melanocallis (Quednau e Toxoptera citricidus (Kirkaldy (0,1% cada uma. Nas amostragens diretamente sobre as plantas foram observados ápteros e alados de A. gossypii e alados de A. spiraecola e R. padi. Nas armadilhas tipo Moericke, as principais espécies capturadas foram R. padi, A. spiraecola, A. gossypii e R. maidis.

  18. A mutant with riboflavin productivity obtained from non-riboflavin-producing ashbya gossypii by γ-induction

    International Nuclear Information System (INIS)

    Yang Suhong; Ge Zhongliang

    1993-01-01

    60 Co γ-ray was used to irradiate Ashbya gossypii, which does not produce riboflavin originally, and mutants were obtained with colonial colour changing from white into yellow. Mutant ratio was high at the absorption dose of 90 Gy. Results of reverse phase-HPLC, high performance-TLC and fluoroscopic analysis proved that riboflavin is produced by the mutant fermentation. The mutant remained after generations of culture, indicating that the induced new properties are stably inheritable

  19. Cotton resistance to ramulose and variability of Colletotrichum gossypii f. sp. cephalosporioides Resistência do algodoeiro a ramulose e variabilidade de Colletotrichum gossypii f. sp. cephalosporioides

    Directory of Open Access Journals (Sweden)

    Jefferson Fernandes do Nascimento

    2006-03-01

    Full Text Available Four cultivars and 21 lines of cotton were evaluated for resistance to ramulose (Colletotrichum gossypii f. sp. cephalosporioides in a field where the disease is endemic. The seeds of each genotype were planted in 5 x 5 m plots with three replications. The lines CNPA 94-101 and 'CNPA Precoce 2'were used as standard susceptible and resistant references, respectively. The disease incidence (DI was calculated from the proportion of diseased plants in the plot. The disease index (DIn was calculated from the disease severity using a 1 to 9 scale, and was evaluated at weekly intervals starting 107 days after emergence. The data collected was used to calculate the area under disease progress curve (AUDPC. In general, the DIn increased linearly with time and varied from 20.0 to 57.1 and AUDPC from 567 to 1627 among the genotypes which could be clustered in to two distinct groups. The susceptible group contained two cultivars and nine lines and the resistant group contained one cultivar and 12 lines. The relationship between disease index and evaluation times was linear for the 25 genotypes tested. The line CNPA 94-101, used as susceptible standard, was the most susceptible with an average DI = 83.4, DIn = 57.1 and AUDPC = 1627.7. The line CNPA 96-08 with DI = 37.8, DIn = 20.0 and AUDPC = 567.7 was the most resistant one. Among the commercial cultivars 'IAC 22' was the most susceptible and 'CNPA Precoce 2', used as resistant standard was the most resistant. The variability in virulence of the pathogen was studied by spray inoculating nine genotypes with conidial suspensions (10(5/mL of either of the 10 isolates. The disease severity was evaluated 30 days later using a scale of 1 to 5. The virulence of the isolate was expressed by DIn. All the isolates were highly virulent but their virulence avaried for several genotypes and could be clustered in two distinct groups of less and more virulent isolates. The isolate MTRM 14 from Mato Grosso was the least

  20. SEPARATION OF THE MINOR FLAVONOLS FROM FLOS GOSSYPII BY HIGH-SPEED COUNTERCURRENT CHROMATOGRAPHY

    Science.gov (United States)

    Yang, Yi; Zhao, Yongxin; Gu, Dongyu; Ayupbek, Amatjan; Huang, Yun; Dou, Jun; Ito, Yoichiro; Zhang, Tianyou; Aisa, Haji Akber

    2010-01-01

    An effective high-speed countercurrent chromatography (HSCCC) method was established for further separation and purification of four minor flavonols in addition to five major flavonols which were reported by our previous study from extracts of Flos Gossypii. HSCCC was performed with three two-phase solvent systems composed of n-hexane-ethyl acetate-methanol-water (7.5:15:6:7, v/v), (2.5:15:2:7, v/v) and (0:1:0:1, v/v). The separation was repeated 3 times, and 3.8 mg of 8-methoxyl-kaempferol-7-O-β-D-rhamnoside (HPLC purity 98.27%), 6.7 mg of astragalin (HPLC purity 94.18%), 3.3 mg of 4′-methoxyl-quercetin-7-O-β-D-glucoside (HPLC purity 94.30%) and 8.2 mg of hyperoside (HPLC purity 93.48%) were separated from 150 mg of the crude sample. The chemical structures of the flavonols were confirmed by MS, 1H NMR and 13C NMR. Meanwhile, the results indicated that the target compound with smaller K value (HSCCC. And four separation rules of flavonols according to the present study and references were summarized, which can be used as a useful guide for separation of flavonols by HSCCC. PMID:21494318

  1. A new species of Aphis Linnaeus, 1758 (Hem. Aphididae collected on Gymnophyton Clos (Apiaceae in Argentina

    Directory of Open Access Journals (Sweden)

    Sara I. López Ciruelos

    2017-02-01

    Full Text Available Aphis cuyana López Ciruelos & Ortego, sp. n. (Aphididae, Aphidinae is described from apterous and alate viviparous females collected on Gymnophyton polycephalum (Apiaceae in localities of the Argentinean provinces of La Rioja, San Juan and Mendoza. A table with differences of the apterous viviparous females of the new species from the species of Aphis and its close genera Andinaphis and Protaphis known in South America is presented. http://urn:lsid:zoobank.org:pub:4834FEF4-171C-4EBD-BF91-2137B517491E

  2. Newly identified resistance to soybean aphid (Aphis glycines) in soybean plant introduction lines

    Science.gov (United States)

    Host-plant resistance is potentially efficacious in managing the soybean aphid (SA, Aphis glycines Matsumura), a major invasive pest in northern soybean-production regions of North America. However, development of aphid-resistant soybean has been complicated by the presence of virulent SA biotypes,...

  3. Identificatoin and confirmation of resistance against soybean aphid (Aphis glycines) in eight wild soybean lines

    Science.gov (United States)

    The development and use of aphid-resistant soybean (Glycine max) cultivars has been complicated by the presence of multiple virulent biotypes of the soybean aphid (SA, Aphis glycines Matsumura). Ultimately, a variety of unique resistance sources may be needed to develop cultivars with a broad spectr...

  4. Identification of a new species of Aphis (Hemiptera: Aphididae) based on distinct morphology

    Science.gov (United States)

    Aphis elena Lagos-Kutz and Voegtlin, sp. nov. (Hemiptera: Aphididae), is described from specimens collected in Illinois, USA, on the North American native plant, Pycnanthemum virginianum (L.) T. Dur. & B.D. Jacks. ex B.L. Rob. & Fernald (Family: Lamiaceae). Both apterous and alate viviparae are desc...

  5. New Sources of Resistance in Cowpea to the Cowpea Aphid (Aphis ...

    African Journals Online (AJOL)

    Twenty-two advanced breeding genotypes of cowpea were evaluated for their responses to infes-tation by the cowpea aphid, Aphis craccivora Koch. The aim of the study was to identify geno-type(s) of cowpea resistant to A. craccivora to be used as breeding line(s). Seedling screening technique and aphid growth and ...

  6. 76 FR 72897 - Privacy Act Systems of Records; APHIS Animal Health Surveillance and Monitoring System

    Science.gov (United States)

    2011-11-28

    ... Veterinary Services Laboratory Submissions (VSLS), the National Poultry Improvement Plan (NPIP), and the... private industry employed to identify patterns, trends or anomalies indicative of fraud, waste, or abuse... Service, Farm Service Agency, APHIS' Wildlife Services, or from State veterinary health officials and...

  7. Development of a stage-structured process-based predator–prey model to analyse biological control of cotton aphid, Aphis gossypii, by the sevenspot ladybeetle, Coccinella septempunctata, in cotton

    NARCIS (Netherlands)

    Xia, J.Y.; Wang, J.; Cui, J.J.; Leffelaar, P.A.; Rabbinge, R.; Werf, van der W.

    2018-01-01

    Agricultural system diversification is well known to affect the population dynamics of crop pests, but predator–prey dynamics in crop systems are difficult to analyse due to interactions between multiple life stages of predator and prey, the modulating effect of temperature, the actions of

  8. 78 FR 689 - Notice of Request for Revision to and Extension of Approval of an Information Collection; APHIS...

    Science.gov (United States)

    2013-01-04

    ... participate in character and team building activities and diversity workshops. Two programs currently in the..., Diversity and Inclusion, Office of the Administrator, APHIS, 4700 River Road Unit 92, Riverdale, MD 20737...

  9. Characteristics of suspended and streambed sediment within constructed chutes and the main channel at Upper Hamburg and Glovers Point Bends, Missouri River, Nebraska, 2008

    Science.gov (United States)

    Woodward, Brenda K.; Rus, David L.

    2011-01-01

    The U.S. Army Corps of Engineers, Omaha District, as part of the Missouri River Bank Stabilization and Navigation Mitigation Project, has constructed 17 off-channel chutes along the channelized Missouri River, downstream from Sioux City, Iowa, to increase habitat diversity. To better understand characteristics of suspended and streambed sediment within these constructed chutes, the U.S. Geological Survey investigated specific aspects of chute design and function in relation to sediment characteristics including: (1) effects of inlet structures; (2) changes occurring between the inlet and the outlet of a chute; (3) effects of chutes on sediment characteristics in the main channel; and (4) differences in chute dynamics between sampled chutes. Two chutes differing in design, location, and dynamics were studied, Upper Hamburg Bend near Nebraska City, Nebr., and Glovers Point Bend near Winnebago, Nebr. Each site was characterized using five or more sampling transects (two in the chute and three to four in the main channel) designed to bracket sediment exchanges between chutes and the main channel. A sixth transect was included at the Upper Hamburg Bend study site to account for the effects of a nontarget chute having its inlet midway between the inlet and outlet of the primary chute. Representative samples of suspended and streambed sediment were collected at each transect, along with measurements of turbidity and streamflow, between June and November 2008. Four sets of samples were collected at the Glovers Point Bend study site and five sample sets were collected from the Upper Hamburg Bend study site. Results from paired t-tests and standard t-tests indicated that the inlet structure design, passing inflow only from the top of the main-channel water column, reduced the supply of coarse-grained suspended sediment entering the chutes. Statistical comparisons did not indicate differences between the inlet and outlet of either chute; however, anecdotal evidence of recent

  10. COMPORTAMENTO DO FUNGO Colletotrichum gossypii South. var. cephalosporoides Costa EM SUBSTRATO COM DIFERENTES FONTES DE NITROGÊNIO THE BEHAVIOR OF THE FUNGUS Colletotrichum gossypii South Var. cephalosporoides Costa IN SUBSTRATE CONTAINING DIFFERENT SOURCES OF NITROGEN

    Directory of Open Access Journals (Sweden)

    Yvo de Carvalho

    2007-09-01

    Full Text Available

    Nesse trabalho procurou-se observar o efeito de diversas substâncias nitrogenadas sobre o crescimento miceliano, esporulação e aspectos morfológicos das colônias do fungo Colletotrichum gossypii South. var. cephalosporoides Costa em substrato sólido. Usou-se um substrato sintético como meio-básico e a este se adicionou peptona, metionina, asparagina, nitrato de sódio ou salicilato de amônia, conforme o tratamento. A testemunha não recebeu qualquer fonte de nitrogênio. Concluiu-se que a peptona foi o melhor tratamento para esporulação e crescimento miceliano, seguindo-se a asparagina que foi eficiente na indução da esporulação. O salicilato de amônia exerceu efeito inibidor do crescimento vegetativo e da esporulação do fungo. Para produção de inóculo, a curto prazo, recomenda-se o uso da peptona como fonte de nitrogênio. Foram observadas diferenças na pigmentação, bordos e densidade das colônias. A esporulação, embora abundante em substratos contendo peptona e asparagina, ocorreu em forma de verdadeiras massas localizadas de conídios na primeira, e como conídios dispersos na segunda.

    In this experiment, the effect of different nitrogenous substances on the mycelium growth, sporulation and morphological aspects of the colonies of the fungus Colletotrichum gossypii  South Var. cephalosporoides Costa planted in a solid substrate were observed. A synthetic substrate was used as a basic medium, and to this was added peptone metionine, asparagine, sodium nitrate or ammonium salicylate, according to the treatment. The control (group received no nitrogen whatsover. It was concluded that peptone was the best treatment for sporulation and mycelium growth, and that the next best was asparagine which was helpfull in inducing sporulation. Ammonium salicylate inhibited the vegetative growth

  11. Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars

    International Nuclear Information System (INIS)

    Soglia, Maria da Conceicao M.; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes

    2007-01-01

    This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 ± 1 deg C, RH 70 ± 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

  12. Effect of alternative prey on development and consumption of Orius insidiosus (Say) (Hemiptera, Anthocoridae) and oviposition behavior on chrysantemum cultivars; Efeito da presa alternativa no desenvolvimento e consumo de Orius insidiosus (Say) (Hemiptera, Anthocoridae) e comportamento de oviposicao em cultivares de crisantemo

    Energy Technology Data Exchange (ETDEWEB)

    Soglia, Maria da Conceicao M. [Universidade Federal da Bahia (UFBA), Cruz das Almas, BA (Brazil). Centro de Ciencias Agrarias e Ambientais], e-mail: mcsoglia@yahoo.com.br; Bueno, Vanda Helena Paes; Carvalho, Livia Mendes [Universidade Federal de Lavras (UFLA), MG (Brazil). Dept. de Entomologia], e-mail: vhpbueno@ufla.br

    2007-10-15

    This work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832) feeding on Aphis gossypii Glover, 1877 as well as its oviposition behavior on two chrysanthemum cut cultivars. The trials were conducted in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photo phase. Nymphs of the predator, less than 24h old, were kept individually in petri dishes (5cm) with 20 nymphs of A. gossypii (first, second and third instar) on leaf disc (4 cm) of each cultivar ('White Reagan' and 'Yellow Snowdon') in a layer of agar-water (1%). Petiole of each chrysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879). The predator complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on 'White Reagan' and 'Yellow Snowdon', respectively. The consumption of the females of O. insidiosus was higher (P<0.01) on A. gossypii in 'White Reagan' (2.63 nymphs) compared to the consumption in 'Yellow Snowdon' (0.7 nymphs). Females of O. insidiosus oviposited in petiole of both cultivars with 22.5 and 23.3 eggs/female on 'White Reagan' and 'Yellow Snowdon', respectively. Release of O. insidiosus on chrysanthemum crops could be important to decrease the A. gossypii population, as the predator completes its development having this aphid as prey, and the chrysanthemum cultivars offer conditions to colonization and establishment of O. insidiosus. (author)

  13. Seed Treatment Combined with a Spot Application of Clothianidin Granules Prolongs the Efficacy of Controlling Piercing-Sucking Insect Pests in Cotton Fields.

    Science.gov (United States)

    Zhang, Zhengqun; Zhao, Yunhe; Wang, Yao; Li, Beixing; Lin, Jin; Zhang, Xuefeng; Mu, Wei

    2017-09-13

    Seed treatments can directly protect cotton from early season piercing-sucking insect Aphis gossypii Glover but hardly provide long-term protection against Apolygus lucorum (Meyer-Dür). Therefore, the efficacy of clothianidin seed treatments combined with spot applications of clothianidin granules at the bud stage of cotton was evaluated to control piercing-sucking pests during the entire cotton growing season. Clothianidin seed treatments (at the rate of 4 g ai/kg seed) combined with a clothianidin granular treatment (even at low rate of 0.9 kg ai/ha) at the bud stage can effectively suppress A. gossypii and A. lucorum infestations throughout the seedling and blooming stages after planting and can improve cotton yield. The spot application of clothianidin granules also reduced the population densities of Bemisia tabaci (Gennadius). The dynamic changes of clothianidin residues demonstrated that the control efficacy of clothianidin against A. gossypii and A. lucorum might be related to the residues of this neonicotinoid in cotton leaves. This pest management practice provided long-term protection against cotton piercing-sucking pests for the entire growing season of cotton plants and could supplement the short-term control efficiency of clothianidin used as a seed treatment.

  14. Hubungan Pemencaran Kutu Daun dengan Diseminasi Potato Virus Y (PVY pada Tanaman Kentang (Solanum tuberosum L.

    Directory of Open Access Journals (Sweden)

    Reymas M. R. Ruimassa

    2003-07-01

    Full Text Available Two aphid species, Myzus persicae (Sulzer, and Aphis gossypii (Glover and the five potato varieties (Alpha, Bintje, Berthaultii, Granola and Premiere were used in the experiments to study the relationship between insect vector dispersal and dissemination of disease caused by potato virus Y (PVY. The results showed that M. persicae could cause time for the appearance of first symptom two to four time faster than A. gossypii . Although statistical analysis (anova in general showed that disease incidence is not significantly different for each treatment. M. persicae caused higher disease incidence than A. gossypii on Bintje (56 and 74 days after planting. M. persicae seems to have better capability to disperse when the plant reach vegetative growth stadia which may result in higher efficiency of transmitting the virus. The relationship between aphid dispersal and dissemination of PVY can be grouped into four categories (1 plant with aphid and showing symptom; (2 plant without aphid but showing symptom; (3 plant with aphid but without symptom; (4 plant without aphid and without symptom.

  15. Presence of Native Prey Does Not Divert Predation on Exotic Pests by Harmonia axyridis in Its Indigenous Range.

    Directory of Open Access Journals (Sweden)

    Gui Fen Zhang

    Full Text Available In China, two invasive pests, Bemisia tabaci MEAM1 (Gennadius and Frankliniella occidentalis (Pergande, often co-occur with the native pest, Aphis gossypii (Glover, on plants of Malvaceae and Cucurbitaceae. All three are preyed on by the native ladybird, Harmonia axyridis (Pallas; however, the native predator might be expected to prefer native prey to the exotic ones due to a shared evolutionary past. In order to clarify whether the presence of native prey affected the consumption of these two invasive species by the native predator, field-cage experiments were conducted. A duplex qPCR was used to simultaneously detect both non-native pests within the gut of the predator. H. axyridis readily accepted both invasive prey species, but preferred B. tabaci. With all three prey species available, H. axyridis consumption of B. tabaci was 39.3±2.2% greater than consumption of F. occidentalis. The presence of A. gossypii reduced (by 59.9% on B. tabaci, and by 60.6% on F. occidentalis, but did not stop predation on the two exotic prey when all three were present. The consumption of B. tabaci was similar whether it was alone or together with A. gossypii. However, the presence of aphids reduced predation on the invasive thrips. Thus, some invasive prey may be incorporated into the prey range of a native generalist predator even in the presence of preferred native prey.

  16. Synthesis and biological activity of pyridazine amides, hydrazones and hydrazides.

    Science.gov (United States)

    Buysse, Ann M; Yap, Maurice Ch; Hunter, Ricky; Babcock, Jonathan; Huang, Xinpei

    2017-04-01

    Optimization studies on compounds initially designed to be herbicides led to the discovery of a series of [6-(3-pyridyl)pyridazin-3-yl]amides exhibiting aphicidal properties. Systematic modifications of the amide moiety as well as the pyridine and pyridazine rings were carried out to determine if these changes could improve insecticidal potency. Structure-activity relationship (SAR) studies showed that changes to the pyridine and pyridazine rings generally resulted in a significant loss of insecticidal potency against green peach aphids [Myzus persicae (Sulzer)] and cotton aphids [(Aphis gossypii (Glover)]. However, replacement of the amide moiety with hydrazines, hydrazones, or hydrazides appeared to be tolerated, with small aliphatic substituents being especially potent. A series of aphicidal [6-(3-pyridyl)pyridazin-3-yl]amides were discovered as a result of random screening of compounds that were intially investigated as herbicides. Follow-up studies of the structure-activity relationship of these [6-(3-pyridyl)pyridazin-3-yl]amides showed that biosteric replacement of the amide moiety was widely tolerated suggesting that further opportunities for exploitation may exist for this new area of insecticidal chemistry. Insecticidal efficacy from the original hit, compound 1, to the efficacy of compound 14 produced greater than 10-fold potency improvement against Aphis gossypii and greater than 14-fold potency improvement against Myzus persicae. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  17. Aphis Glycines Virus 2, a Novel Insect Virus with a Unique Genome Structure

    Directory of Open Access Journals (Sweden)

    Sijun Liu

    2016-11-01

    Full Text Available The invasive soybean aphid, Aphis glycines, is a major pest in soybeans, resulting in substantial economic loss. We analyzed the A. glycines transcriptome to identify sequences derived from viruses of A. glycines. We identified sequences derived from a novel virus named Aphis glycines virus 2 (ApGlV2. The assembled virus genome sequence was confirmed by reverse transcription polymerase chain reaction (RT-PCR and Sanger sequencing, conserved domains were characterized, and distribution, and transmission examined. This virus has a positive sense, single-stranded RNA genome of ~4850 nt that encodes three proteins. The RNA-dependent RNA polymerase (RdRp of ApGlV2 is a permuted RdRp similar to those of some tetraviruses, while the capsid protein is structurally similar to the capsid proteins of plant sobemoviruses. ApGlV2 also encodes a larger minor capsid protein, which is translated by a readthrough mechanism. ApGlV2 appears to be widespread in A. glycines populations and to persistently infect aphids with a 100% vertical transmission rate. ApGlV2 is susceptible to the antiviral RNA interference (RNAi pathway. This virus, with its unique genome structure with both plant- and insect-virus characteristics, is of particular interest from an evolutionary standpoint.

  18. Intercropping System for Protection the Potato Plant from Insect Infestation

    Directory of Open Access Journals (Sweden)

    Aziza Sharaby

    2015-06-01

    Full Text Available The use of intercropping system provides an option for insect control for organic farmers that are limited in their chemical use. Additionally, intercropping systems can be attractive to conventional growers as a cost-effective insect control solution. A study was carried out for two seasons 2011-2012 and 2012-2013 to evaluate the effect of intercropping of potato (Solanum tuberosum L. with onion (Allium cepa L. on whitefly (Bemicia tabasi Gennadius and aphids’ Myzus persicae Sulz. and Aphis gossypii Glover infestation in potato fields. Results indicated that intercropping significantly reduced potato plant infestation with whitefly by 42.7, 51.3% while it was 62.69% reduction with aphids during the two successive winter seasons than when potato plants were cultivated alone. Therefore, intercropping could be recommended as a protection method of reducing pest population in the fields.

  19. Análise Faunística de Insetos Associados à Cultura do Quiabeiro [Abelmoschus esculentus (L. Moench] em Plantio Comercial, no Município de Canindé de São Francisco, SE, Brasil

    Directory of Open Access Journals (Sweden)

    Daniele Cristina Silva

    2016-08-01

    Abstract. This research aims to study the entomofauna associated with the commercial cultivation of okra in municipality of Canindé do São Francisco, Sergipe State, Brazil, through faunal analysis. The species Bemisia tabaci (Gennadius biotype B, Aphis gossypii (Glover, Phenacoccus sp., Icerya purchasi (Maskell and Lagria villosa (Fabricius were the okra key pests. Diabrotica speciosa (Germar and Gryllus assimilis (Fabricius were plagues of secondary importance. And Leptoglossus zonatus (Dallas, Nezaraviridula L., Pachycoris torridus (Scopoli and Oxycarenus hyalinipennis (Costa were sporadic pests. Four species of predatory insects were found, a constant and dominant (Cycloneda sanguinea L. a dispersed, but constant (Eriopis connexa German and two rare (Hippodamia convergens Guérin-Méneville and Psyllobora confluens F..

  20. Efeito da presa alternativa no desenvolvimento e consumo de Orius insidiosus (Say (Hemiptera, Anthocoridae e comportamento de oviposição em cultivares de crisântemo Effect of alternative prey on development and consumption of Orius insidiosus (Say (Hemiptera, Anthocoridae and oviposition behavior on chrysantemum cultivars

    Directory of Open Access Journals (Sweden)

    Maria da Conceição M. Soglia

    2007-12-01

    Full Text Available Este trabalho teve como objetivo avaliar o desenvolvimento e o consumo de Orius insidiosus (Say, 1832 tendo Aphis gossypii Glover, 1877 como presa, bem como seu comportamento de oviposição em duas cultivares de crisântemo. O experimento foi conduzido em câmara climática a 25 ± 1ºC, UR 70 ± 10% e fotofase de 12 horas. Ninfas do predador com até 24 horas de idade foram colocadas individualmente em placas de petri (5 cm contendo 20 ninfas de A. gossypii (1º, 2º e 3º ínstares, as quais estavam posicionadas sobre disco foliar (4 cm de cada cultivar ('White Reagan' e'Yellow Snowdon' em camada de ágar-água . Na avaliação da oviposição foram utilizados pecíolos de cada cultivar como substrato de oviposição e ovos de Anagasta kuehniella (Zeller, 1879 como alimento. O predador completou seu desenvolvimento alimentando-se somente de A. gossypii presente em ambas as cultivares. A duração da fase ninfal de O. insidiosus foi de 21,1 e 18,3 dias, em 'White Reagan' e 'Yellow Snowdon', respectivamente. O consumo de A. gossypii por fêmeas foi maior (PThis work aimed to evaluate the development time and the consumption of Orius insidiosus (Say, 1832 feeding on Aphis gossypii Glover, 1877 as weel as its oviposition behavior on two crysanthemum cut cultivars. The trials were conducted in climatic chamber at 25±1ºC, RH 70±10% and 12h photophase. Nymphs of the predator, less than 24h old, were kept individualy in petri dishes (5cm with 20 nymphs of A. gossypii (1st, 2nd and 3rt instars on leaf disc (4cm of each cultivar ("White Reagan" and "Yellow Snowdon" in a layer of agar-water (1%. Petiole of each crysanthemum cultivar as oviposition substrate was evaluated and the females were feeding on eggs of Anagasta kuehniella (Zeller, 1879. The predador complete its development feeding on A. gossypii kept in both cultivars. The duration of nymphal phase of O. insidiosus were 21.1 and 18.3 days on "White Reagan" and "Yellow Snowdon", respectively

  1. Level II scour analysis for Bridge 23 (GLOVTH00410023) on Town Highway 41, crossing Sherburne Brook, Glover, Vermont

    Science.gov (United States)

    Olson, Scott A.; Boehmler, Erick M.

    1997-01-01

    This report provides the results of a detailed Level II analysis of scour potential at structure GLOVTH00410023 on Town Highway 41 crossing Sherburne Brook, Glover, Vermont (figures 1–8). A Level II study is a basic engineering analysis of the site, including a quantitative analysis of stream stability and scour (U.S. Department of Transportation, 1993). Results of a Level I scour investigation also are included in Appendix E of this report. A Level I investigation provides a qualitative geomorphic characterization of the study site. Information on the bridge, gleaned from Vermont Agency of Transportation (VTAOT) files, was compiled prior to conducting Level I and Level II analyses and is found in Appendix D. The site is in the New England Upland section of the New England physiographic province in northern Vermont. The 2.57-mi2 drainage area is in a predominantly rural and forested basin. In the vicinity of the study site, the surface cover is primarily forest with small areas of lawn and a home on the right overbank and a gravel roadway along the upstream left bank. In the study area, Sherburne Brook has an incised, sinuous channel with a slope of approximately 0.03 ft/ft, an average channel top width of 33 ft and an average bank height of 6 ft. The channel bed material ranges from gravel to boulder with a median grain size (D50) of 57.3 mm (0.188 ft). The geomorphic assessment at the time of the Level I and Level II site visit on October 24, 1994, indicated that the reach was stable. The Town Highway 41 crossing of Sherburne Brook is a 24-ft-long, one-lane bridge consisting of one 21-foot steel-beam span with a timber deck (Vermont Agency of Transportation, written communication, August 4, 1994). The opening length of the structure parallel to the bridge face is 20.3 ft. The bridge is supported by vertical, granite block abutments. The channel is skewed approximately 55 degrees to the opening while the measured opening-skew-to-roadway is 30 degrees. One foot

  2. An analysis of arthropod interceptions by APHIS-PPQ and Customs and Border Patrol in Puerto Rico

    Science.gov (United States)

    USDA Animal Plant Health Inspection Service Plant Protection and Quarantine (APHIS-PPQ) and Customs and Border Patrol (CBP) inspect traffic entering the United States for arthropods that pose a threat to national agriculture and/or ecosystems. We analyzed interceptions made by these agencies in Puer...

  3. Review of invasive grapevine aphid, Aphis illinoisensis Shimer, and native parasitoids in the Mediterranean (Hemiptera, Aphididae; Hymenoptera, Braconidae, Aphidiinae)

    Czech Academy of Sciences Publication Activity Database

    Havelka, Jan; Shukshuk, A. H.; Ghaliow, M. E.; Laamari, M.; Kavallieratos, N. G.; Tomanović, Ž.; Rakhshani, E.; Pons, X.; Starý, Petr

    2011-01-01

    Roč. 63, č. 1 (2011), s. 269-274 ISSN 0354-4664 Grant - others:Ministry of Science and Technological Development of the Republic of Serbia(CS) 43001 Institutional research plan: CEZ:AV0Z50070508 Keywords : invasions * Aphis illinoisensis * grapevine Subject RIV: EH - Ecology, Behaviour Impact factor: 0.360, year: 2011

  4. Comparison of complete mitochondrial DNA sequences between old and new world strains of the cowpea aphid, Aphis craccivora (Hemiptera: Aphididae)

    Science.gov (United States)

    Mitochondrial DNA provides useful tools for inferring population genetic structure within a species and phylogenetic relationships between species. The complete mitogenome sequences were assembled from strains of the cowpea aphids, Aphis craccivora, from the old (15,308 bp) and new world (15,305 bp...

  5. Reciprocal interactions between native and introduced populations of common milkweed, Asclepias syriaca, and the specialist aphid, Aphis nerii

    NARCIS (Netherlands)

    Bukovinszky, T.; Gols, R.; Agrawal, A.A.; Roge, C.; Bezemer, T.M.; Biere, A.; Harvey, J.A.

    2014-01-01

    Following its introduction into Europe (EU), the common milkweed (Asclepias syriaca) has been free of most specialist herbivores that are present in its native North American (NA) range, except for the oleander aphid Aphis nerii. We compared EU and NA populations of A. nerii on EU and NA milkweed

  6. 77 FR 73613 - Notice of Request for Revision to and Extension of Approval of an Information Collection; APHIS...

    Science.gov (United States)

    2012-12-11

    ... members of the general public, nature organizations, school groups, garden clubs, and others help APHIS... 0.083 hours per response. Respondents: General public, nature organizations, school groups, and garden clubs. Estimated annual number of respondents: 5,000. Estimated annual number of responses per...

  7. Potential candidates for biological control of the black bean aphid Aphis fabae in Serbia

    Directory of Open Access Journals (Sweden)

    Stanković, S.S.

    2015-09-01

    Full Text Available The black bean aphid is widely spread aphid species in the Palaearctic, known to attack over 1150 plant species. Because some of the host plants are of great agricultural interest, Aphis fabae represent a very important pest. We assembled all data concerning the presence of this pest and connected it in tritrophic associations. In the period of 24 years investigation on the territory of Serbia it has been recorded in 107 trophic associations. In total there are 145 findings of A. fabae parasitized by 19 taxa of Aphidiinae (Brackonidae from seven genera. The most suitable biocontrol agents for the black bean aphid are Lysiphlebus fabarum, Binodoxys angelicae, Lipolesis gracilis and the introduced species Lysiphlebus testaceipes.

  8. Worldwide populations of the aphid Aphis craccivora are infected with diverse facultative bacterial symbionts.

    Science.gov (United States)

    Brady, Cristina M; Asplen, Mark K; Desneux, Nicolas; Heimpel, George E; Hopper, Keith R; Linnen, Catherine R; Oliver, Kerry M; Wulff, Jason A; White, Jennifer A

    2014-01-01

    Facultative bacterial endosymbionts can play an important role in the evolutionary trajectory of their hosts. Aphids (Hemiptera: Aphididae) are infected with a wide variety of facultative endosymbionts that can confer ecologically relevant traits, which in turn may drive microevolutionary processes in a dynamic selective environment. However, relatively little is known about how symbiont diversity is structured in most aphid species. Here, we investigate facultative symbiont species richness and prevalence among world-wide populations of the cowpea aphid, Aphis craccivora Koch. We surveyed 44 populations of A. craccivora, and detected 11 strains of facultative symbiotic bacteria, representing six genera. There were two significant associations between facultative symbiont and aphid food plant: the symbiont Arsenophonus was found at high prevalence in A. craccivora populations collected from Robinia sp. (locust), whereas the symbiont Hamiltonella was almost exclusively found in A. craccivora populations from Medicago sativa (alfalfa). Aphids collected from these two food plants also had divergent mitochondrial haplotypes, potentially indicating the formation of specialized aphid lineages associated with food plant (host-associated differentiation). The role of facultative symbionts in this process remains to be determined. Overall, observed facultative symbiont prevalence in A. craccivora was lower than that of some other well-studied aphids (e.g., Aphis fabae and Acyrthosiphon pisum), possibly as a consequence of A. craccivora's almost purely parthenogenetic life history. Finally, most (70 %) of the surveyed populations were polymorphic for facultative symbiont infection, indicating that even when symbiont prevalence is relatively low, symbiont-associated phenotypic variation may allow population-level evolutionary responses to local selection.

  9. Quality of different aphids as hosts of the parasitoid Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae); Qualidade de diferentes especies de pulgoes como hospedeiros do parasitoide Lysiphlebus testaceipes (Cresson) (Hymenoptera: Braconidae, Aphidiinae)

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Robson J.; Bueno, Vanda H.P. [Universidade Federal de Lavras, MG (Brazil). Dept. de Entomologia]. E-mail: vhpbueno@ufla.br; Sampaio, Marcus V.[Universidade Federal de Uberlandia (UFU), MG (Brazil). Inst. de Ciencias Agrarias]. E-mail: mvsampaio@iciag.ufu.br

    2008-03-15

    Lysiphlebus testaceipes (Cresson) has a broad aphid host range; however the quality of these preys may interfere in its biological feature. This study aimed to evaluate the quality of three Macrosiphini, Brevicoryne brassicae (L.), Lipaphis erysimi (Kaltenbach) and Myzus persicae (Sulzer), and three Aphidini Schizaphis graminum (Rondani) Rhopalosiphum maidis (Fitch) and Aphis gossypii Glover as hosts to L. testaceipes and to determine the relation possible of host preference, of size and quality of the host. The tests were carried out in climatic chamber at 25 {+-} 1 deg C, RH 70 {+-} 10% and 12h photophase. The parasitoid did not oviposite in B. brassicae and L. erysimi, while the other species were nutritionally suitable to the parasitoid. L. testaceipes showed preference for aphids from tribe Aphidini and these hosts presented better quality to the parasitoid when compared to Macrosiphini. Interactions among size, preference and quality between the Aphidini were found. L. testaceipes showed preference (parasitism rate 76.7%) for R. maidis, the bigger host (hind tibia with 0.281 mm). This host provided bigger size (hind tibia with 0.49 mm) and higher emergence rate (95.6%) to the parasitoid when compared to A. gossypii (parasitism rate of 55.7%). Also the smaller host A. gossypii (0.266 mm) provided smaller size hind tibia (0.45 mm) and higher mortality of the parasitoid (emergence rate 72.1%). However, the development time was shorter and the longevity was higher in A. gossypii (6.3 and 5.4 days, respectively) when compared to the host R. maidis (6.7 and 3.8 days, respectively), and not been related to host size. (author)

  10. Biological parameters and fertility life table of Aphis forbesi Weed, 1889 (Hemiptera: Aphididae on strawberry

    Directory of Open Access Journals (Sweden)

    E. S. Araujo

    Full Text Available Abstract This study provides the first contribution of the biology and life table of Aphis forbesi Weed, 1889 (Hemiptera: Aphididae, an important strawberry pest throughout the world. This species lives in the crown and leaf petioles of the plant. It is difficulty to rear this species in laboratory due to protocooperation with ants observed only in the field. We studied the life cycle of A. forbesi on the leaves of the Albion strawberry cultivar at 25 ± 2 °C, 60 ± 10% relative humidity, and a 12-h photophase. The experiment was randomised with 100 replicates. The parameters of the fertility life table were calculated using TabVida. In the population studied, 25% and 46% had four and three instars, respectively. A mean of 1.43 nymphs per female per day was generated. The mean reproductive period was seven days and the mean longevity was 10 days. In every 11 days there is a generation of A. forbesi, where each female has the potential to generate between 6 to 9 individuals daily, increasing its population by 1.2 times. The average life cycle was 16.8 days. High viability observed in all instars and the resulting values of R0, rm and λ suggest that A. forbesi has the capacity to increase their numbers in a short period of time, while generating high populations in strawberry crops, requiring differential management.

  11. Host Preference between Symbiotic and Aposymbiotic Aphis fabae, by the Aphid Parasitoid, Lysiphlebus ambiguus

    Science.gov (United States)

    Cheng, Rui-Xia; Meng, Ling; Mills, Nickolas J; Li, Baoping

    2011-01-01

    Few empirical studies have directly explored the association between Buchnera aphidicola (Enterobacteriales: Enterobacteriaceae), the primary endosymbiont of aphids, and the life history strategies of aphid parasitoids. A series of paired-choice experiments were conducted to explore the preference of the parasitoid Lysiphlebus ambiguus Halliday (Hymenoptera: Aphididae) for symbiotic and aposymbiotic Aphis fabae Scopoli (Hemiptera: Aphididae) and the suitability of these hosts for parasitoid development. When given a choice between symbiotic and aposymbiotic aphids of the same instar, the parasitoid significantly preferred symbiotic over aposymbiotic aphids only during the later instars (L4 and adult). The suitability of aposymbiotic aphids for parasitoid development was equal to that of symbiotic aphids in terms of survivorship and sex ratio, but was significantly lower than that of symbiotic aphids for L4 and adult instars in development rate and/or female adult size. When given a choice between similar-sized symbiotic L2 and aposymbiotic L4 aphids, the parasitoid preferred the former. No significant differences in preference or host suitability were demonstrated when the parasitoid was given a choice between different instars of aposymbiotic aphids. While parasitoid lifetime fecundity increased with aphid instar at the time of oviposition, there was no significant influence of previous development from symbiotic versus aposymbiotic aphids. These results suggest that while L. ambiguus can discriminate between symbiotic and aposymbiotic A. fabae during later instars and when the aphids are of a similar size, the primary endosymbiont is not needed for successful parasitoid development; and its absence only compromises parasitoid growth reared from later instar aposymbiotic host. PMID:21870967

  12. Aboveground feeding by soybean aphid, Aphis glycines, affects soybean cyst nematode, Heterodera glycines, reproduction belowground.

    Directory of Open Access Journals (Sweden)

    Michael T McCarville

    Full Text Available Heterodera glycines is a cyst nematode that causes significant lost soybean yield in the U.S. Recent studies observed the aphid Aphis glycines and H. glycines interacting via their shared host, soybean, Glycine max. A greenhouse experiment was conducted to discern the effect of A. glycines feeding on H. glycines reproduction. An H. glycines-susceptible cultivar, Kenwood 94, and a resistant cultivar, Dekalb 27-52, were grown in H. glycines-infested soil for 30 and 60 d. Ten days after planting, plants were infested with either zero, five, or ten aphids. At 30 and 60 d, the number of H. glycines females and cysts (dead females and the number of eggs within were counted. In general, H. glycines were less abundant on the resistant than the susceptible cultivar, and H. glycines abundance increased from 30 to 60 d. At 30 d, 33% more H. glycines females and eggs were produced on the resistant cultivar in the ten-aphid treatment compared to the zero-aphid treatment. However, at 30 d the susceptible cultivar had 50% fewer H. glycines females and eggs when infested with ten aphids. At 60 d, numbers of H. glycines females and cysts and numbers of eggs on the resistant cultivar were unaffected by A. glycines feeding, while numbers of both were decreased by A. glycines on the susceptible cultivar. These results indicate that A. glycines feeding improves the quality of soybean as a host for H. glycines, but at higher herbivore population densities, this effect is offset by a decrease in resource quantity.

  13. Collective defense of Aphis nerii and Uroleucon hypochoeridis (Homoptera, Aphididae against natural enemies.

    Directory of Open Access Journals (Sweden)

    Manfred Hartbauer

    2010-04-01

    Full Text Available The prevalent way aphids accomplish colony defense against natural enemies is a mutualistic relationship with ants or the occurrence of a specialised soldier caste typical for eusocial aphids, or even both. Despite a group-living life style of those aphid species lacking these defense lines, communal defense against natural predators has not yet been observed there. Individuals of Aphis nerii (Oleander aphid and Uroleucon hypochoeridis, an aphid species feeding on Hypochoeris radicata (hairy cat's ear, show a behavioral response to visual stimulation in the form of spinning or twitching, which is often accompanied by coordinated kicks executed with hind legs. Interestingly, this behaviour is highly synchronized among members of a colony and repetitive visual stimulation caused strong habituation. Observations of natural aphid colonies revealed that a collective twitching and kicking response (CTKR was frequently evoked during oviposition attempts of the parasitoid wasp Aphidius colemani and during attacks of aphidophagous larvae. CTKR effectively interrupted oviposition attempts of this parasitoid wasp and even repelled this parasitoid from colonies after evoking consecutive CTKRs. In contrast, solitary feeding A. nerii individuals were not able to successfully repel this parasitoid wasp. In addition, CTKR was also evoked through gentle substrate vibrations. Laser vibrometry of the substrate revealed twitching-associated vibrations that form a train of sharp acceleration peaks in the course of a CTKR. This suggests that visual signals in combination with twitching-related substrate vibrations may play an important role in synchronising defense among members of a colony. In both aphid species collective defense in encounters with different natural enemies was executed in a stereotypical way and was similar to CTKR evoked through visual stimulation. This cooperative defense behavior provides an example of a surprising sociality that can be found

  14. Transgenic Bt Cotton Does Not Disrupt the Top-Down Forces Regulating the Cotton Aphid in Central China.

    Directory of Open Access Journals (Sweden)

    Yong-Sheng Yao

    Full Text Available Top-down force is referred to arthropod pest management delivered by the organisms from higher trophic levels. In the context of prevalent adoption of transgenic Bt crops that produce insecticidal Cry proteins derived from Bacillus thuringiensis (Bt, it still remains elusive whether the top-down forces are affected by the insect-resistant traits that introduced into the Bt crops. We explored how Bt cotton affect the strength of top-down forces via arthropod natural enemies in regulating a non-target pest species, the cotton aphid Aphis gossypii Glover, using a comparative approach (i.e. Bt cotton vs. conventional cotton under field conditions. To determine top-down forces, we manipulated predation/parasitism exposure of the aphid to their natural enemies using exclusion cages. We found that the aphid population growth was strongly suppressed by the dominant natural enemies including Coccinellids, spiders and Aphidiines parasitoids. Coccinellids, spiders and the assemblage of other arthropod natural enemies (mainly lacewings and Hemipteran bugs are similarly abundant in both plots, but with the parasitoid mummies less abundant in Bt cotton plots compared to the conventional cotton plots. However, the lower abundance of parasitoids in Bt cotton plots alone did not translate into differential top-down control on A. gossypii populations compared to conventional ones. Overall, the top-down forces were equally strong in both plots. We conclude that transgenic Bt cotton does not disrupt the top-down forces regulating the cotton aphid in central China.

  15. High levels of exotic armored scales on imported avocados raise concerns regarding USDA-APHIS' phytosanitary risk assessment.

    Science.gov (United States)

    Morse, J G; Rugman-Jones, P F; Watson, G W; Robinson, L J; Bi, J L; Stouthamer, R

    2009-06-01

    Between 1914 and 2007, a quarantine protected California avocado, Persea americana Mill., groves from pests that might be introduced into the state along with fresh, imported avocados. Soon after Mexican avocados were first allowed entry on 1 February 2007, live specimens of several species of armored scales (Hemiptera: Diaspididae) not believed to be present in California were detected on 'Hass' avocados entering the state from Mexico. Initially, the California Department of Food and Agriculture (CDFA) prevented avocados infested with these scales from entering the state or required that they be fumigated with an approved treatment such as methyl bromide. After a Science Advisory Panel meeting in May 2007, U.S. Department of Agriculture-Animal and Plant Health Inspection Service (USDA-APHIS) reaffirmed its position that armored scales on shipments of fruit for consumption (including avocados) pose a "low risk" for pest establishment. In compliance with APHIS protocols, as of 18 July 2007, CDFA altered its policy to allow shipments of scale-infested avocados into the state without treatment. Here, we report on sampling Mexican avocados over an 8-mo period, September 2007-April 2008. An estimated 67 million Mexican Hass avocados entered California over this period. Based on samples from 140 trucks containing approximately 15.6% of this volume of fruit, we estimate that approximately 47.6 million live, sessile armored scales and an additional 20.1 million live eggs and crawlers were imported. We found eight probable species of armored scales in the samples, seven of these are not believed to occur in California; 89.3% of the live scales were Abgrallaspis aguacatae Evans, Watson and Miller, a recently described species. In contrast to the USDA-APHIS opinion, we believe the volume of shipments and levels of live scales they contain present a significant risk to California's US$300 million avocado industry and to other crops that might become infested by one or more of

  16. All 37 Mitochondrial Genes of Aphid Aphis craccivora Obtained from Transcriptome Sequencing: Implications for the Evolution of Aphids.

    Science.gov (United States)

    Song, Nan; Zhang, Hao; Li, Hu; Cai, Wanzhi

    2016-01-01

    The availability of mitochondrial genome data for Aphididae, one of the economically important insect pest families, in public databases is limited. The advent of next generation sequencing technology provides the potential to generate mitochondrial genome data for many species timely and cost-effectively. In this report, we used transcriptome sequencing technology to determine all the 37 mitochondrial genes of the cowpea aphid, Aphis craccivora. This method avoids the necessity of finding suitable primers for long PCRs or primer-walking amplicons, and is proved to be effective in obtaining the whole set of mitochondrial gene data for insects with difficulty in sequencing mitochondrial genome by PCR-based strategies. Phylogenetic analyses of aphid mitochondrial genome data show clustering based on tribe level, and strongly support the monophyly of the family Aphididae. Within the monophyletic Aphidini, three samples from Aphis grouped together. In another major clade of Aphididae, Pterocomma pilosum was recovered as a potential sister-group of Cavariella salicicola, as part of Macrosiphini.

  17. All 37 Mitochondrial Genes of Aphid Aphis craccivora Obtained from Transcriptome Sequencing: Implications for the Evolution of Aphids.

    Directory of Open Access Journals (Sweden)

    Nan Song

    Full Text Available The availability of mitochondrial genome data for Aphididae, one of the economically important insect pest families, in public databases is limited. The advent of next generation sequencing technology provides the potential to generate mitochondrial genome data for many species timely and cost-effectively. In this report, we used transcriptome sequencing technology to determine all the 37 mitochondrial genes of the cowpea aphid, Aphis craccivora. This method avoids the necessity of finding suitable primers for long PCRs or primer-walking amplicons, and is proved to be effective in obtaining the whole set of mitochondrial gene data for insects with difficulty in sequencing mitochondrial genome by PCR-based strategies. Phylogenetic analyses of aphid mitochondrial genome data show clustering based on tribe level, and strongly support the monophyly of the family Aphididae. Within the monophyletic Aphidini, three samples from Aphis grouped together. In another major clade of Aphididae, Pterocomma pilosum was recovered as a potential sister-group of Cavariella salicicola, as part of Macrosiphini.

  18. Composition of the essential oil of Cynanchum mongolicum (Asclepiadaceae) and insecticidal activities against Aphis glycines (Hemiptera: Aphidiae)

    Science.gov (United States)

    Yang, Wang; Zhao, An; Congai, Zhen; Qizhi, Liu; Wangpeng, Shi

    2014-01-01

    Background: Farmers have applied Cynanchum mongolicum (Maxim) to control crop pests. The aim of this study was to analyze composition of essential oil from C. mongolicum, evaluate insecticidal activities against Aphis glycines, and lethal doses. Materials and Methods: Essential oil from C. mongolicum was efficiently extracted by steam distillation. The main components of the oil were analyzed with a gas chromatography/mass spectrometry (GC/MS) system, and the insecticidal activity of the essential oil on soybean aphids Aphis glycines was tested using a variety of methods. Results: The components of the essential oil from C. mongolicum mainly included terpenes and ester compounds, of which (Z)-3-Hexen-1-ol acetate, cis-3-hexenyl isovalerate, α-farnesene, and β-caryophyllene accounted for 15.8, 10.4, 8.4, and 5.5%, respectively. With 1- and 2-day exposure, the essential oil showed pronounced contact toxicity (median lethal concentration (LC50) =37.8 and 38.4 μL/mL, respectively), weak fumigant toxicity (LC50 = 139.7 and 139.9 μL/L, respectively). The essential oil showed strong deterrent activity on soybean aphids in 2 and 4 h. Conclusion: The essential oil of C. mongolicum contained insecticidal components and possessed contact toxicity and deterrent activity to A. glycines. PMID:24914292

  19. Toxic and Repellent effecto of Harmal (Peganum harmala L. Acetonic Extract on Several Aphids and Tribolium castaneum (Herbst Efecto Tóxico y Repelente del Extracto Acetónico de Harmal (Peganum harmala L. sobre varias especies de Áfidos y Tribolium castaneum (Herbst

    Directory of Open Access Journals (Sweden)

    Elham Salari

    2012-03-01

    Full Text Available To reduce the dependence on the sometimes unwise use of synthetic pesticides in fruit and vegetable plantations, the toxicity and repellence of Peganum harmala L. (Zygophyllaceae acetonic seed extract was assayed against several insect pests. For contact toxicity, 3- to 4-d-old individuals of Aphis fabae Scopoli, A. gossypii Glover, A. nerii Boyer de Fonscolombe, and Myzus persicae (Sulzer were included, as well as 1- to 7-d-old adult Tribolium castaneum (Herbst. Repellent effect experiments were conducted on adult, 1- to 2- and 3- to 4-d old M.persicae individuals. At 60 mg mL4, the topical bioassay mortality percentage was significantly higher in A. gossypii than in A. fabae and A. nerii after 12-72 h. Mortality of the treatments on M.persicae was 87.1% and 90.0% after 24 and 48 h, respectively, and significantly higher than A. fabae and A. nerii during this period. At 60 mg mL-1, the mortality of T. castaneum was much lower than that of the aphid species. The highest repellent index (over 72% was observed on 1- to 2-d-old M. persicae individuals.Para reducir la dependencia de los pesticidas sintéticos en plantaciones frutales y hortalizas, se realizó un ensayo para medir la toxicidad y repelencia de un extracto acetónico obtenido a partir de semillas de Peganum harmala L. (Zygophyllaceae contra diferentes especies de plagas. Para evaluar la toxicidad del extracto al contacto con los insectos, se incluyeron individuos de 3-4 d de edad de Aphis fabae Scopoli, Aphis gossypii Glover, Aphis nerii Boyer de Fonscolombe, y Myzus persicae (Sulzer, así como adultos 1-7 d de edad de Tribolium castaneum (Herbst. Experimentos para medir el efecto repelente se llevaron a cabo con individuos de 1-2 y 3-4 d de edad de M. persicae. En los resultados de los bioensayos tópicos el porcentaje de mortalidad fue significativamente mayor en la especie A. gossypii que en A. fabae y A. nerii, después de 12-72 h con una concentración de 60 mg mL-1. La mortalidad

  20. APHiD: Hierarchical Task Placement to Enable a Tapered Fat Tree Topology for Lower Power and Cost in HPC Networks

    Energy Technology Data Exchange (ETDEWEB)

    Michelogiannakis, George; Ibrahim, Khaled Z.; Shalf, John; Wilke, Jeremiah J.; Knight, Samuel; Kenny, Joseph P.

    2017-05-14

    The power and procurement cost of bandwidth in system-wide networks has forced a steady drop in the byte/flop ratio. This trend of computation becoming faster relative to the network is expected to hold. In this paper, we explore how cost-oriented task placement enables reducing the cost of system-wide networks by enabling high performance even on tapered topologies where more bandwidth is provisioned at lower levels. We describe APHiD, an efficient hierarchical placement algorithm that uses new techniques to improve the quality of heuristic solutions and reduces the demand on high-level, expensive bandwidth in hierarchical topologies. We apply APHiD to a tapered fat-tree, demonstrating that APHiD maintains application scalability even for severely tapered network configurations. Using simulation, we show that for tapered networks APHiD improves performance by more than 50% over random placement and even 15% in some cases over costlier, state-of-the-art placement algorithms.

  1. Review of invasive grapevine aphid, Aphis illinoisensis Shimer, and native parasitoids in the Mediterranean (Hemiptera, Aphididae; Hymenoptera, Braconidae, Aphidiinae

    Directory of Open Access Journals (Sweden)

    Havelka J.

    2011-01-01

    Full Text Available A summary of the study of Aphis illinoisensis Shimer on grapes, Vitis vinifera in the Mediterranean area brings references and new findings on its distribution in Crete/Greece, Turkey, Northern Cyprus, Malta, Israel, Montenegro, Tunisia, Algeria and Libya. Parasitoids of A. illinoisensis were only occasionally found (Aphidius matricariae Hal. - Cyprus, Turkey, Greece; Aphidius colemani Viereck - Libya; Lysiphlebus testaceipes Cress. - Algeria. Of the native species, i.e. A. colemani, and others similar to the native species, L. testaceipes seem to be a promising biocontrol agent within the framework of an ecologically friendly management in the area. Given the evidence of its expansion, A. illinoisensis is expected to expand further in several directions from the recently documented invaded area to all the grape-growing areas of the Mediterranean and even those of South-Eastern and Central Europe.

  2. The perspective of USDA APHIS Veterinary Services Emergency Management and Diagnostics in preparing and responding to Foreign Animal Diseases - plans, strategies, and countermeasures.

    Science.gov (United States)

    Díez, J R; Styles, D K

    2013-01-01

    The United States Department of Agriculture (USDA) Animal and Plant Health Inspection Service (APHIS) Veterinary Services (VS) is charged with monitoring, controlling, and responding to select reportable diseases and all foreign animal diseases. Emergency Management and Diagnostics (EM&D) oversees Foreign Animal Disease (FAD) preparedness and response. In order to effectively prepare for and respond to FADs, such as highly pathogenic avian influenza and foot-and-mouth disease, VS develops plans, strategies, and policies to effectively combat an intrusion. USDA APHIS VS has made significant gains in preparedness and response planning. However, much remains to be done especially in surveillance, diagnostic tools, and vaccines. There are significant needs for novel medical technologies to improve diagnostic capabilities and offer additional approaches for FAD response.

  3. Review and key to the world parasitoids (Hymenoptera: Braconidae: Aphidiinae) of Aphis ruborum (Hemiptera: Aphididae) and its role as a host reservoir

    Czech Academy of Sciences Publication Activity Database

    Havelka, Jan; Tomanović, Ž.; Kavallieratos, N. G.; Rakhshani, E.; Pons, X.; Petrović, A.; Pike, K. S.; Starý, Petr

    2012-01-01

    Roč. 105, č. 3 (2012), s. 386-394 ISSN 0013-8746 Grant - others:The Ministry of Education and Science of the Republic of Serbia(RS) III43001; University of Zabol(IR) 89-9198 Institutional research plan: CEZ:AV0Z50070508 Institutional support: RVO:60077344 Keywords : Rubus spp. * Aphis ruborum * parasitoid complex Subject RIV: EG - Zoology Impact factor: 1.196, year: 2012

  4. The role of detoxifying enzymes in the resistance of the cowpea aphid (Aphis craccivora Koch to thiamethoxam

    Directory of Open Access Journals (Sweden)

    Abdallah Ibrahim Saleh

    2016-01-01

    Full Text Available The cowpea aphid (Aphis craccivora Koch is considered a serious insect pest attacking several crops. We carried out biochemical studies to elucidate the role of the metabolising enzymes in conferring resistance to thiamethoxam, in two strains (resistant and susceptible of the cowpea aphid. Bioassay experiments showed that the thiamethoxam selected strain developed a 48 fold resistance after consecutive selection with thiamethoxam for 12 generations. This resistant strain also exhibited cross-resistance to the tested carbamates; pirimicarb and carbosulfan, organophosphorus (malathion, fenitrothion, and chlorpyrifos-methyl, and the neonicotinoid (acetamiprid. Synergism studies have indicated that S,S,S-tributyl phosphorotrithioate (DEF, a known inhibitor for esterases, increased thiamethoxam toxicity 5.58 times in the resistant strain compared with the susceptible strain. Moreover, the biochemical determination revealed that carboxylestersae activity was 30 times greater in the resistant strain than in the susceptible strain. In addition, the enzyme activity of glutathione S-transferase (GST and mixed function oxidases (mfo increased only in the resistant strain 3.7 and 2.7 times, respectively, in relation to the susceptible (the control. Generally, our results suggest that the higher activity of the detoxifying enzymes, particularly carboxylesterase, in the resistant strain of the cowpea aphid, apparently have a significant role in endowing resistance to thiamethoxam, although additional mechanisms may contribute.

  5. Core RNAi Machinery and Sid1, a Component for Systemic RNAi, in the Hemipteran Insect, Aphis glycines

    Directory of Open Access Journals (Sweden)

    Raman Bansal

    2013-02-01

    Full Text Available RNA interference (RNAi offers a novel tool to manage hemipteran pests. For the success of RNAi based pest control in the field, a robust and systemic RNAi response is a prerequisite. We identified and characterized major genes of the RNAi machinery, Dicer2 (Dcr2, Argonaute2 (Ago2, and R2d2 in Aphis glycines, a serious pest of soybean. The A. glycines genome encodes for at least one copy of Dcr2, R2d2 and Ago2. Comparative and molecular evolution analyses (dN/dS showed that domain regions of encoded proteins are highly conserved, whereas linker (non-domain regions are diversified. Sequence homology and phylogenetic analyses suggested that the RNAi machinery of A. glycines is more similar to that of Tribolium casteneum as compared to that of Drosophila melanogaster. We also characterized Sid1, a major gene implicated in the systemic response for RNAi-mediated gene knockdown. Through qPCR, Dcr2, R2d2, Ago2, and Sid1 were found to be expressed at similar levels in various tissues, but higher expression of Dcr2, R2d2, and Ago2 was seen in first and second instars. Characterization of RNAi pathway and Sid1 in A. glycines will provide the foundation of future work for controlling one of the most important insect pests of soybean in North America.

  6. Insecticied effect of silver and zinc nanoparticles against Aphis nerii Boyer of fonscolombe (Hemiptera: Aphididae Efecto insecticida de nanopartículas de plata y zinc contra Aphis nerii Boyer de Fonscolombe (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Mohammad Rouhani

    2012-12-01

    Full Text Available The oleander aphid, Aphis nerii Boyer de Fonscolombe, is one of the common pests of ornamental plants in the families of Apocynaceae and Sclepiadaceae and distributed throughout the world, which has been responsible for the mortality of a large number of oleander (Nerium oleander L. shrubs each year. In this research, the insecticidal activity of Ag nanoparticles against the A. nerii was investigated. Nanoparticles of Ag and Ag-Zn were synthesized through a solvothermal method, and using them, insecticidal solutions of different concentrations were prepared and tested on A. nerii. For comparison purposes, imidacloprid was also used as a conventional insecticide. In the experiments, the LC50 value for imidacloprid, Ag and Ag-Zn nanoparticles were calculated to be 0.13 μL mL-1, 424.67 mg mL-1, and 539.46 mg mL-1, respectively. The result showed that Ag nanoparticles can be used as a valuable tool in pest management programs of A. nerii. Additionally, the study showed that imidacloprid at 1 μL mL-1 and nanoparticles at 700 mg mL-1 had the highest insect mortality effect.El áfido de la adelfa, Aphis nerii Boyer de Fonscolombe, es una de las plagas más comunes de plantas ornamentales en las familias Apocynaceae y Sclepiadaceae y tiene distribución mundial, ha sido responsable de la mortalidad de un gran número de arbustos de adelfa (Nerium oleander L. cada ano. En este estudio se investigó la actividad insecticida de nanopartículas de Ag contra A. nerii. Nanopartículas de Ag y Ag-Zn fueron sintetizadas a través de un método solvotérmico, y con ellas se prepararon soluciones insecticidas de diferentes concentraciones y se probaron contra A. nerii. Con fines de comparación, también se usó imidacloprid como un insecticida convencional. En los experimentos, el valor LC50 para imidacloprid, nanopartículas de Ag y Ag-Zn se calculó como 0.13 μL mL-1, 424.67 mg mL-1, y 539.46 mg mL-1, respectivamente. El resultado mostró que nanopart

  7. Differential Life History Trait Associations of Aphids with Nonpersistent Viruses in Cucurbits.

    Science.gov (United States)

    Angelella, G M; Egel, D S; Holland, J D; Nemacheck, J A; Williams, C E; Kaplan, I

    2015-06-01

    The diversity of vectors and fleeting nature of virus acquisition and transmission renders nonpersistent viruses a challenge to manage. We assessed the importance of noncolonizing versus colonizing vectors with a 2-yr survey of aphids and nonpersistent viruses on commercial pumpkin farms. We quantified aphid alightment using pan traps, while testing leaf samples with multiplex RT-PCR targeting cucumber mosaic virus (CMV), zucchini yellow mosaic virus (ZYMV), watermelon mosaic virus (WMV), and papaya ringspot virus (PRSV). Overall, we identified 53 aphid species (3,899 individuals), from which the melon aphid, Aphis gossypii Glover, a pumpkin-colonizing species, predominated (76 and 37% of samples in 2010 and 2011, respectively). CMV and ZYMV were not detected, but WMV and PRSV were prevalent, both regionally (WMV: 28/29 fields, PRSV: 21/29 fields) and within fields (infection rates = 69 and 55% for WMV in 2010 and 2011; 28 and 25% for PRSV in 2010 and 2011). However, early-season samples showed extremely low infection levels, suggesting cucurbit viruses are not seed-transmitted and implicating aphid activity as a causal factor driving virus spread. Interestingly, neither noncolonizer and colonizer alightment nor total aphid alightment were good predictors of virus presence, but community analyses revealed species-specific relationships. For example, cowpea aphid (Aphis craccivora Koch) and spotted alfalfa aphid (Therioaphis trifolii Monell f. maculata) were associated with PRSV infection, whereas the oleander aphid (Aphis nerii Bover de Fonscolombe) was associated with WMV spread within fields. These outcomes highlight the need for tailored management plans targeting key vectors of nonpersistent viruses in agricultural systems. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. The effects of Aphis fabae infestation on the antioxidant response and heavy metal content in field grown Philadelphus coronarius plants

    Energy Technology Data Exchange (ETDEWEB)

    Kafel, Alina, E-mail: akafel@us.edu.pl [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland); Nadgorska-Socha, Aleksandra [University of Silesia, Department of Ecology, Bankowa 9, PL 40-007, Katowice (Poland); Gospodarek, Janina [Agricultural University of Krakow, Department of Agricultural Environment Protection, Mickiewicza 21, PL 31-120, Krakow (Poland); Babczynska, Agnieszka; Skowronek, Magda [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland); Kandziora, Marta [University of Silesia, Department of Ecology, Bankowa 9, PL 40-007, Katowice (Poland); Rozpedek, Katarzyna [University of Silesia, Department of Animal Physiology and Ecotoxicology, Bankowa 9, PL 40-007, Katowice (Poland)

    2010-02-01

    The purpose of this study was to explore a possible relationship between the soil availability of metals and their concentrations in various parts of Philadelphuscoronarius plants. Moreover, the possible impact of an aphid infestation on the contamination and antioxidant response of plants from the urban environment of Krakow and the reference rural area of Zagaje Stradowskie (southern Poland) was analyzed. The contents of the glutathione, proline, non-protein - SH groups, antioxidants, and phosphorous and the levels of guaiacol peroxidase and catalase activity in leaves and shoots either infested or not by the aphid Aphis fabae Scop., were measured. The potential bioavailability of metals (Cd; Cu; Ni; Pb; Zn) in the soil and their concentrations in P. coronarius plants originating from both sites were compared. The antioxidant responses were generally elevated in the plants in the polluted area. Such reactions were additionally changed by aphid infestation. Generally, the concentrations of metals in the HNO{sub 3} and CaCl{sub 2} extractants of the soils from two layers at the 0-20 and 20-40 cm depths from the polluted area were higher than in those from the reference area. Such differences were found for nickel and lead (in all examined extractants), zinc (in soil extractants from the layer at 20-40 cm) and cadmium (in HNO{sub 3} extractants). Significant positive relationships between the lead concentrations in the soil and in the plants were found. In the parts of plants from the polluted area, higher concentrations of Pb and Zn (leaves and shoots) and Cd (shoots) were recorded. The shoots and leaves of plants infested with aphids had higher concentrations of Zn but lower Pb. Moreover, their leaves had higher contaminations of Cu and Ni. In conclusion, aphids affected not only the antioxidant response of the plants but also their contamination with metals, especially contamination of the leaves.

  9. Economic Injury Levels for Aphis glycines Matsumura (Hemiptera: Aphididae) on the Soybean Aphid Tolerant KS4202 Soybean.

    Science.gov (United States)

    Marchi-Werle, Lia; Baldin, Edson L L; Fischer, Hillary D; Heng-Moss, Tiffany M; Hunt, Thomas E

    2017-10-01

    The soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), is an invasive species from Asia that has been the major economic insect pest of soybeans, Glycine max (L.) Merrill, since 2000. While use of soybeans expressing antibiosis and antixenosis is a well-studied strategy to manage this pest, aphid-tolerant soybeans remain underexplored. This study examined the relationship between cumulative aphid-days (CAD) and yield loss in the tolerant soybean KS4202 during two growing seasons to determine the economic injury levels (EILs) for soybean aphids on KS4202. Soybean aphid infestations were initiated during the soybean reproductive stages. A range of CAD treatments (3,000-45,000 CADs) were applied during the growing seasons. Aphid populations reached 45,000 CAD in 2011 and 38,000 CAD in 2013 in plots that were not treated with insecticides. It was estimated that the population doubling time was 9.4 d. In infested plots, soybean yield was reduced by 1.4-13.3%, equivalent to a 3.1% yield loss for every 10,000 CAD. Overall, most CAD treatments did not affect yield parameters, although CAD > 39,000 caused a significant reduction in most yield parameters. The EILs calculated for KS4202 ranged from 526 to 2,050 aphids/plant, which were approximately 2.5-fold higher when compared to EILs previously calculated for susceptible soybean. The adoption of soybean aphid tolerant soybean with higher EILs may help mitigate treatment delay problems by lengthening the treatment lead-time and possibly reduce the number of insecticide applications. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  10. The Effect of an Interspersed Refuge on Aphis glycines (Hemiptera: Aphididae), Their Natural Enemies, and Biological Control.

    Science.gov (United States)

    Varenhorst, A J; O'Neal, M E

    2016-02-01

    Soybean production in the north central United States has relied heavily on the use of foliar and seed applied insecticides to manage Aphis glycines (Hemiptera: Aphididae). An additional management strategy is the use soybean cultivars containing A. glycines resistance genes (Rag). Previous research has demonstrated that Rag cultivars are capable of preventing yield loss equivalent to the use of foliar and seed-applied insecticides.However, the presence of virulent biotypes in North America has raised concern for the durability of Rag genes. A resistance management program that includes a refuge for avirulent biotypes could limit the frequency at which virulent biotypes increase within North America. To what extent such a refuge reduces the effectiveness of aphid-resistant soybean is not clear. We conducted an experiment to determine whether a susceptible refuge mixed into resistant soybean (i.e., interspersed refuge or refuge-in-a-bag) affects the seasonal exposure of aphids, their natural enemies, biological control, and yield protection provided by aphid resistance. We compared three ratios of interspersed refuges (resistant: susceptible; 95:5, 90:10, 75:25) to plots grown with 100%susceptible or resistant soybean. We determined that an interspersed refuge of at least 25% susceptible seed would be necessary to effectively produce avirulent individuals. Interspersed refuges had negligible effects onyield and the natural enemy community. However, there was evidence that they increased the amount of biological control that occurred within a plot. We discuss the compatibility of interspersed refuges for A. glycines management and whether resistance management can prolong the durability of Rag genes.

  11. Type of prey influences biology and consumption rate of Orius insidiosus (Say (Hemiptera, Anthocoridae

    Directory of Open Access Journals (Sweden)

    Simone M. Mendes

    2002-01-01

    Full Text Available Generalist predators are capable of consuming different types of prey, and as each prey may have distinct nutritional values, each may have a distinct impact on the biology of the predator. Therefore, the aim of this study was to determine how the consumption of different prey influences certain biological characteristics and the predatory capacity of Orius insidiosus (Say. The investigation was performed in climatic chamber at 25 ±1 ºC, RH 70 ± 10% and fotophase 12. Eggs of Anagasta kuehniella (Zeller, adults of Caliothrips phaseoli (Hood and nymphs of Aphis gossypii Glover were used as prey and were provided daily ad libitum for all the mobile stages of the predator. The results showed that biological parameters of O. insidiosus are affected differently depending on the type of prey ingested. The development time of the nymphal stage was 13.1, 11.23 and 10.25 days for O. insidiosus feeding on eggs of A. kuehniella, nymphs of A. gossypii and adults of C. phaseoli, respectively. Longevity was five times larger for adults fed on eggs of A. kuehniella (56.25 days compared to that of adults that preyed on nymphs of A. gossypii (11.44 days, and four times larger when the prey were adults of C. phaseoli (13.58 days. The consumption of eggs of A. kuehniella by predator females resulted in a shorter pre-oviposition period (3.2 days and a longer oviposition period (44.4 days when compared to the consumption of other types of prey. In addition, fecundity was increased with the consumption of eggs of A. kuehniella (195.25 eggs laid / female when compared to feeding on the other prey, C. phaseoli (70.00 eggs laid / female or A. gossypii (22.50 eggs laid / female. However, the consumption of aphids was larger (148.28 nymphs/ nymphal stage than that of thrips (74.10 thrips / nymphal stage or eggs of A. kuehniella (37.03 eggs /nymphal stage for all of the nymphal stages of the predator. The results indicate that the eggs of A. kuehniella are the type of

  12. Host Range Specificity of Scymnus camptodromus (Coleoptera: Coccinellidae), A Predator of Hemlock Woolly Adelgid (Hemiptera: Adelgidae).

    Science.gov (United States)

    Limbu, Samita; Cassidy, Katie; Keena, Melody; Tobin, Patrick; Hoover, Kelli

    2016-02-01

    Scymnus (Neopullus) camptodromus Yu and Liu (Coleoptera: Coccinellidae) was brought to the United States from China as a potential biological control agent for hemlock woolly adelgid (Adelges tsugae Annand) (Hemiptera: Adelgidae). Scymnus camptodromus phenology is closely synchronized with that of A. tsugae and has several characteristics of a promising biological control agent. As a prerequisite to field release, S. camptodromus was evaluated for potential nontarget impacts. In host range studies, the predator was given the choice of sympatric adelgid and nonadelgid prey items. Nontarget testing showed that S. camptodromus will feed to some degree on other adelgid species, but highly prefers A. tsugae. We also evaluated larval development of S. camptodromus on pine bark adelgid (Pineus strobi (Hartig)) (Hemiptera: Adelgidae) and larch adelgid (Adelges laricis Vallot) (Hemiptera: Adelgidae); a small proportion of predator larvae was able to develop to adulthood on P. strobi or A. laricis alone. Scymnus camptodromus showed no interest in feeding on woolly alder aphid (Paraprociphilus tessellatus Fitch) (Hemiptera: Aphididae) or woolly apple aphid (Eriosoma lanigerum (Hausmann)) (Hemiptera: Aphididae), and minimal interest in cotton aphid (Aphis gossypii Glover) (Hemiptera: Aphididae) in choice and no-choice experiments. Scymnus camptodromus females did not oviposit on any host material other than A. tsugae-infested hemlock. Under the circumstances of the study, S. camptodromus appears to be a specific predator of A. tsugae, with minimal risk to nontarget species. Although the predator can develop on P. strobi, the likelihood that S. camptodromus would oviposit on pine hosts of this adelgid is small.

  13. Insectes ravageurs et propriétés biocides de Jatropha curcas L. (Euphorbiaceae : synthèse bibliographique

    Directory of Open Access Journals (Sweden)

    Abdoul Habou, Z.

    2013-01-01

    Full Text Available Insect pests and biocidal properties of Jatropha curcas L. (Euphorbiaceae. A review. Jatropha curcas is a Euphorbiaceae shrub widely distributed in many tropical countries. Its seeds are rich in oil that can be used as biofuel in modified diesel engines. Several insect species, mainly belonging to Hemiptera, Coleoptera and Orthoptera, have been referenced as insect pests of J. curcas. These insects attack the plant and cause damage to fruits, inflorescences and leaves. The most frequently observed pests belong to the genus Pachycoris (Heteroptera: Scutelleridae, which are widely distributed in Mexico, Australia, United States of America, Brazil and Nicaragua. Pachycoris spp. cause significant damage to the fruits, leading to the malformation of seeds and a reduction in their oil content. Although Jatropha shrubs are subjected to insect infestations, the oil has been shown to demonstrate biocidal activity, including insecticidal effects against several insect pests, including Busseola fusca (Fuller (Lepidoptera: Noctuidae, Sesamia calamistis Hampson (Lepidoptera: Noctuidae, Aphis gossypii Glover (Homoptera: Aphididae and Callosobruchus chinensis L. (Coleoptera: Bruchidae. In the present paper, we summarize the work carried out on inventories of J. curcas insect pests as well as on the biocidal activity of its oil.

  14. Correlation of the aphicidal activity of Beauveria bassiana SFB-205 supernatant with enzymes.

    Science.gov (United States)

    Kim, Jae Su; Roh, Jong Yul; Choi, Jae Young; Wang, Yong; Shim, Hee Jin; Je, Yeon Ho

    2010-01-01

    The supernatant of Beauveria bassiana SFB-205 reduced the population of cotton aphid, Aphis gossypii Glover, with a dosage-dependent manner, which allowed a quality control (QC) factor to be determined for the evaluation of the supernatant as the first step of a development. Enzymes were assumed as possible QC factors based on 1) the comparable aphicidal activity of the supernatant protein pellet to the raw supernatant, 2) the supernatant-induced degradation of the insect cuticles, observed by transmission electron microscopy, and 3) the confirmation of enzymes related to the fungal penetration - chitinase, and the Pr1- and Pr2 proteases - in the supernatant. Finally, from the bioassay with the enzyme-inhibited supernatants processed by substrate inhibition one by one, decreased aphicidal activities were observed for all three enzyme-inhibited treatments. This phenomenon, furthermore, was more remarkable in the chitinase-inhibited supernatant. This finding provides that those enzymes (and most particularly the chitinase) in the supernatant were strongly involved in the aphicidal activity. Consequently, the amount of the chitinase may be used as one of the QC factors to determine the insecticidal activity of the supernatant of B. bassiana SFB-205 in the optimization of mass production. Copyright © 2009 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  15. Assessment of Citrus tristeza virus (CTV incidence in Calabria, southern Italy: results of a three-year survey

    Directory of Open Access Journals (Sweden)

    Giuliana Renata Albanese

    2010-05-01

    Full Text Available Since 2006 a survey on Citrus tristeza virus (CTV has been carried out in Calabria, southern Italy, to determine the occurrence of the virus, to evaluate its incidence, to identify and characterize the virus strains, and to monitor the aphid vector populations. Citrus samples were collected from nurseries and orchards located in the five provinces of the region. The virus was not detected in the citrus-growing areas of Catanzaro (CZ or Crotone (KR, whereas it was found in three orchards in Cosenza (CS, three in Vibo Valentia (VV and twelve citrus plantings in Reggio Calabria (RC. The highest infection percentages occurred in citrus orchards close to fields already infected with CTV. Infections were detected not only in foreign cultivars, but also in local cultivars such as ‘Comune’ clementine, ‘Moro’, ‘Ovale’ and ‘Tarocco’ sweet orange, suggesting that CTV was transmitted by aphids. CTV occurred in only a few plantlets sampled in two citrus nurseries located near the main areas already infected. Serological differentiation of several CTV field isolates revealed that the mild strains were prevalent. Aphis gossypii (Glover and A. spiraecola Patch (= A. citricola Van der Goot were the most frequent aphids in the orchards, whereas Toxoptera aurantii (Boyer de Foscoulombe and Myzus persicae (Sulzer occurred with low incidence. The absence of T. citricidus (Kirkaldy was confirmed.

  16. Comparaison des effets de différents types de traitement phytosani-taire des semences du cotonnier au Burundi et en Grèce

    Directory of Open Access Journals (Sweden)

    Carême, C.

    1996-01-01

    Full Text Available Comparison of Different Pesticide Treatments of Cotton Seed in Burundi and in Greece. The effects of several active ingredients and various cotton seed treatments have been compared in 7 trials realized in Burundi and Greece in 1993 and 1994. The trials led in Burundi show the very high significant efficacy of imidacloprid on Aphis gossypii Glover at 3 g a. i./kg associated with chlorothalonil at 08 g a. i./kg seeds, when applied by pelleting on delinted seeds. In Greece, the absence of parasitic pressure at the beginning of the growing season did not allow the classification of the applied treatments concerning their efficiency to control cotton pests. The ecophysiological observations realized during this experimentation show a significant improvement of the bail maturation precocity in plants issued from pelleted seeds with an average dose of 2.2 g imidacloprid and 2.4 g TMTD per kg of seeds. On average, plants issued from treated seeds matured 10 days earlier than the untreated one.

  17. Evidence for an Invasive Aphid “Superclone”: Extremely Low Genetic Diversity in Oleander Aphid (Aphis nerii) Populations in the Southern United States

    Science.gov (United States)

    Harrison, John Scott; Mondor, Edward B.

    2011-01-01

    Background The importance of genetic diversity in successful biological invasions is unclear. In animals, but not necessarily plants, increased genetic diversity is generally associated with successful colonization and establishment of novel habitats. The Oleander aphid, Aphis nerii, though native to the Mediterranean region, is an invasive pest species throughout much of the world. Feeding primarily on Oleander (Nerium oleander) and Milkweed (Asclepias spp.) under natural conditions, these plants are unlikely to support aphid populations year round in the southern US. The objective of this study was to describe the genetic variation within and among US populations of A. nerii, during extinction/recolonization events, to better understand the population ecology of this invasive species. Methodology/Principal Findings We used five microsatellite markers to assess genetic diversity over a two year period within and among three aphid populations separated by small (100 km) and large (3,700 km) geographic distances on two host plant species. Here we provide evidence for A. nerii “superclones”. Genotypic variation was absent in all populations (i.e., each population consisted of a single multilocus genotype (MLG) or “clone”) and the genetic composition of only one population completely changed across years. There was no evidence of sexual reproduction or host races on different plant species. Conclusions/Significance Aphis nerii is a well established invasive species despite having extremely low genetic diversity. As this aphid appears to be obligatorily asexual, it may share more similarities with clonally reproducing invasive plants, than with other animals. Patterns of temporal and geographic genetic variation, viewed in the context of its population dynamics, have important implications for the management of invasive pests and the evolutionary biology of asexual species. PMID:21408073

  18. Evidence for an invasive aphid "superclone": extremely low genetic diversity in Oleander aphid (Aphis nerii populations in the southern United States.

    Directory of Open Access Journals (Sweden)

    John Scott Harrison

    2011-03-01

    Full Text Available The importance of genetic diversity in successful biological invasions is unclear. In animals, but not necessarily plants, increased genetic diversity is generally associated with successful colonization and establishment of novel habitats. The Oleander aphid, Aphis nerii, though native to the Mediterranean region, is an invasive pest species throughout much of the world. Feeding primarily on Oleander (Nerium oleander and Milkweed (Asclepias spp. under natural conditions, these plants are unlikely to support aphid populations year round in the southern US. The objective of this study was to describe the genetic variation within and among US populations of A. nerii, during extinction/recolonization events, to better understand the population ecology of this invasive species.We used five microsatellite markers to assess genetic diversity over a two year period within and among three aphid populations separated by small (100 km and large (3,700 km geographic distances on two host plant species. Here we provide evidence for A. nerii "superclones". Genotypic variation was absent in all populations (i.e., each population consisted of a single multilocus genotype (MLG or "clone" and the genetic composition of only one population completely changed across years. There was no evidence of sexual reproduction or host races on different plant species.Aphis nerii is a well established invasive species despite having extremely low genetic diversity. As this aphid appears to be obligatorily asexual, it may share more similarities with clonally reproducing invasive plants, than with other animals. Patterns of temporal and geographic genetic variation, viewed in the context of its population dynamics, have important implications for the management of invasive pests and the evolutionary biology of asexual species.

  19. EFEITOS DA TEMPERATURA DE INCUBAÇÃO SOBRE O FUNGO colletotrichum gossypii South. var. cephalosporioides EFFECT OF TEMPERATURE INCUBATION ON THE FUNGUS Colletotrichum gossypi SOUTH. Var. cephalosporioides COSTA

    Directory of Open Access Journals (Sweden)

    Yvo de Carvalho

    2007-09-01

    Full Text Available

    Estudou-se o efeito da temperatura de incubação sobre o crescimento vegetativo, esporulação e morfologia da colônia do fungo Colletotrichum gossypii South. var. cephalosporioides Costa, em substrato de batata + dextrose + agar, pH 5,6. O delineamento experimental usado foi o de blocos casualizados e as temperaturas variaram de 12 a 33°C, a intervalos de 3° C. Concluiu-se que a temperatura de incubação afeta notavelmente o crescimento vegetativo, a esporulação e a morfologia da colônia do fungo. Temperaturas acima da faixa ótima provocaram modificações mais acentuadas sobre o crescimento miceliano, esporulação e aspecto morfológico, do que temperaturas baixas. Conídios produzidos em temperaturas extremas, 12 a 33°C, mostraram-se mais curtos que os dos demais tratamentos. A incubação à temperatura de 27°C é a mais recomendável para produção de inóculos em quantidade.

    In this work, the effect of temperature of incubation on the vegetative growth, sporulation and morphology of the colony of the fungus colletotrichum gossypii South. var. cephalosporioides Costa in substrate containing potato + dextrose + agar pH 5.6, was studied. The experimental design used was that of randomized blocks, with temperatures varying from 12 to 33 degrees centigrades, at intervals of 3°C. It was concluded that the temperature of incubation notably affects the vegetative growth, sporulation and morphology of the colony of this fungus. Temperatures above the optimum range caused greater changes in mycelial, sporulation an morphology of the colony than temperatures below this range. Conidia produced at l2 and 33°C were shown to be shorter than those in other treatments. The temperature of incubation recommended for inocule production was 27°C.

  20. Establishment of in vitro soybean aphids, Aphis glycines (Hemiptera: Aphididae): a tool to facilitate studies of aphid symbionts, plant-insect interactions and insecticide efficacy.

    Science.gov (United States)

    Gunadi, Andika; Bansal, Raman; Finer, John J; Michel, Andy

    2017-06-01

    Studies on plant-insect interactions of the soybean aphid, Aphis glycines (Matsumura), can be influenced by environmental fluctuations, status of the host plant and variability in microbial populations. Maintenance of aphids on in vitro-grown plants minimizes environmental fluctuations, provides uniform host materials and permits the selective elimination of aphid-associated microbes for more standardized controls in aphid research. Aphids were reared on sterile, in vitro-grown soybean seedlings germinated on plant tissue culture media amended with a mixture of antimicrobials. For initiation and maintenance of in vitro aphid colonies, single aphids were inoculated onto single in vitro seedlings. After three rounds of transfer of 'clean' aphids to fresh in vitro seedlings, contamination was no longer observed, and aphids performed equally well when compared with those reared on detached leaves. The addition of the insecticides thiamethoxam and chlorantraniliprole to the culture medium confirmed uptake and caused significant mortality to the in vitro aphids. The use of the antimicrobial mixture removed the associated bacteria Arsenophonus but retained Buchnera and Wolbachia within the in vitro aphids. The in vitro aphid system is a novel and highly useful tool to understand insecticidal efficacy and expand our knowledge of tritrophic interactions among plants, insects and symbionts. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  1. Weed host specificity of the aphid, Aphis spiraecola: developmental and reproductive performance of aphids in relation to plant growth and leaf chemicals of the Siam weed, Chromolaena odorata.

    Science.gov (United States)

    Agarwala, B K; Das, Jhuma

    2012-01-01

    Density, distribution, and nutritional quality of plants are the causal basis of host plant selection in aphids. Nutritional qualities of a plant vary according to its growth stage and also in response to seasonal variation. How host plant growth stages shape aphid performance was studied in Aphis spiraecola Patch (Homoptera: Aphididae) on the perennial Siam weed, Chromolaena odorata (L.) King and Robinson (Asterales: Asteraceae). This plant species is the preferred host in the hot and humid tropical parts of northeast and southern India. Variations in developmental and reproductive performances in apterous viviparous female aphids were recorded in relation to differences in leaf chemicals in different growth stages of C. odorata. Aphids reproduced at higher rates in the vegetative stage of C. odorata when developmental time was shortest, and fecundity was higher in a longer reproductive time. Intrinsic rate of increase and net reproductive rate were also recorded to be higher in the vegetative stage of the weed host. In the vegetative stage, leaves contained higher quantity of proteins and nitrogen, which are vital for insect reproduction. Results of this study have demonstrated that A spiraecola showed synchronization of its developmental and reproductive performances to growth stages of C. odorata, which occur in high abundance in the study area.

  2. Pengendalian Aphis craccivora Koch. dengan kitosan dan pengaruhnya terhadap penularan Bean common mosaic virus strain Black eye cowpea (BCMV-BlC pada kacang panjang

    Directory of Open Access Journals (Sweden)

    Dita Megasari

    2015-09-01

    Full Text Available Aphis craccivora is one of the important pests on yard long bean. It causes direct damage and also has an indirect effect as insect vector of the Bean common mosaic virus (BCMV. The research was done to test the effectiveness of chitosan in suppressing aphid population growth, feeding preference and its ability in transmiting BCMV. Chitosan with concentration ranging of 0.1–1.0% were applied on leaves using spraying method at 1 day before BCMV transmission. BCMV was transmitted by using 3 individuals of viruliferous aphids on each plant. Results show that chitosan treatments on leaves or plants significantly suppressed the population and feeding preferences of A. craccivora. Further, treated plants showed lower disease incidence, severity and BCMV titre significantly compared with untreated control plants. The positive effects of chitosan in suppressing population growth as feeding preferences and BCMV transmission might be due to the anti-feedant effect of chitosan on A. craccivora. Based on the result, chitosan at concentration 0.9% is the most effective concentration in suppressing BCMV and its vector A. craccivora.

  3. THE IMPACT OF SOYBEAN AND CORN INTERCROPPING SYSTEM AND SOIL FERTILITY MANAGEMENT ON SOYBEAN APHID POPULATIONS APHIS GLYCINES (HEMIPTERA: APHIDIDAE AND SOYBEAN GROWTH PERFORMANCE

    Directory of Open Access Journals (Sweden)

    Rosma Hasibuan

    2013-09-01

    Full Text Available Agricultural management cropping systems play an important role in affecting a crop plant’s ability to tolerate or resist insect pests.  Field studies were conducted to examine the effect of two strategies management systems: fertilizer treatment and intercropping soybean with corn on soybean  aphid (Aphis glycines Matsumura population and soybean growth  and yield parameters. The intercropping treatments were: soybean alone; 2:1 soybean/corn intercrop; and 3:1 soybean/corn intercrop. While the soil fertility treatments were the combination of NPK (urea 100 kg ha-1 + SP-36 200 kg ha-1 + KCl 200 kg ha-1 levels, dolomite (4 ton ha-1, compost  (10 ton ha-1, and chicken manure (10 ton ha-1.  The results of the first study showed that the intercropping soybean with corn  significantly reduced the population density of soybean aphids. However, there were no significant effects of intercropping systems on soybean growth (plant height and yield (number seed per pod and  thousand seed weight performances except on the number of soybean pods per plant. Meanwhile, the result of the second study indicated that soil fertilizer treatments had  a significant effect on the soybean plant characteristics: leaf numbers; pod numbers; and plant height.  Combining  intercropping methods and soil fertilizer management offer an opportunity to protect the soybean plants by natural and sustainable pest management.

  4. Studying Plant–Insect Interactions with Solid Phase Microextraction: Screening for Airborne Volatile Emissions Response of Soybeans to the Soybean Aphid, Aphis glycines Matsumura (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Lingshuang Cai

    2015-05-01

    Full Text Available Insects trigger plants to release volatile compounds that mediate the interaction with both pest and beneficial insects. Soybean aphids (Aphis glycines induces soybean (Glycine max leaves to produce volatiles that attract predators of the aphid. In this research, we describe the use of solid-phase microextraction (SPME for extraction of volatiles from A. glycines-infested plant. Objectives were to (1 determine if SPME can be used to collect soybean plant volatiles and to (2 use headspace SPME-GC-MS approach to screen compounds associated with A. glycines-infested soybeans, grown in the laboratory and in the field, to identify previously known and potentially novel chemical markers of infestation. A total of 62 plant volatiles were identified, representing 10 chemical classes. 39 compounds had not been found in previous studies of soybean volatile emissions. 3-hexen-1-ol, dimethyl nonatriene, indole, caryophyllene, benzaldehyde, linalool, methyl salicylate (MeSA, benzene ethanol, and farnesene were considered herbivore-induced plant volatiles (HIPVs. For reproductive field-grown soybeans, three compounds were emitted in greater abundance from leaves infested with A. glycines, cis-3-hexen-1-ol acetate, MeSA and farnesene. In summary, SPME can detect the emission of HIPVs from plants infested with insect herbivores.

  5. Evaluation of Aphis glycines as an Alternative Host for Supporting Aphelinus albipodus Against Myzus persicae on Capsicum annuum cv. Ox Horn and Hejiao 13.

    Science.gov (United States)

    Song, Y Q; Sun, H Z; Du, J; Wang, X D; Cheng, Z J

    2017-04-01

    Bank plant systems provide effective biological control for pests infesting commercially important crops. Aphids cause physical damage to crops by feeding on the leaves, as well as transmitting damaging viral diseases. To develop a bank plant system to control aphids that damage vegetable crops, we initially reared the parasitoid Aphelinus albipodus (Hayat and Fatima) on the soybean aphid, Aphis glycines (Matsumura) reared on the soybean plant, Glycine max (L.) that was elected as the alternate host. Parasitoid adults that emerged from A. glycines were allowed to parasitize second instar nymphs of the aphid Myzus persicae (Sulzer) which were reared on sweet pepper and chili pepper leaves. The results showed that A. albipodus females feeding and parasitizing M. persicae nymphs reared on sweet pepper lived for 18.9 days, with an average fecundity of 337.3 progenies/female, while females feeding and parasitizing on M. persicae nymphs reared on chili pepper lived for 18.8 days, with an average fecundity of 356.2 progenies/female. There were no significant difference in the development time and reproduction of A. albipodus individuals parasitizing M. persicae nymphs reared on sweet pepper and chili pepper plants. The intrinsic rate of increase (r), net reproductive rate (R 0 ), net aphid killing rate (Z 0 ), and finite aphid killing rate (θ) of A. albipodus parasitizing sweet pepper and chili pepper M. persicae was 0.2258 days -1 , 171.7 progeny adults, 222.6 aphids, and 0.4048 and 0.2295 days -1 , 191.8 progeny adults, 243.3 aphids, and 0.4021, respectively. Our results suggested that A. glycines could serve as an effective alternative host for supporting A. albipodus against M. persicae infesting sweet pepper and chili pepper.

  6. Tissue specific expression of potent insecticidal, Allium sativum leaf agglutinin (ASAL) in important pulse crop, chickpea (Cicer arietinum L.) to resist the phloem feeding Aphis craccivora.

    Science.gov (United States)

    Chakraborti, Dipankar; Sarkar, Anindya; Mondal, Hossain Ali; Das, Sampa

    2009-08-01

    The phloem sap-sucking hemipteran insect, Aphis craccivora, commonly known as cowpea aphid, cause major yield loss of important food legume crop chickpea. Among different plant lectins Allium sativum leaf agglutinin (ASAL), a mannose binding lectin was found to be potent antifeedant for sap sucking insect A. craccivora. Present study describes expression of ASAL in chickpea through Agrobacterium-mediated transformation of "single cotyledon with half embryo" explant. ASAL was expressed under the control of CaMV35S promoter for constitutive expression and phloem specific rolC promoter for specifically targeting the toxin at feeding site, using pCAMBIA2301 vector containing plant selection marker nptII. Southern blot analysis demonstrated the integration and copy number of chimeric ASAL gene in chickpea and its inheritance in T(1) and T(2) progeny plants. Expression of ASAL in T(0) and T(1) plants was confirmed through northern and western blot analysis. The segregation pattern of ASAL transgene was observed in T(1) progenies, which followed the 3:1 Mendelian ratio. Enzyme linked immunosorbant assay (ELISA) determined the level of ASAL expression in different transgenic lines in the range of 0.08-0.38% of total soluble protein. The phloem tissue specific expression of ASAL gene driven by rolC promoter has been monitored by immunolocalization analysis of mature stem sections. Survival and fecundity of A. craccivora decreased to 11-26% and 22-42%, respectively when in planta bioassay conducted on T(1) plants compared to untransformed control plant which showed 85% survival. Thus, through unique approach of phloem specific expression of novel insecticidal lectin (ASAL), aphid resistance has been successfully achieved in chickpea.

  7. Effect of petroleum-derived substances on life history traits of black bean aphid (Aphis fabae Scop.) and on the growth and chemical composition of broad bean.

    Science.gov (United States)

    Rusin, Milena; Gospodarek, Janina; Nadgórska-Socha, Aleksandra; Barczyk, Gabriela

    2017-04-01

    The aim of the study was to determine the effects of various petroleum-derived substances, namely petrol, diesel fuel and spent engine oil, on life history traits and population dynamics of the black bean aphid Aphis fabae Scop. and on growth and chemical composition of its host plant Vicia faba L. Each substance was tested separately, using two concentrations (9 g kg -1 and 18 g kg -1 ). The experiment was conducted in four replications (four pots with five plants in each pot per treatment). Plants were cultivated in both control and contaminated soils. After six weeks from soil contamination and five weeks from sowing the seeds, observations of the effect of petroleum-derived substances on traits of three successive generations of aphids were conducted. Aphids were inoculated separately on leaves using cylindrical cages hermetically closed on both sides. Contamination of aphid occurred through its host plant. Results showed that all tested substances adversely affected A. fabae life history traits and population dynamics: extension of the prereproductive period, reduction of fecundity and life span, reduction of the population intrinsic growth rate. In broad bean, leaf, roots, and shoot growth was also impaired in most conditions, whereas nutrient and heavy metal content varied according to substances, their concentration, as well as plant part analysed. Results indicate that soil contamination with petroleum-derived substances entails far-reaching changes not only in organisms directly exposed to these pollutants (plants), but also indirectly in herbivores (aphids) and consequently provides information about potential negative effects on further links of the food chain, i.e., for predators and parasitoids.

  8. Hosting Capacity of Horticultural Plants for Insect Pests in Brazil Capacidad de Alojamiento de Plantas Hortícolas para Plagas de Insectos en Brasil

    Directory of Open Access Journals (Sweden)

    Germano L.D Leite

    2011-09-01

    Full Text Available Factors such as fertilization, allelochemicals, trichomes, weather, and natural enemies can influence pest populations. Thus, it is necessary to understand the factors that predispose vegetable species to pests and the role of polyculture, crop rotation, and neighboring plants. The objective of this research was to study the hosting capacity for pests of Abelmoschus esculentus (L., Brassica oleracea L. vars. acephala and capitata, Capsicum annuum L., Cucurbita moschata (Duchesne, Cucurbita maxima Duchesne and Cucumis sativus L., Lycopersicon esculentum Mill., Solanum gilo Raddi and Solanum melongena L., and Phaseolus vulgaris L. The higher density of Bemisia tabaci (Genn. adults on C. sativus can be due to the higher amount of pentacosane and octacosane in this plant. The occurrence of Brevicoryne brassicae (L. only in Brassica spp. can be accounted for by the nonacosane of these plants. The low trichome density and greater palmitic acid level can explain the greatest damage by Aphis gossypii Glover in A. esculentum. Empoasca sp. was more frequent in P. vulgaris followed by A. esculentum, which are plants with lower K content. Solanum melongena was attacked more by Hydrangea similis (Walker and Epitrix sp. perhaps because of higher palmitic acid and 11,14,17-eicosatrienoic methyl ester concentrations in their leaves. Frankliniella sp. exhibited more damage in C. sativus probably owing to higher pentacosane and octacosane in its leaves. Sistena sp. was more frequent in C. maxima and had higher octadecane levels and trichome density. The presence of ¥-humulene and hexacosane can explain the damage by Tuta absoluta (Meyrick on L. esculentum.Factores tales como la fertilización, aleloquímicos, tricomas, el clima y los enemigos naturales pueden influir en las poblaciones de plagas. Por lo tanto, es necesario comprender los factores que predisponen a las especies vegetales a las plagas y el papel de policultivos, rotación de cultivos y las plantas

  9. SELECTIVITY OF INSECTICIDES TO NATURAL ENEMIES ON SOIL CULTIVATED WITH COTTON SELETIVIDADE DE INSETICIDAS AOS INIMIGOS NATURAIS OCORRENTES SOBRE O SOLO CULTIVADO COM ALGODOEIRO

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Degrande

    2008-11-01

    Full Text Available

    The objective of this research was to evaluate the selectivity of the most used insecticides for controlling Aphis gossypii Glover, 1877, on natural enemies occurring on the cotton crop soil, under field conditions. The study was conducted in Dourados, Mato Grosso do Sul State, Brazil, as randomized blocks, with seven treatments and four replications. The treatments were: Acetamiprid 200 PS, Carbosulfan 400 CE, Diafentiurom 500 PM, Tiametoxam 250 WG, Imidacloprid 200 SC, Paration Metil 600 CE, and control. The samplings of cotton pests natural enemies occurring in the area were made with ";modified pittfall"; traps. During the evaluation period, it was verified the presence of natural enemies, mainly Araneae (31%, Formicidae (29%, and Tachinidae (16%. The insecticide Acetamiprid 200 PS was not selective to the family Formicidae, but it was selective to Araneida and Tachinidae. The insecticide Tiametoxam 250 WG represented a larger effect in the first day (DAA to the families Formicidae and Tachinidae, when mortality rates of 100% and 56%, respectively, were observed, but it was selective to Arachnida. The insecticide Imidacloprid 200 SC was not selective to ants and Tachinidae, but it was selective to the occurring spiders. Carbosulfan 400 CE was selective to spiders. Paration Metil 600 CE only preserved populations of Araneida.

    KEY-WORDS: Predator; parasitoid; Gossypium hirsutum.


  10. Alterações anatômicas em algodoeiro infectado pelo vírus da doença azul Anatomical alterations in blue disease infected cotton plant

    Directory of Open Access Journals (Sweden)

    Juliana K. Takimoto

    2009-01-01

    Full Text Available A doença azul do algodoeiro está associada a um vírus ainda pouco conhecido em suas características morfológicas e moleculares, tanto quanto a sua patologia e epidemiologia. O tipo de transmissão circulativa pelo afídeo vetor Aphis gossypii Glover, associado a recentes relatos de estudos moleculares, sustentam ser o agente etiológico uma espécie membro da família Luteoviridae. No presente trabalho, estudos anatômicos comparativos em plantas sadias e infectadas foram realizados com a finalidade de conhecer aspectos estruturais da interação vírus-espécie hospedeira, com potencial aplicação na área de diagnose e melhoramento genético. Os estudos anatômicos foram realizados em folhas de plantas infectadas, com área foliar reduzida, nervuras cloróticas e margem foliar voltada para baixo. O encurtamento dos entrenós, que resultam em um agrupamento de folhas, flores e frutos, e conseqüente redução da altura da planta, do número e tamanho dos frutos, são expressões fenotípicas da planta de algodão infectada, a qual serviu para o presente estudo. Nas plantas infectadas com o agente da doença azul havia maior acúmulo de calose e de cristais de oxalato de cálcio, cloroplastos íntegros distribuídos na região periférica das células do mesofilo e aparente alteração química no interior das células do parênquima paliçádico. Inclusões nos vasos do floema e, ocasionalmente no xilema, também foram observadas. O acúmulo de calose e a presença de inclusões no floema podem indicar uma relação ou preferência do vírus por esse tecido.Cotton blue disease is caused by a virus whose morphological and molecular characteristics is not well known and so demanding information its phytosanitary and epidemiological characteristics. Evidences of an aphid borne (Aphis gossypii Glover circulative (persistent type of transmission, associated with a recent molecular report, sustain for a virus species belonging to the

  11. Ocorrência e flutuação populacional de tripes, pulgões e inimigos naturais em crisântemo de corte em casa de vegetação Occurrence and population fluctuation of thrips, aphids and natural enemies in cut chrysanthemum in greenhouse

    Directory of Open Access Journals (Sweden)

    Lívia Mendes Carvalho

    2006-01-01

    Full Text Available Os pulgões e os tripes são importantes pragas em cultivo de crisântemo em casas de vegetação. O objetivo deste trabalho foi avaliar a ocorrência e flutuação populacional de tripes, pulgões e inimigos naturais em cultivares de crisântemo de corte ('White Reagan', 'Yellow Snowdon' e 'Sunny Reagan' em casa de vegetação comercial. A amostragem de tripes foi realizada através de batidas nas plantas ("tapping method" e a de pulgões a partir de coletas diretas nas plantas. Das espécies de tripes amostradas, mais de 90% foram identificadas como Frankliniella occidentalis (Pergande, e o restante incluíram F. gemina (Bagnall, Frankliniella sp., Caliothrips phaseoli (Hood e Haplothrips gowdeyi (Franklin. Foi observado maior número de tripes/planta no cultivar White Reagan se comparado com 'Yellow Snowdon'. Aphis gossypii Glover foi a espécie de pulgão mais comum (> 80%, sendo também coletados Myzus persicae (Sulzer e Dysaphis sp. Maior número de pulgões foi verificado na cultivar White Reagan, quando comparada com 'Sunny Reagan'. Orius insidiosus (Say foi o único predador encontrado associado aos tripes, sendo verificada uma correlação positiva significativa entre a população de tripes e a desse predador. Dentre os inimigos naturais relacionados aos pulgões, foram observados parasitóides (Aphidius colemani Viereck e Lysiphlebus testaceipes Cresson e predadores (Chrysoperla sp., Cycloneda sanguinea Linnaeus e Scymnus sp.. Houve uma correlação positiva significativa entre o crescimento populacional de pulgões e desses predadores e parasitóides nas cultivares White Reagan e Sunny Reagan. Inimigos naturais podem ocorrer naturalmente em casas de vegetação e influenciar as populações de pragas.Aphids and thrips play an important role on chrysanthemum crops in greenhouses. The objective of this work was to evaluate the occurrence and population densities of thrips, aphids and natural enemies in cut chrysanthemum cultivars

  12. Mutualisme pucerons – fourmis : étude des bénéfices retirés par les colonies d'Aphis fabae en milieu extérieur

    Directory of Open Access Journals (Sweden)

    Verheggen F.

    2009-01-01

    Full Text Available Aphid – ant mutualism: an outdoor study of the benefits for Aphis fabae. Aphid – ant relationships are common examples of mutualism. Aphids are indeed submitted to predation and therefore require protection, while ants are continuously looking for new sugar sources. The present work aimed to study the benefits that a mutualistic relationship with Lasius niger (Hymenoptera, Formicidae could bring to the black bean aphid Aphis fabae (Homoptera, Aphididae. Several parameters were observed in the field, on broad bean plants infested with an initial amount of 100 A. fabae and in presence or not of a L. niger colony. More aphids were observed on plants being visited by ants as well as a higher proportion of winged individuals. One explanation is that fewer predators were observed on plants being visited by ants, demonstrating their protective role. However, the number of parasitized aphids was not reduced in presence of L. niger. On the other hand, fewer different aphid species were present on plants foraged by ants, what suggests that they could exert a predation on unattended aphids. Our observations do not allow to conclude on any impact of L. niger on the fitness of the aphid host plant, although fewer exuvia and honeydew spots were observed when they were present. All these results confirm that L. niger increase the fitness of A. fabae colonies mainly by decreasing the number of predators and by reducing competition from aphid species unattended by ants.

  13. The entomopathogenic fungal endophytes Purpureocillium lilacinum (formerly Paecilomyces lilacinus and Beauveria bassiana negatively affect cotton aphid reproduction under both greenhouse and field conditions.

    Directory of Open Access Journals (Sweden)

    Diana Castillo Lopez

    Full Text Available The effects of two entomopathogenic fungal endophytes, Beauveria bassiana and Purpureocillium lilacinum (formerly Paecilomyces lilacinus, were assessed on the reproduction of cotton aphid, Aphis gossypii Glover (Homoptera:Aphididae, through in planta feeding trials. In replicate greenhouse and field trials, cotton plants (Gossypium hirsutum were inoculated as seed treatments with two concentrations of B. bassiana or P. lilacinum conidia. Positive colonization of cotton by the endophytes was confirmed through potato dextrose agar (PDA media plating and PCR analysis. Inoculation and colonization of cotton by either B. bassiana or P. lilacinum negatively affected aphid reproduction over periods of seven and 14 days in a series of greenhouse trials. Field trials were conducted in the summers of 2012 and 2013 in which cotton plants inoculated as seed treatments with B. bassiana and P. lilacinum were exposed to cotton aphids for 14 days. There was a significant overall effect of endophyte treatment on the number of cotton aphids per plant. Plants inoculated with B. bassiana had significantly lower numbers of aphids across both years. The number of aphids on plants inoculated with P. lilacinum exhibited a similar, but non-significant, reduction in numbers relative to control plants. We also tested the pathogenicity of both P. lilacinum and B. bassiana strains used in the experiments against cotton aphids in a survival experiment where 60% and 57% of treated aphids, respectively, died from infection over seven days versus 10% mortality among control insects. Our results demonstrate (i the successful establishment of P. lilacinum and B. bassiana as endophytes in cotton via seed inoculation, (ii subsequent negative effects of the presence of both target endophytes on cotton aphid reproduction using whole plant assays, and (iii that the P. lilacinum strain used is both endophytic and pathogenic to cotton aphids. Our results illustrate the potential of

  14. Cucumber Plants Baited with Methyl Salicylate Accelerates Scymnus (Pullus) sodalis (Coleoptera: Coccinellidae) Visiting to Reduce Cotton Aphid (Hemiptera: Aphididae) Infestation.

    Science.gov (United States)

    Dong, Y J; Hwang, S Y

    2017-10-01

    The cotton aphid, Aphis gossypii (Glover) (Hemiptera: Aphididae), is a major pest of many crops worldwide and a major cucumber plant pest in Taiwan. Because cotton aphids rapidly develop insecticide resistance and because of the insecticide residue problem, a safe and sustainable method is required to replace conventional chemical control methods. Methyl salicylate (MeSA), a herbivore-induced plant volatile, has been shown to affect aphids' behavior and attract the natural enemies of aphids for reducing their population. Therefore, this study examined the direct effects of MeSA on cotton aphids' settling preference, population development, and attractiveness to natural enemies. The efficiency of using MeSA and the commercial insecticide pymetrozine for reducing the cotton aphid population in laboratory and outdoor cucumber plant pot was also examined. The results showed no difference in winged aphids' settling preference and population development between the MeSA and blank treatments. Cucumber plants infested with cotton aphids and baited with 0.1% or 10% MeSA contained significantly higher numbers of the natural enemy of cotton aphids, namely Scymnus (Pullus) sodalis (Weise) (Coleoptera: Coccinellidae), and MeSA-treated cucumber plants contained a lower number of aphids. Significantly lower cotton aphid numbers were found on cucumber plants within a 10-m range of MeSA application. In addition, fruit yield showed no difference between the MeSA and pymetrozine treatments. According to our findings, 0.1% MeSA application can replace insecticides as a cotton aphid control tool. However, large-scale experiments are necessary to confirm its efficiency and related conservation biological control strategies before further use. © The Author 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  15. Effect of reproductive mode on host plant utilization of melon aphid (Hemiptera: Aphididae).

    Science.gov (United States)

    Liu, Xiangdong; Gao, Xue

    2010-12-01

    Variation in the reproductive mode of melon aphid Aphis gossypii Glover occurred on the large geographic scale, but the performance of different reproductive modes to use host plant is poorly understood. Life tables of melon aphid population that undergo the anholocyclic, androcyclic, and intermediate reproductive mode were conducted on different host plants. The results showed that the anholocyclic and androcyclic strains could become adults and produce offspring on cotton Gossypium hirsutum L., whereas the intermediate strain could not. The survival rate, net reproductive rate (R(0)), and intrinsic rate of natural increase (r(m)) of the androcyclic strain on cotton were significantly greater than that of the anholocyclic strain. The three strains could aptly use cucurbits host plants including cucumber Cucumis sativa L., pumpkin Cucurbita moschata (Duchesne ex Lam.), and zucchini Cucurbita pepo L.; survival rate and R(0) were not significantly different on these two host plants. Moreover, the r(m) of the anholocyclic strain on cucumber and the androcyclic strain on pumpkin and zucchini were significantly greater than that of the other two strains. The abilities of the three strains to use a host plant were flexible, because their r(m) on pumpkin or zucchini became equal after rearing for four successive generations; furthermore, the intermediate strain attained the ability to use cotton, and the performance of anholocyclic and intermediate strains to use cotton also significantly increased after feeding on pumpkin or zucchini for one or three generations. It was concluded that the reproductive mode and feeding experience affected the performance of melon aphid to use a host plant. © 2010 Entomological Society of America

  16. Identification of top-down forces regulating cotton aphid population growth in transgenic Bt cotton in central China.

    Directory of Open Access Journals (Sweden)

    Peng Han

    Full Text Available The cotton aphid Aphis gossypii Glover is the main aphid pest in cotton fields in the Yangtze River Valley Cotton-planting Zone (YRZ in central China. Various natural enemies may attack the cotton aphid in Bt cotton fields but no studies have identified potential specific top-down forces that could help manage this pest in the YRZ in China. In order to identify possibilities for managing the cotton aphid, we monitored cotton aphid population dynamics and identified the effect of natural enemies on cotton aphid population growth using various exclusion cages in transgenic Cry1Ac (Bt+CpTI (Cowpea trypsin inhibitor cotton field in 2011. The aphid population growth in the open field (control was significantly lower than those protected or restricted from exposure to natural enemies in the various exclusion cage types tested. The ladybird predator Propylaea japonica Thunberg represented 65% of Coccinellidae predators, and other predators consisted mainly of syrphids (2.1% and spiders (1.5%. The aphid parasitoids Aphidiines represented 76.7% of the total count of the natural enemy guild (mainly Lysiphlebia japonica Ashmead and Binodoxys indicus Subba Rao & Sharma. Our results showed that P. japonica can effectively delay the establishment and subsequent population growth of aphids during the cotton growing season. Aphidiines could also reduce aphid density although their impact may be shadowed by the presence of coccinellids in the open field (likely both owing to resource competition and intraguild predation. The implications of these results are discussed in a framework of the compatibility of transgenic crops and top-down forces exerted by natural enemy guild.

  17. Indian Bt Cotton Varieties Do Not Affect the Performance of Cotton Aphids

    Science.gov (United States)

    Lawo, Nora C.; Wäckers, Felix L.; Romeis, Jörg

    2009-01-01

    Cotton varieties expressing Cry proteins derived from the soil bacterium Bacillus thuringiensis (Bt) are grown worldwide for the management of pest Lepidoptera. To prevent non-target pest outbreaks and to retain the biological control function provided by predators and parasitoids, the potential risk that Bt crops may pose to non-target arthropods is addressed prior to their commercialization. Aphids play an important role in agricultural systems since they serve as prey or host to a number of predators and parasitoids and their honeydew is an important energy source for several arthropods. To explore possible indirect effects of Bt crops we here examined the impact of Bt cotton on aphids and their honeydew. In climate chambers we assessed the performance of cotton aphids, Aphis gossypii Glover (Hemiptera: Aphididae) when grown on three Indian Bt (Cry1Ac) cotton varieties (MECH 12, MECH 162, MECH 184) and their non-transformed near isolines. Furthermore, we examined whether aphids pick up the Bt protein and analyzed the sugar composition of aphid honeydew to evaluate its suitability for honeydew-feeders. Plant transformation did not have any influence on aphid performance. However, some variation was observed among the three cotton varieties which might partly be explained by the variation in trichome density. None of the aphid samples contained Bt protein. As a consequence, natural enemies that feed on aphids are not exposed to the Cry protein. A significant difference in the sugar composition of aphid honeydew was detected among cotton varieties as well as between transformed and non-transformed plants. However, it is questionable if this variation is of ecological relevance, especially as honeydew is not the only sugar source parasitoids feed on in cotton fields. Our study allows the conclusion that Bt cotton poses a negligible risk for aphid antagonists and that aphids should remain under natural control in Bt cotton fields. PMID:19279684

  18. Presence of the Aphid, Chaetosiphon fragaefolii, on Strawberry in Argentina

    OpenAIRE

    C?dola, Claudia; Grecob, Nancy

    2010-01-01

    Seasonal abundance of the strawberry aphid complex under different agronomic practices in the outskirts of La Plata, Argentina was studied on strawberry, Fragaria x ananassa Duchesne (Rosales: Rosaceae). Aphid densities were low in strawberry fields in which insecticides and fungicides were used. In addition to Aphis gossypii, Aphis fabae, Mysus persicae and Macrosiphum euphorbiae, the aphid, Chaetosiphon fragaefolii (Cockerell) (Homoptera: Aphididae), was recorded for the first time in this ...

  19. Introduced sap-feeding insect pests of crop plants in the Maltese Islands

    OpenAIRE

    Mifsud, David; Watson, Gillian W.

    1999-01-01

    Sap-feeding insects within Hemiptera and Thysanoptera are some of the most important crop pests world-wide. Apart from the loss of yield they cause by sap depletion, saliva toxicity and soiling of the leaves, some species transmit serious plant virus diseases. Important sap-feeding species that have been introduced to the Maltese Islands include the whitefly Bemisia tabaci; the scale insects Pseudo coccus !ongispinus, Planococcus citri and lcerya purchasi; the aphids Aphis gossypii, Aphis spi...

  20. Aphid resistance in florist's chrysanthemum (Chrysanthemum ...

    African Journals Online (AJOL)

    ... SAE is readily toxic when ingested by the pea aphid, Acyrthosiphon pisum, and the cotton aphid, Aphis gossypii. We transformed chrysanthemum genotype 1581 by Agrobacterium tumefaciens-mediated transformation with the SAE gene under the control of the chrysanthemum RbcS promoter to induce aphid resistance.

  1. Original Research Original Research

    African Journals Online (AJOL)

    User

    2013-06-16

    Jun 16, 2013 ... in watermelon cultivation (Burubai and Eribo, 2. It is observed that cow urine has inhibitory against several plant ... compared with the nectar. 004; Gururaja et al., 2011). lications in agriculture. It has ..... against melon aphids (Aphis gossypii) & pickleworms. (Diaphania hyalinata) in watermelon cultivation.

  2. Monitoring of aphid flight activities in seed potato crops in Serbia

    Directory of Open Access Journals (Sweden)

    Andja Vucetic

    2013-07-01

    Full Text Available Aphid flight activities in seed potato fields have been studied by the yellow water traps. It is a good method for monitoring aphids as vectors of viruses, but this study also showed it is a suitable method for insect-diversity research. During the four-year studies, over 11.500 specimens were collected and a total of 107 different taxa of aphids were identified. The most abundant species were polyphagous species, such as: Acyrthosiphon pisum (Haris, Aphis fabae Scopoli, Aphis gossypii Glover and Brachycaudus helichrysi (Kaltenbach. The results of the studies show that diversity of aphids in different regions of Serbia is similar regardless of the altitude and the diversity of terrain. At most sites it ranged from 2 to 3. The highest value was recorded in Begeč, locality in northern part of Serbia, in year 2008, and it was 2.92. The maximum values of the Shannon-Weaver diversity index at all sites were recorded in the first weeks of the monitoring of aphid flight activities. Morisita-Horn similarity index shows no significant differences between sites regardless of altitudes. The sites are grouped by year, not by similarity of relief. In spite of these results, the Chi-square analysis showed highly significant difference in vector frequencies among seasons and sites with more pronounced differences for PVY. As a consequence of differences in vector frequencies, the vector pressure index in some regions was different also. The number of vectors and vector pressure index vary depending on the altitude of localities. At localities at altitudes under 1000 m, they were high. The highest index was at Kotraža, locality in central part of Serbia, in 2007, when PVY index exceeded the value of 180, while for PLRV it was 60. At high altitudes on mountain Golija, above 1100 m, the number of aphids was low, as well as the vector pressure index which indicates that these regions are suitable for producing virus-free seed potato.

  3. Efeito de restritores hídricos sobre a germinação, comprimento da radícula e níveis de detecção de Colletotrichum gossypii var. cephalosporioides em sementes de algodão

    Directory of Open Access Journals (Sweden)

    Alderi Emídio de Araújo

    2012-03-01

    Full Text Available O fungo Colletotrichum gossypii var. cephalosporioides, agente causal da ramulose do algodoeiro, é transmitido pela semente que se constitui em uma das mais importantes fontes de inóculo inicial e de introdução da doença em áreas indenes. Para que se possa identificar sua presença em lotes de sementes, é importante que se empreguem métodos de detecção rápidos e seguros. O mais empregado é o do papel de filtro, que se baseia na avaliação de sinais do patógeno desenvolvidos sobre as sementes, seguida da sua identificação morfológica. O método apresenta a desvantagem do crescimento das plântulas no período de incubação das sementes que pode favorecer o desenvolvimento de outros fungos e prejudicar a caracterização do patógeno. Para minimizar este problema vem sendo empregada a técnica da restrição hídrica. O presente trabalho teve como objetivo avaliar o efeito de três solutos em dois potenciais osmóticos, comparados ao tratamento padrão de água destilada, ao congelamento e ao 2,4 D, sobre a germinação, comprimento da radícula e detecção do agente causal da ramulose, durante o teste de sanidade. Os solutos Manitol e NaCl foram mais eficientes em inibir a germinação e favorecer a incidência do patógeno no potencial osmótico de -0,8 MPa. O KCl mostrou-se eficiente em inibir a germinação nos dois potenciais osmóticos testados, -0,6 e -0,8 MPa, porém reduziu a incidência do patógeno no potencial de -0,8 MPa. Os solutos Manitol, nos potenciais osmóticos de -0,8 e -0,6 MPa e o NaCl no potencial osmótico de -0,8 foram eficientes em reduzir o comprimento da radícula, sem interferir negativamente nos níveis de detecção de C. gossypii var. cephalosporioides, podendo ser recomendados para uso em análises sanitárias de rotina.

  4. Impact of insecticides on non-target arthropods in watermelon cropImpacto de inseticidas em artrópodes não-alvo associados à cultura da melancia

    Directory of Open Access Journals (Sweden)

    Cíntia Ribeiro Souza

    2012-10-01

    Full Text Available Watermelon Citrullus lunatus (Thunberg, Matsumura & Nakai is an ecosystem having a variety of arthropods, each one playing a specific role. Although some of them are considered pest to crops, some others are responsible for soil aeration, nutrient release and predation of pest species and are, therefore, considered beneficial to crops. The intensive farming practiced for watermelon cultivation in Brazil is based on the use of tiamethoxam and deltamethrin, which may not only kill target but also nontarget organisms such as beneficial arthropods. Research data regarding the influence of insecticides on arthropods in watermelon cropping is scarce. This study aimed to evaluate the effect of the insecticides deltamethrin and thiamethoxam on soil surface and watermelon canopy arthropod community. The study was carried out in the State of Tocantins, Brazil. Although the application of thiamethoxam and deltamethrin was efficient in controlling populations of Aphis gossypii (Glover, as we expected, they negatively affected non-target arthropods such as detritivores insects in the canopy and soil surface. Ecological implications of the impact of such pesticides on beneficial arthropod species are discussed.A cultura da melancia Citrullus lunatus (Thunberg, Matsumura & Nakai abriga uma grande diversidade de artrópodes, cada um desempenhando um papel específico. Apesar de alguns desses artrópodes serem considerados pragas, outros são responsáveis pela aeração do solo, liberação de nutrientes e predação das espécies-praga, sendo, dessa forma, considerados benéficos às culturas. A agricultura intensiva praticada no Brasil para o cultivo da melancia é baseada no uso dos inseticidas como tiamethoxam e deltametrina, que pode não só matar as pragas, mas também organismos não-alvo. Pesquisas relacionadas à influência de inseticidas sobre artrópodes benéficos na cultura da melancia são escassas. Este estudo foi realizado com o objetivo de

  5. Stimulation des défenses naturelles par l’application d’un Lombricompost. Effet sur les paramètres populationnels d’Aphis fabae scop. (Homoptera: Aphididae et la qualité Phytochimique de la fève

    Directory of Open Access Journals (Sweden)

    Zahr-Eddine Djazouli

    2017-06-01

    Full Text Available Chaichi, W. Djazouli, Z. Djemai, I. Abdelkader, S. Ribera, I. and Nancé, J. 2017. Stimulation of natural defences by the application of lombricompost. Effect on the Aphis fabae scop. (Homoptéra: Aphididae population and phytochemical quality of faba bean. Lebanese Science Journal, 18(1: 81-97. The integrated production in durable agriculture aims to improve the efficiency of biological inputs through formulations extending the remanence in the field or the incorporation of synergistic products which, being themselves nontoxic at used quantities, increase the protective action of the viabe cultivations. The lombricultivation represents an appropriate technology to enhance the value of the farm residues and manage, on a long term basis, plant health. The study focused on the stimulation of natural defenses of bean through the use of a lombricompost dilutions produced in two different seasons. The effect of lombricompost has been evaluated based on the Aphis fabae population density in relation to the phytochemical quality of the nutritional support. Variations of biochemical molecule contents and major mineral elements during the leaf expanding phase have been noticed. These changes affect the biological performance as well as the density of A. fabae population. The results allowed detecting a positive effect of lombricompost on plant chemistry. On the other hand, enrichment in proteins and proline under the effect of strong dilution was noticed. Finally, results related to the repressive effect of the different forms of lombricompost showed a marked difference between treatments and the control, with a stronger effect on the winged forms. Results also indicated some variability of the Aphis Fabae populational structure in relation to the phytochemical enrichments established by the application of lombricompost.

  6. A comparison of alternative plant mixes for conservation bio-control by native beneficial arthropods in vegetable cropping systems in Queensland Australia.

    Science.gov (United States)

    Qureshi, S A; Midmore, D J; Syeda, S S; Reid, D J

    2010-02-01

    Cucurbit crops host a range of serious sap-sucking insect pests, including silverleaf whitefly (SLW) and aphids, which potentially represent considerable risk to the Australian horticulture industry. These pests are extremely polyphagous with a wide host range. Chemical control is made difficult due to resistance and pollution, and other side-effects are associated with insecticide use. Consequently, there is much interest in maximising the role of biological control in the management of these sap-sucking insect pests. This study aimed to evaluate companion cropping alongside cucurbit crops in a tropical setting as a means to increase the populations of beneficial insects and spiders so as to control the major sap-sucking insect pests. The population of beneficial and harmful insects, with a focus on SLW and aphids, and other invertebrates were sampled weekly on four different crops which could be used for habitat manipulation: Goodbug Mix (GBM; a proprietary seed mixture including self-sowing annual and perennial herbaceous flower species); lablab (Lablab purpureus L. Sweet); lucerne (Medicago sativa L.); and niger (Guizotia abyssinica (L.f.) Cass.). Lablab hosted the highest numbers of beneficial insects (larvae and adults of lacewing (Mallada signata (Schneider)), ladybird beetles (Coccinella transversalis Fabricius) and spiders) while GBM hosted the highest numbers of European bees (Apis mellifera Linnaeus) and spiders. Lucerne and niger showed little promise in hosting beneficial insects, but lucerne hosted significantly more spiders (double the numbers) than niger. Lucerne hosted sig-nificantly more of the harmful insect species of aphids (Aphis gossypii (Glover)) and Myzus persicae (Sulzer)) and heliothis (Heliothis armigera Hübner). Niger hosted significantly more vegetable weevils (Listroderes difficillis (Germar)) than the other three species. Therefore, lablab and GBM appear to be viable options to grow within cucurbits or as field boundary crops to

  7. Infeksi Cucumber mosaic virus dan Chilli veinal mottle virus pada Cabai di Kabupaten Rejang Lebong, Bengkulu

    Directory of Open Access Journals (Sweden)

    Mimi Sutrawati

    2013-04-01

    Full Text Available Mosaic disease caused by Cucumber mosaic virus (CMV and Chilli veinal mottle Virus (ChiVMV has been distributed widely in chilli in Indonesia and considered as important disease. A research was conducted to investigate the spread and incidence of CMV and ChiVMV in Rejang Lebong, Bengkulu and to identify its insect vector. Symptomatic and asymptomatic leaf samples were collected systematically from several chillipepper fields for further detection by DAS-ELISA (Double antibody sandwich-enzyme linked immunosorbant assay using specific antibody for CMV and ChiVMV. The result showed that infection of both CMV and ChiVMV was found with disease incidence reached 20-50%, whereas infection only by ChiVMV or CMV were 50-80% and 20-50%, respectively. One species of aphid, i.e. Aphis gossypii was found from the fields.Key words: Aphis gossypii, CMV, ChiVMV, disease incidence

  8. Resource Provisioning as a Habitat Manipulation Tactic to Enhance the Aphid Parasitoid, Aphidius colemani Viereck (Hymenoptera: Braconidae: Aphidiinae), and the Plant-Mediated Effects of a Systemic Insecticide, Imidacloprid

    OpenAIRE

    Charles-Tollerup, Jennifer Jean

    2012-01-01

    Resource provisioning as a habitat manipulation tactic to control the melon aphid, Aphis gossypii, by the polyphagous aphid parasitoid, Aphidius colemani, was investigated in the ornamental, potted-plant nursery using the shrub Photinia x fraseri as a plant host. Floral food resources from an invasive, Conium maculatum, an ornamental, P. x fraseri, and a native, Salvia apiana considerably improved the longevity and fecundity of A. colemani in laboratory experiments. Additionally, floral nec...

  9. Genetic differentiating Aphis fabae and Aphis craccivora (Hemiptera: Sternorranycha: Aphididae) populations in Egypt using mitochondrial COI

    Czech Academy of Sciences Publication Activity Database

    Helmi, A.; Sharaf, Abdoallah

    2016-01-01

    Roč. 71, č. 11 (2016), s. 1266-1273 ISSN 0006-3088 Institutional support: RVO:60077344 Keywords : DNA sequencing * Aphididae * COI * biotypes * SNPs * molecular phylogeny Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.759, year: 2016

  10. Bacterial Communities of Two Parthenogenetic Aphid Species Cocolonizing Two Host Plants across the Hawaiian Islands ▿

    Science.gov (United States)

    Jones, Ryan T.; Bressan, Alberto; Greenwell, April M.; Fierer, Noah

    2011-01-01

    Aphids (Hemiptera: Aphididae) have been the focus of several studies with respect to their interactions with inherited symbionts, but bacterial communities of most aphid species are still poorly characterized. In this research, we used bar-coded pyrosequencing to characterize bacterial communities in aphids. Specifically, we examined the diversity of bacteria in two obligately parthenogenetic aphid species (the melon aphid, Aphis gossypii, and the cardamom aphid, Pentalonia caladii) cocolonizing two plant species (taro, Colocasia esculenta, and ginger, Alpinia purpurata) across four Hawaiian Islands (Hawaii, Kauai, Maui, and Oahu). Results from this study revealed that heritable symbionts dominated the bacterial communities for both aphid species. The bacterial communities differed significantly between the two species, and A. gossypii harbored a more diverse bacterial community than P. caladii. The bacterial communities also differed across aphid populations sampled from the different islands; however, communities did not differ between aphids collected from the two host plants. PMID:21965398

  11. Bacterial communities of two parthenogenetic aphid species cocolonizing two host plants across the Hawaiian Islands.

    Science.gov (United States)

    Jones, Ryan T; Bressan, Alberto; Greenwell, April M; Fierer, Noah

    2011-12-01

    Aphids (Hemiptera: Aphididae) have been the focus of several studies with respect to their interactions with inherited symbionts, but bacterial communities of most aphid species are still poorly characterized. In this research, we used bar-coded pyrosequencing to characterize bacterial communities in aphids. Specifically, we examined the diversity of bacteria in two obligately parthenogenetic aphid species (the melon aphid, Aphis gossypii, and the cardamom aphid, Pentalonia caladii) cocolonizing two plant species (taro, Colocasia esculenta, and ginger, Alpinia purpurata) across four Hawaiian Islands (Hawaii, Kauai, Maui, and Oahu). Results from this study revealed that heritable symbionts dominated the bacterial communities for both aphid species. The bacterial communities differed significantly between the two species, and A. gossypii harbored a more diverse bacterial community than P. caladii. The bacterial communities also differed across aphid populations sampled from the different islands; however, communities did not differ between aphids collected from the two host plants.

  12. Activity of telomerase and telomeric length in Aphis mellifera

    Czech Academy of Sciences Publication Activity Database

    Korandová, Michala; Čapková Frydrychová, Radmila

    2016-01-01

    Roč. 125, č. 3 (2016), s. 405-411 ISSN 0009-5915 R&D Projects: GA ČR GA14-07172S Grant - others:GA JU(CZ) 052/2013/P; European Union Seventh Framework(CZ) 316304 Program:FP7 Institutional support: RVO:60077344 Keywords : telomere * telomerase * Apis mellifera Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.414, year: 2016

  13. 9 CFR 124.10 - APHIS liaison with PTO.

    Science.gov (United States)

    2010-01-01

    ... the product was subject to a regulatory review period before its commercial marketing or use; (2) Determining whether the permission for commercial marketing or use of the product after the regulatory review period was the first permitted commercial marketing or use of the product under the provision of law...

  14. Evaluation de l'incidence des attaques des insectes piqueurs ...

    African Journals Online (AJOL)

    Dans la perspective de contribuer à l'élaboration d'une stratégie de gestion intégrée desprincipaux insectes piqueurs-suceurs (Aphis gossypii et Jacobiella fascialis) rencontrés en culture cotonnière au Togo, un test de résistance variétale a été réalisé sur la station de Kolokopé de juillet à octobre 2016.Huit variétés de ...

  15. Biodiversité fonctionnelle : des bandes fleuries contre les pucerons

    OpenAIRE

    Lambion, Jérôme

    2014-01-01

    Cette présentation fait le bilan des essais concernant les bandes fleuries visant à favoriser les auxiliaires naturels contre les pucerons, qui sont parmi les principaux ravageurs dans le Sud de la France, en particulier sur melon (pour lequel aucun produit phytosanitaire n’est autorisé en AB). Ces essais s'inscrivent dans un réseau d'expérimentations : le CASDAR AGATH (Gestion agro-écologique du puceron Aphis gossypii et du thrips Thrips tabaci en culture de melon ou de poireau) et le CTPS P...

  16. PRODUCT NEEM AZAL T/S - BROAD-SPECTRUM PHYPOPESTICIDE FOR CONTROL OF PESTS ON VEGETABLE CROPS

    Directory of Open Access Journals (Sweden)

    Vinelina Yankova

    2016-09-01

    Full Text Available Experiments for determination of the effectiveness of product Neem Azal T/S (a. i. azadirachtin were conducted at a concentration of 0,3% against some major pests in vegetable crops grown in greenhouses at the Maritsa Vegetable Crops research Institute, Plovdiv during the period 2010-2016. It was established very good insecticidal and acaricidal action of phytopesticide against: cotton aphid (Aphis gossypii Glov.; green peach aphid (Myzus persicae Sulz.; western flower trips (Frankliniella occidentalis Perg.; cotton bollworm (Helicoverpa armigera Hubn.; tomato borer (Tuta absoluta Meyrick and two-spotted spider mite (Tetranichus urticae Koch.. This product is a successful alternative to using chemical insecticides and acaricides.

  17. Ocorrência de afídeos causando danos em mangueira (Mangifera indica L., no Vale do São Francisco

    Directory of Open Access Journals (Sweden)

    FERREIRA RACHEL GONÇALVES

    2002-01-01

    Full Text Available Observaram-se em pomares de mangueiras (Mangifera indica L., no semi-árido nordestino, altas infestações de afídeos causando danos às folhas novas e brotações da planta. Diversas amostras foram coletadas, tendo sido identificadas três espécies: Aphis craccivora, Aphis gossypii e Toxoptera aurantii. As duas primeiras espécies estão sendo relatadas pela primeira vez como pragas, em mangueiras, no Brasil. Espécimens de referência encontram-se depositados no Laboratório de Entomologia da Embrapa Semi-Árido, localizada em Petrolina-PE.

  18. EPIDEMIOLOGICAL ASPECTS OF COTTON RAMULOSIS (Colletotrichum gossypii SOUTH. Var. cephalosporioides COSTA ASPECTOS EPIDEMIOLÓGICOS DA RAMULOSE (Colletotrichum gossypii South. var. cephalosporioides Costa DO ALGODOEIRO (Gossypium hirsutum L.

    Directory of Open Access Journals (Sweden)

    Fuad Calil

    2007-09-01

    Full Text Available

    These experiments deal with the effects of outbreak of early, medium and late developing ramulosis on the IAC-13.l variety of cotton, which was seeded at three different intervals in Itauçu (Goiás—Brazil. The effects of the ramulosis on the height and weight of the plants, on the number of bolls, and on the weight of the cotton seeds and lints, were studied. The experiments were installed in a flat area of red latosoil. The experimental design was one of random blocks with six repetitions and the plants were classified, at the end of their vegetative growth, into the following categories: healthy, early ramulosis, medium ramulosis and late developing ramulosis. The early and medium ramulosis affected more significantly the studied parameters, and it was observed that varieties of cotton which were moderately resistant in relation to ramulosis, can be severely affected during growing seasons of heavy rains such as the 1975/76 season.

    Estudaram-se os efeitos da incidência precoce, mediana e tardia de ramulose sobre o peso e altura das plantas, número de capulhos, peso das sementes e da pluma de algodoeiro do cultivar IAC-l3.l em três épocas de semeadura (21/10/75, 21/11/75 e 23/12/75 no município de Itauçu (GO. O experimento foi instalado em região plana com latossolo vermelho. Foram utilizados blocos casualizados com seis repetições e plantas no final do ciclo vegetativo foram classificadas em quatro tipos: sadias, com ramulose precoce, com ramulose mediana ou com ramulose tardia. Concluiu-se que a forma precoce e também a mediana foram as que afetaram mais significativamente os parâmetros aferidos, e que cultivares tidos como de razoável comportamento em relação à ramulose, podem ser severamente afetados em anos agrícolas muito chuvosos como foi o de 1975/76.

  19. Aphid honeydew quality as a food source for parasitoids is maintained in Bt cotton.

    Science.gov (United States)

    Hagenbucher, Steffen; Wäckers, Felix L; Romeis, Jörg

    2014-01-01

    Bt-transgenic cotton has proven to be highly efficient in controlling key lepidopteran pests. One concern with the deployment of Bt cotton varieties is the potential proliferation of non-target pests. We previously showed that Bt cotton contained lower concentrations of insecticidal terpenoids as a result of reduced caterpillar damage, which benefited the aphid Aphis gossypii. It is thus important that non-target herbivores are under biological control in Bt cotton fields. The induction or lack of induction of terpenoids could also influence the quality of aphid honeydew, an important food source for beneficial insects. We therefore screened A. gossypii honeydew for cotton terpenoids, that are induced by caterpillars but not the aphids. We then tested the influence of induced insect-resistance of cotton on honeydew nutritional quality for the aphid parasitoid Lysiphlebus testaceipes and the whitefly parasitoid Eretmocerus eremicus. We detected the cotton terpenoids gossypol and hemigossypolone in A. gossypii honeydew. Although a feeding assay demonstrated that gossypol reduced the longevity of both parasitoid species in a non-linear, dose-dependent manner, the honeydew was capable of sustaining parasitoid longevity and reproduction. The level of caterpillar damage to Bt and non-Bt cotton had no impact on the quality of honeydew for the parasitoids.These results indicate that the nutritional quality of honeydew is maintained in Bt cotton and is not influenced by induced insect resistance.

  20. Aphid honeydew quality as a food source for parasitoids is maintained in Bt cotton.

    Directory of Open Access Journals (Sweden)

    Steffen Hagenbucher

    Full Text Available Bt-transgenic cotton has proven to be highly efficient in controlling key lepidopteran pests. One concern with the deployment of Bt cotton varieties is the potential proliferation of non-target pests. We previously showed that Bt cotton contained lower concentrations of insecticidal terpenoids as a result of reduced caterpillar damage, which benefited the aphid Aphis gossypii. It is thus important that non-target herbivores are under biological control in Bt cotton fields. The induction or lack of induction of terpenoids could also influence the quality of aphid honeydew, an important food source for beneficial insects. We therefore screened A. gossypii honeydew for cotton terpenoids, that are induced by caterpillars but not the aphids. We then tested the influence of induced insect-resistance of cotton on honeydew nutritional quality for the aphid parasitoid Lysiphlebus testaceipes and the whitefly parasitoid Eretmocerus eremicus. We detected the cotton terpenoids gossypol and hemigossypolone in A. gossypii honeydew. Although a feeding assay demonstrated that gossypol reduced the longevity of both parasitoid species in a non-linear, dose-dependent manner, the honeydew was capable of sustaining parasitoid longevity and reproduction. The level of caterpillar damage to Bt and non-Bt cotton had no impact on the quality of honeydew for the parasitoids.These results indicate that the nutritional quality of honeydew is maintained in Bt cotton and is not influenced by induced insect resistance.

  1. Carboxylesterase-mediated insecticide resistance: Quantitative increase induces broader metabolic resistance than qualitative change.

    Science.gov (United States)

    Cui, Feng; Li, Mei-Xia; Chang, Hai-Jing; Mao, Yun; Zhang, Han-Ying; Lu, Li-Xia; Yan, Shuai-Guo; Lang, Ming-Lin; Liu, Li; Qiao, Chuan-Ling

    2015-06-01

    Carboxylesterases are mainly involved in the mediation of metabolic resistance of many insects to organophosphate (OP) insecticides. Carboxylesterases underwent two divergent evolutionary events: (1) quantitative mechanism characterized by the overproduction of carboxylesterase protein; and (2) qualitative mechanism caused by changes in enzymatic properties because of mutation from glycine/alanine to aspartate at the 151 site (G/A151D) or from tryptophan to leucine at the 271 site (W271L), following the numbering of Drosophila melanogaster AChE. Qualitative mechanism has been observed in few species. However, whether this carboxylesterase mutation mechanism is prevalent in insects remains unclear. In this study, wild-type, G/A151D and W271L mutant carboxylesterases from Culex pipiens and Aphis gossypii were subjected to germline transformation and then transferred to D. melanogaster. These germlines were ubiquitously expressed as induced by tub-Gal4. In carboxylesterase activity assay, the introduced mutant carboxylesterase did not enhance the overall carboxylesterase activity of flies. This result indicated that G/A151D or W271L mutation disrupted the original activities of the enzyme. Less than 1.5-fold OP resistance was only observed in flies expressing A. gossypii mutant carboxylesterases compared with those expressing A. gossypii wild-type carboxylesterase. However, transgenic flies universally showed low resistance to OP insecticides compared with non-transgenic flies. The flies expressing A. gossypii W271L mutant esterase exhibited 1.5-fold resistance to deltamethrin, a pyrethroid insecticide compared with non-transgenic flies. The present transgenic Drosophila system potentially showed that a quantitative increase in carboxylesterases induced broader resistance of insects to insecticides than a qualitative change. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Impact of Vat resistance in melon on viral epidemics and genetic structure of virus populations.

    Science.gov (United States)

    Schoeny, Alexandra; Desbiez, Cécile; Millot, Pauline; Wipf-Scheibel, Catherine; Nozeran, Karine; Gognalons, Patrick; Lecoq, Hervé; Boissot, Nathalie

    2017-09-15

    Cultivar choice is at the heart of cropping systems and resistant cultivars should be at the heart of disease management strategies whenever available. They are the easiest, most efficient and environmentally friendly way of combating viral diseases at the farm level. Among the melon genetic resources, Vat is a unique gene conferring resistance to both the melon aphid Aphis gossypii and the viruses it carries. The 'virus side' of this pleiotropic phenotype is seldom regarded as an asset for virus control. Indeed, the effect of Vat on virus epidemics in the field is expected to vary according to the composition of aphid populations in the environment and long-term studies are needed to draw a correct trend. Therefore, the first objective of the study was to re-evaluate the potential of Vat to reduce viral diseases in melon crops. The second objective was to investigate the potential of Vat to exert a selection pressure on virus populations. We monitored the epidemics of Cucurbit aphid-borne yellows virus (CABYV), Cucumber mosaic virus (CMV), Watermelon mosaic virus (WMV) and Zucchini yellow mosaic virus (ZYMV) in two melon lines having a common genetic background, a resistant line (R) and a susceptible line (S), in eight field trials conducted in southeastern France between 2011 and 2015. Vat had limited impact if any on WMV epidemics probably because A. gossypii is not the main vector of WMV in the field, but a favorable impact on CMV, yet of variable intensity probably related to the importance of A. gossypii in the total aphid population. Vat had a significant impact on CABYV epidemics with mean incidence reduction exceeding 50% in some trials. There was no effect of Vat on the structure of virus populations, both for the non-persistent WMV transmitted by numerous aphid species and for the persistent CABYV transmitted predominantly by A. gossypii. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Simulate rain about action insecticide flonicamid in the control of the cotton aphid=Chuva simulada sobre ação inseticida flonicamid no controle do pulgão-do-algodoeiro.

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Degrande

    2011-10-01

    Full Text Available The cotton production system in Brazil concentrates on the area of the cerrado, characterized by frequent rains that interfere in the effectiveness of the necessary sprays during its cycle. The objective of the work was to evaluate simulate rain of 15 mm in 4 hours after spraying in the control of Aphis gossypii with insecticide flonicamid. Plants of Gossypium hirsutum were cultivated in pots containing soil as substrate in greenhouse conditions. The pots were arranged in randomized complete design with seven treatments and five replicates, consisting of: test without insecticide spraying, without insecticide spraying with rain, flonicamid spraying with simulate rain of 15 mm after 30 minutes, 1, 2 and 4 hours after spraying. Equivalent insecticide was sprayed 75 g of flonicamid by hectare. The efficiency evaluation was accomplished through the individuals of A. gossypii count which started from an artificial infestation 6 days before the application of the treatments. The results were: a 15-mm precipitation during the first four hours after flonicamid spraying interfered negatively in the control of A. gossypii.O cultivo do algodoeiro no Brasil concentra-se na Região do Cerrado, caracterizada por chuvas freqüentes que interferem na eficácia das pulverizações necessárias durante seu ciclo. O objetivo do trabalho foi avaliar chuva simulada de 15 mm nas 4h iniciais após pulverização no controle de A. gossypii com inseticida flonicamid. Plantas de Gossypium hirsutum foram cultivadas em vasos contendo solo como substrato em condições de casa-de-vegetação. Cada parcela foi constituída de um vaso com duas plantas. Utilizou-se delineamento experimental inteiramente casualizado com sete tratamentos e cinco repetições, consistindo de: testemunha sem pulverização de inseticida, testemunha sem pulverização de inseticida com presença de chuva e pulverização de flonicamid com chuva simulada de 15 mm aos 30 min., 1, 2 e 4h após aplica

  4. Seasonal phenology and species composition of the aphid fauna in a northern crop production area.

    Directory of Open Access Journals (Sweden)

    Sascha M Kirchner

    Full Text Available BACKGROUND: The species diversity of aphids and seasonal timing of their flight activity can have significant impacts on crop production, as aphid species differ in their ability to transmit plant viruses and flight timing affects virus epidemiology. The aim of the study was to characterise the species composition and phenology of aphid fauna in Finland in one of the northernmost intensive crop production areas of the world (latitude 64°. METHODOLOGY/PRINCIPAL FINDINGS: Flight activity was monitored in four growing seasons (2007-010 using yellow pan traps (YPTs placed in 4-8 seed potato fields and a Rothamsted suction trap. A total of 58,528 winged aphids were obtained, identified to 83 taxa based on morphology, and 34 species were additionally characterised by DNA barcoding. Seasonal flight activity patterns analysed based on YPT catch fell into three main phenology clusters. Monoecious taxa showed early or middle-season flight activity and belonged to species living on shrubs/trees or herbaceous plants, respectively. Heteroecious taxa occurred over the entire potato growing season (ca. 90 days. Abundance of aphids followed a clear 3-year cycle based on suction trap data covering a decade. Rhopalosiphum padi occurring at the end of the potato growing season was the most abundant species. The flight activity of Aphis fabae, the main vector of Potato virus Y in the region, and Aphis gossypii peaked in the beginning of potato growing season. CONCLUSIONS/SIGNIFICANCE: Detailed information was obtained on phenology of a large number aphid species, of which many are agriculturally important pests acting as vectors of plant viruses. Aphis gossypii is known as a pest in greenhouses, but our study shows that it occurs also in the field, even far in the north. The novel information on aphid phenology and ecology has wide implications for prospective pest management, particularly in light of climate change.

  5. Results of Sediment Sampling and Elutriate Testing at the Proposed Glovers Point Shallow Water Habitat Project Site

    Science.gov (United States)

    2013-04-01

    hypoxia is primarily caused by excess nutrients – originating from cities, farms , and industries in the Mississippi River Basin – which cause extensive...the Missouri River because much of the topsoil portion of the sediment disposed of in the river has been heavily fertilized . The Nation Research...Total (mg/kg) (Arsenic, Cadmium, Chromium, Copper, Lead, Mercury, Nickel, Zinc)  Organochlorine Pesticide and PCB Scan (µg/kg

  6. Survey of aphid population in a yellow passion fruit crop and its relationship on the spread Cowpea aphid-borne mosaic virus in a subtropical region of Brazil.

    Science.gov (United States)

    Garcêz, Renata Maia; Chaves, Alexandre Levi Rodrigues; Eiras, Marcelo; Meletti, Laura Maria Molina; de Azevedo Filho, Joaquim Adelino; da Silva, Leonardo Assis; Colariccio, Addolorata

    2015-01-01

    Passion fruit woodiness may be caused by Cowpea aphid-borne mosaic virus (CABMV) and is currently the major passion fruit disease in Brazil. To assess the virus-vector-host interactions, a newly introduced golden passion fruit plantation located in eastern region of São Paulo State, Brazil, was monitored. Dissemination of CABMV was determined analyzing golden passion fruit plants monthly for 18 months by PTA-ELISA. Seasonality and aphid fauna diversity was determined by identification of the captured species using yellow sticky, yellow water-pan and green tile traps. Population composition of the aphid species was determined using the descriptive index of occurrence, dominance and general classification and overlap of species in the R program. Analyses of species grouping afforded to recognize 14 aphid species. The genus Aphis represented 55.42 % of the species captured. Aphid species formed two distinct clusters, one of which was characterized by the diversity of polyphagous species that presented high potential to spread CABMV. The low abundance and diversity of aphid species did not interfere negatively in the CABMV epidemiology. The genus Aphis, particularly Aphis fabae/solanella and A. gossypii, was crucial in the spread of CABMV in passion fruit orchards in the eastern State of São Paulo.

  7. Prey Acceptability and Preference of Oenopia conglobata (Coleoptera: Coccinellidae, a Candidate for Biological Control in Urban Green Areas

    Directory of Open Access Journals (Sweden)

    Belén Lumbierres

    2018-01-01

    Full Text Available Oenopia conglobata is one of the most common ladybird species in urban green areas of the Mediterranean region. We have obtained data about its prey acceptability and prey preferences. In a laboratory experiment, we investigated the acceptability of seven aphid and one psyllid species as prey for this coccinellid: the aphids Chaitophorus populeti, Aphis gossypii, Aphis craccivora Monelliopsis caryae, Eucallipterus tiliae, Aphis nerii (on white poplar, pomegranate, false acacia, black walnut, lime, and oleander, respectively, and the psyllid Acizzia jamatonica on Persian silk tree. These species are abundant in urban green areas in the Mediterranean region. In addition, we tested the acceptability of Rhopalosiphum padi on barley, an aphid species easily reared in the laboratory. We also tested preferences of the predator in cafeteria experiments with three aphid species and one aphid and the psyllid. Adults and larvae of the coccinellid accepted all of the preys offered, except A. nerii, with a clear preference for M. caryae. The predator also showed preference for M. caryae when it was offered in a cafeteria experiment with other aphid species or with the psyllid. The aphid R. padi obtained a good acceptability and could be used for rearing O. conglobata in the laboratory.

  8. [Isolation, identification and insecticidal activity of endophyte from Achnatherum inebrians].

    Science.gov (United States)

    Zhang, Xuebing; Shi, Yingwu; Wang, Xiaoxia; Zhang, Wei; Lou, Kai

    2010-04-01

    To study endophyte species of Achnatherum inebrians and to screen strains with insecticidal activity against cotton insect. We isolated endophytic from roots,stems,leaves and seeds of health A. inebrians by grinding separation method and identified by a dual approach of morphological and physiological observation and 16S rDNA gene (for bacteria) and ITS sequence (for fungi) based molecular identification. Then,those endophytes were inoculated into liquid media for fermentation and the crude extracts were used to test insecticidal activities by slide disc immersion and nebulization methods. We isolated bacteria species classified into 8 genera of Bacillus, Streptomyces, Corynebacterium, Phyllobacterium, sphingomonnas, Paenibacillus, Pseudomonas, Acinetobacter and 2 fungi of Claviceps purpure and Claviceps Chaetomium. Of them, the strain Streptomyces rochei (GA) and Claviceps purpurea (PF-2) had more than 85% of mortality to cotton aphis. Two strains of PF-2 and GA associated within the A. inebrians had significant insecticidal activity to cotton aphis (Aphis gossypii), which may provide a new biological resource to explore new microbial insecticide.

  9. Prey Acceptability and Preference of Oenopia conglobata (Coleoptera: Coccinellidae), a Candidate for Biological Control in Urban Green Areas.

    Science.gov (United States)

    Lumbierres, Belén; Madeira, Filipe; Pons, Xavier

    2018-01-12

    Oenopia conglobata is one of the most common ladybird species in urban green areas of the Mediterranean region. We have obtained data about its prey acceptability and prey preferences. In a laboratory experiment, we investigated the acceptability of seven aphid and one psyllid species as prey for this coccinellid: the aphids Chaitophorus populeti, Aphis gossypii , Aphis craccivora Monelliopsis caryae , Eucallipterus tiliae , Aphis nerii (on white poplar, pomegranate, false acacia, black walnut, lime, and oleander, respectively), and the psyllid Acizzia jamatonica on Persian silk tree. These species are abundant in urban green areas in the Mediterranean region. In addition, we tested the acceptability of Rhopalosiphum padi on barley, an aphid species easily reared in the laboratory. We also tested preferences of the predator in cafeteria experiments with three aphid species and one aphid and the psyllid. Adults and larvae of the coccinellid accepted all of the preys offered, except A. nerii , with a clear preference for M. caryae . The predator also showed preference for M. caryae when it was offered in a cafeteria experiment with other aphid species or with the psyllid. The aphid R. padi obtained a good acceptability and could be used for rearing O. conglobata in the laboratory.

  10. Vat

    Science.gov (United States)

    Boissot, Nathalie; Schoeny, Alexandra; Vanlerberghe-Masutti, Flavie

    2016-01-01

    We review half a century of research on Cucumis melo resistance to Aphis gossypii from molecular to field levels. The Vat gene is unique in conferring resistance to both A. gossypii and the viruses it transmits. This double phenotype is aphid clone-dependent and has been observed in 25 melon accessions, mostly from Asia. It is controlled by a cluster of genes including CC-NLR, which has been characterized in detail. Copy-number polymorphisms (for the whole gene and for a domain that stands out in the LLR region) and single-nucleotide polymorphisms have been identified in the Vat cluster. The role of these polymorphisms in plant/aphid interactions remains unclear. The Vat gene structure suggests a functioning with separate recognition and response phases. During the recognition phase, the VAT protein is thought to interact (likely indirectly) with an aphid effector introduced during cell puncture by the aphid. A few hours later, several miRNAs are upregulated in Vat plants. Peroxidase activity increases, and callose and lignin are deposited in the walls of the cells adjacent to the stylet path, disturbing aphid behavior. In aphids feeding on Vat plants, Piwi-interacting RNA-like sequences are abundant and the levels of other miRNAs are modified. At the plant level, resistance to aphids is quantitative (aphids escape the plant and display low rates of reproduction). Resistance to viruses is qualitative and local. Durability of NLR genes is highly variable. A. gossypii clones are adapted to Vat resistance, either by introducing a new effector that interferes with the deployment of plant defenses, or by adapting to the defenses it triggered. Viruses transmitted in a non-persistent manner cannot adapt to Vat resistance. At population level, Vat reduces aphid density and genetic diversity. The durability of Vat resistance to A. gossypii populations depends strongly on the agro-ecosystem, including, in particular, the presence of other cucurbit crops serving as

  11. THE EFFECT OF AGRO-ECOLOGICAL ZONES ON THE INCIDENCE AND DISTRIBUTION OF APHID VECTORS OF PEPPER VEINAL MOTTLE VIRUS, ON CULTIVATED PEPPER (CAPSICUM ANNUUM L. IN NIGERIA

    Directory of Open Access Journals (Sweden)

    A.A. FAJINMI

    2011-11-01

    Full Text Available The distribution of aphid vectors of Pepper veinal mottle virus (PVMV was studied on cultivated pepper between 2003 and 2005 in the major pepper producing areas of the six agro-ecological zones in Nigeria. The aphids were isolated, identified and their transmission ability determined. Population of aphid vectors increased progressively in all the agro-ecological zones from March at the onset of raining season reaching a peak in August and then declining from September at the on set of the dry season. The Humid forest and Derived Savanna agro-ecological zones recorded highest mean population of aphids / leaf and types of aphid’s species compared with other agro-ecological zones. Six species of aphid, Myzus persicae (Sulzer, Aphis gossipii (Glover, Aphis craccivora (Koch, Aphis spiraecola (Patch, Aphis fabae (Blanchard, and Rhopalosiphum maidis (Fitch, were identified on the pepper fields surveyed in all the agro-ecological zones. There was no significant difference in the occurrence of M. persicae, A. gossipii, A. craccivora, and R. maidis while A. spiraecola and A. fabae that varied in occurrence in all the zones. Ability to transmit PVMV to a healthy pepper plants varied in all the identified aphid species but R. maidis was not able to transmit PVMV from infected to a healthy pepper plant. A more sustainable approach to controlling pepper viruses is by targeting the aphid vectors and preventing the vectors from reaching the crops because the aphid vectors which are virus specific are the major means of transmitting virus to healthy plant.

  12. A genetic map of melon (Cucumis melo L.) with RFLP, RAPD, isozyme, disease resistance and morphological markers.

    Science.gov (United States)

    Baudracco-Arnas, S; Pitrat, M

    1996-07-01

    One hundred and ten markers were analysed for linkage in 218 F2 plants derived from two divergent cultivars ('Védrantais' and 'Songwhan Charmi') of Cucumis melo (L.). Thirty-four RFLPs, 64 RAPDs, one isozyme, four disease resistance markers and one morphological marker were used to construct a genetic map spanning 14 linkage groups covering 1390 cM of the melon genome. RAPD and RFLP markers detected similar polymorphism levels. RFLPs were largely due to base substitutions rather than insertion/deletions. Twelve percent of markers showed distorted segregation. Phenotypic markers consisted of two resistance genes against Fusarium wilt (Fom-1 and Fom-2), one gene (nsv) controlling the resistance to melon necrotic spot virus, one gene (Vat) conferring resistance to Aphis gossypii, and a recessive gene for carpel numbers (3 vs 5 carpels: p).

  13. Characterization of a new potyvirus causing mosaic and flower variegation in Catharanthus roseus in Brazil

    Directory of Open Access Journals (Sweden)

    Sheila Conceição Maciel

    2011-12-01

    Full Text Available Catharanthus roseus is a perennial, evergreen herb in the family Apocynaceae, which is used as ornamental and for popular medicine to treat a wide assortment of human diseases. This paper describes a new potyvirus found causing mosaic symptom, foliar malformation and flower variegation in C. roseus. Of 28 test-plants inoculated mechanically with this potyvirus, only C. roseus and Nicotiana benthamiana developed systemic mosaic, whereas Chenopodium amaranticolor and C. quinoa exhibited chlorotic local lesions. The virus was transmitted by Aphis gossypii and Myzus nicotianae. When the nucleotide sequence of the CP gene (768nt was compared with other members of the Potyviridae family, the highest identities varied from 67 to 76 %. For the 3' UTR (286nt, identities varied from 16.8 to 28.6 %. The name Catharanthus mosaic virus (CatMV is proposed for this new potyvirus.

  14. Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants

    Directory of Open Access Journals (Sweden)

    Alexandra Bächtold

    2013-12-01

    Full Text Available Predatory behavior of Pseudodorus clavatus (Diptera, Syrphidae on aphids tended by ants. In this study, we examined the interactions between myrmecophilous aphids, their ant-guards and a predatory syrphid species, Pseudodorus clavatus (F.. Larvae of this predator were found in the colonies of three aphid species: Aphis gossypii, A. spiraecola and Toxoptera sp., which were tended by eight ant species, especially Camponotus. Hoverfly larvae managed to infiltrate the aphid colonies and consume nymphs. Predator larvae exhibited inconspicuous movements and were not detected by ants which were commonly observed touching and antennating the larvae they come into contact. These results suggest that behavioral and chemical cues are involved in the infiltration and on the successful predation of syrphids upon aphids.

  15. Occurrence, Distribution and Properties of Alfalfa Mosaic Virus

    Directory of Open Access Journals (Sweden)

    A.D. Zadjaii

    2002-01-01

    Full Text Available Alfalfa Mosaic Virus (AlflMV was recorded on 21 hosts comprising of four field crops, 14 vegetables, one ornamental plant and two new weed species (Heliotropium europaeum and Ammi majus belonging to nine families. The virus was identified and confirmed on the basis of its biological, serological (ELISA and physical properties. The leaves, stem and crown from systemically infected alfalfa plant contained high concentration of the virus. It was nonpersistently transmitted by cotton aphids (Aphis gossypii. The wide host range, including virus reservoirs, seed-borne infection and insect transmission account for high incidence and distribution of AlfMV in the country. The virus isolate had a dilution end point between 1 x 10-3 to l x 10-4, 65-67 °C thermal inactivation point and a few days in-vitro longevity and appears to be similar to the AlfMV-S strain.

  16. Activity of aphids associated with lettuce and broccoli in Spain and their efficiency as vectors of Lettuce mosaic virus.

    Science.gov (United States)

    Nebreda, M; Moreno, A; Pérez, N; Palacios, I; Seco-Fernández, V; Fereres, A

    2004-03-01

    This research sought to identify the aphid virus vector species associated with lettuce and broccoli crops in Spain, and to determine their population dynamics and ability to transmit Lettuce mosaic virus (LMV). Green tile traps and Moericke yellow water-pan traps were used to monitor aphid flights during the spring and autumn growing seasons of 2001. Aphid species feeding on lettuce were counted weekly. The transmission efficiencies of LMV were determined for the aphid species caught most frequently. The Moericke traps generally caught more aphid species than the tile trap, but the latter was the most suitable to estimate flight activity of species involved in virus spread. Spring aphid catches indicated that the main aphid species landing on lettuce in the regions of Madrid and Murcia was Hyperomyzus lactucae, but Brachycaudus helichrysi was also abundant in both regions. In broccoli in the Navarra region, the most abundant species in spring were Aphis fabae, B. helichrysi and H. lactucae. In autumn-sown crops, the main species landing on lettuce in the Madrid region were Hyadaphis coriandri and Aphis spiraecola. In Murcia, A. spiraecola and Myzus persicae were the most abundant, while in Navarra, Therioaphis trifolii, and various Aphis spp. were the most numerous landing on broccoli. The main aphid species colonising lettuce was Nasonovia ribisnigri, but other less abundant colonising species were Aulacorthum solani and Macrosiphum euphorbiae. The most efficient vectors of LMV were M. persicae, Aphis gossypii and M. euphorbiae, while A. fabae and H. lactucae transmitted with low efficiency, and Rhopalosiphum padi and N. ribisnigri did not transmit. Occurrence of LMV epidemics in central Spain in relation to aphid flights and the role of weeds as virus reservoirs is discussed.

  17. Characteristics of Watermelon Mosaic Virus Transmission Occurring in Korean Ginseng

    Directory of Open Access Journals (Sweden)

    Seung-Kook Choi

    2014-09-01

    Full Text Available Korean ginseng (Panax ginseng is the most popular herb for medical purpose in Korea. Recently, viral diseases from Korean ginseng showing various degrees of severe mottling, variegation and mosaic symptoms have caused quantity losses of Korean ginseng in a large number of farms. Watermelon mosaic virus (named WMVgin was identified as a causal agent for the disease of Korean ginseng. Interestingly, WMV-gin failed to infect both Korean ginseng plant and susceptible host species including cucurbitaceous plants by mechanical inoculation. However, WMV-gin could successfully infect Korean ginseng by transmission of two aphid species (Myzus persicae and Aphis gossypii. It is likely that transmission of WMV-gin was done by both the aphid species during feeding behavior of the two aphid species on Korean ginseng, though the aphids dislike feeding in Korea ginseng. Similarly, a strain of WMV (WMV-wm isolated from watermelon was transmitted successfully to Korean ginseng plant by the two aphid species, but not by mechanical inoculations. Transmission assays using M. persicae and A. gossypii clearly showed both WMV-gin and WMV-wm were not transmitted from infected Korean ginseng plant to cucurbit species that are good host species for WMV. These results suggest WMV disease occurring in Korean ginseng plant can be controlled by ecological approaches.

  18. miRNA-mediated auxin signalling repression during Vat-mediated aphid resistance in Cucumis melo.

    Science.gov (United States)

    Sattar, Sampurna; Addo-Quaye, Charles; Thompson, Gary A

    2016-06-01

    Resistance to Aphis gossypii in melon is attributed to the presence of the single dominant R gene virus aphid transmission (Vat), which is biologically expressed as antibiosis, antixenosis and tolerance. However, the mechanism of resistance is poorly understood at the molecular level. Aphid-induced transcriptional changes, including differentially expressed miRNA profiles that correspond to resistance interaction have been reported in melon. The potential regulatory roles of miRNAs in Vat-mediated aphid resistance were further revealed by identifying the specific miRNA degradation targets. A total of 70 miRNA:target pairs, including 28 novel miRNA:target pairs, for the differentially expressed miRNAs were identified: 11 were associated with phytohormone regulation, including six miRNAs that potentially regulate auxin interactions. A model for a redundant regulatory system of miRNA-mediated auxin insensitivity is proposed that incorporates auxin perception, auxin modification and auxin-regulated transcription. Chemically inhibiting the transport inhibitor response-1 (TIR-1) auxin receptor in susceptible melon tissues provides in vivo support for the model of auxin-mediated impacts on A. gossypii resistance. © 2016 John Wiley & Sons Ltd.

  19. The Animal and Plant Health Inspection Service (APHIS) brucellosis eradication program in the United States.

    Science.gov (United States)

    Ragan, Valerie E

    2002-12-20

    Efforts to eradicate brucellosis caused by Brucella abortus in the United States began in 1934 as part of an economic recovery program to reduce the cattle population because of the Great Depression and concurrent severe drought conditions. A number of states saw this as an opportunity to reduce the level of brucellosis, which was the most significant livestock disease problem in the US at the time. In 1934 and 1935, the reactor rate in adult cattle tested was 11.5%. In 1954, the magnitude of the brucellosis problem in the United States in terms of economics to the cattle industry and human health prompted Congress to appropriate funds for a comprehensive national effort to eradicate brucellosis. The brucellosis eradication program was designed as a cooperative effort between the federal government, the states, and livestock producers. As the science and technology of brucellosis has developed over the years through research and experience, the eradication program has been modified many times. As of 31 December 2000, there were no affected cattle herds in the United States. This was the first time in the history of the brucellosis program that the United States had no known brucellosis affected herds. However, brucellosis has a variable, sometimes quite lengthy incubation period, so it is expected that additional affected herds will be disclosed. It is likely that additional affected herds will be disclosed before brucellosis is finally eradicated from cattle. Animal health officials remain prepared to aggressively pursue any newly disclosed affected herds to eliminate the disease as quickly as possible. The State-Federal Brucellosis Eradication Program has made tremendous progress since its inception. In an eradication program, it is critically important to recognize that, despite all the tools that are available to eliminate the disease, an effective surveillance system is the critical first step that must be in place in order to be successful. It is imperative, not only to be able to find the disease and eliminate it, but to find it before it spreads to susceptible herds. When brucellosis can be identified, contained, and eliminated before spread occurs, eradication can be achieved. Copyright 2002 Elsevier Science B.V.

  20. Assessment of PAtient Doses During mAmmogrAPhy PrActice At ...

    African Journals Online (AJOL)

    2011-11-11

    Nov 11, 2011 ... of Physics and Applied Physics, University of Massachusetts Lowell, One University Avenue, Lowell, MA 01854, M. N.. Shyanguya, Bwonya, Dip. RAD(D) HND (U/S), Deputy Chief ... of this technology is low in developing countries due to the exorbitant costs of therapy and late stage of disease presentation.

  1. Presence of the aphid, Chaetosiphon fragaefolii, on strawberry in Argentina.

    Science.gov (United States)

    Cédola, Claudia; Grecob, Nancy

    2010-01-01

    Seasonal abundance of the strawberry aphid complex under different agronomic practices in the outskirts of La Plata, Argentina was studied on strawberry, Fragaria x ananassa Duchesne (Rosales: Rosaceae). Aphid densities were low in strawberry fields in which insecticides and fungicides were used. In addition to Aphis gossypii, Aphis fabae, Mysus persicae and Macrosiphum euphorbiae, the aphid, Chaetosiphon fragaefolii (Cockerell) (Homoptera: Aphididae), was recorded for the first time in this horticultural area. Life history and some demographic parameters were calculated for C. fragaefolii. The mean duration of nymphal stages was 10.44 days, the oviposition period was 11.8 days, and the mean number of nymph/female/day was 2.4 +/- 0.3. Demographic parameters analyzed included the net reproductive rate R(o) = 14.55 +/- 0.096 nymph/female, generation time T=16.91 +/- 0.035 days, and the intrinsic rate of increase r(m) = 0.158 +/- (0.004). No parasites were found associated with C. fragaefolli. The pathogenic fungus, Entomophthora planchoniana Cornu (Zygomycetes: Entomophthorales) was the main mortality factor. Although aphids are not the main pests in strawberry fields, C. fragaefolii can be a serious problem because it can transmit several virus diseases of strawberry. Greater knowledge of life history traits and mortality factors of this species is needed in order to design appropriate control strategies.

  2. Biological and behavior aspects of Chrysoperla externa (Hagen, 1861 on cotton plantsAspectos biológicos e comportamentais de Chrysoperla externa (Hagen, 1861 em algodoeiro

    Directory of Open Access Journals (Sweden)

    Luciano Pacelli Medeiros Macedo

    2010-02-01

    Full Text Available It was aimed to study biological and behavior aspects of larvae and adults of Chrysoperla externa in greenhouse, on cotton plants. Recently hatched larvae were released on the upper third of cotton plants, which were previously infested with Aphis gossypii,. After emergence, adults were separated by sex and packed in cylindrical PVC recipients with cotton plant. We evaluated the duration of each larval, pre-pupal and pupal periods, pre-oviposition, oviposition, effective oviposition and post-oviposition periods, male and female logevity, daily and total oviposition capacity. The behavior of pupal stage was also evaluated, which released three larvae of the 3rd instar per cotton plant and they were put on the lower, medium and upper sections. As treatments, it was used naked soil, dried leaves from cotton plant, crushed rock nº 1; and crushed rock nº 1 + dried leaves. Larvae from different instars were released on the upper section of the cotton plants infested with A. gossypii to verify the search timing that marked the period the prey was exposed to the predator. C. externa larvae passed through all the phases of their biological cycle and there was no significant influence on the type of the soil covering used on pupal stage, since all of them were significantly higher on naked soil. There was no significative difference on the prey search by C. externa larvae.Objetivou-se estudar aspectos biológicos e comportamentais de larvas e adultos de Chrysoperla externa em casa-de-vegetação, em plantas de algodão. Larvas recém eclodidas foram liberadas no terço superior de plantas de algodão previamente infestadas com Aphis gossypii, onde permaneceram até a pupação. Após a emergência, adultos foram separados por sexo, acondicionados em recipientes cilíndricos de PVC contendo uma planta de algodoeiro. Avaliaram-se a duração de cada ínstar, dos períodos larval, pré-pupal e pupal, dos períodos de pré-oviposição, oviposi

  3. Rapid detection of vip1-type genes from Bacillus cereus and characterization of a novel vip binary toxin gene.

    Science.gov (United States)

    Yu, Xiumei; Liu, Tao; Liang, Xiaoxing; Tang, Changqing; Zhu, Jun; Wang, Shiquan; Li, Shuangcheng; Deng, Qiming; Wang, Linxia; Zheng, Aiping; Li, Ping

    2011-12-01

    A PCR-restriction fragment length polymorphism (PCR-RFLP) method for identifying vegetative insecticidal protein (vip) 1-type genes from Bacillus cereus was developed by designing specific primers based on the conserved regions of the genes to amplify vip1-type gene fragments. PCR products were digested with endonuclease AciI, and four known vip1-type genes were identified. Vip1Ac and vip1Aa-type genes appeared in 17 of 26 B. cereus strains. A novel vip1-type gene, vip1Ac1, was identified from B. cereus strain HL12. The vip1Ac1 and vip2Ae3 genes were co-expressed in Escherichia coli strain BL21 by vector pCOLADuet-1. The binary toxin showed activity only against Aphis gossypii (Homoptera), but not for Coleptera (Tenebrio molitor, Holotrichia oblita), Lepidoptera (Spodoptera exigua, Helicoverpa armigera, and Chilo suppressalis), Diptera (Culex quinquefasciatus). The LC(50) of this binary toxin for A. gossypii is 87.5 (34.2-145.3) ng mL(-1) . This is probably only the second report that Vip1 and Vip2 binary toxin shows toxicity against homopteran pests. The PCR-RFLP method developed could be very useful for identifying novel Vip1-Vip2-type binary toxins, and the novel binary toxins, Vip1Ac1 and Vip2Ae3, identified in this study may have applications in biological control of insects, thus avoiding potential problems of resistance. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  4. The tri-trophic interactions hypothesis: interactive effects of host plant quality, diet breadth and natural enemies on herbivores.

    Directory of Open Access Journals (Sweden)

    Kailen A Mooney

    Full Text Available Several influential hypotheses in plant-herbivore and herbivore-predator interactions consider the interactive effects of plant quality, herbivore diet breadth, and predation on herbivore performance. Yet individually and collectively, these hypotheses fail to address the simultaneous influence of all three factors. Here we review existing hypotheses, and propose the tri-trophic interactions (TTI hypothesis to consolidate and integrate their predictions. The TTI hypothesis predicts that dietary specialist herbivores (as compared to generalists should escape predators and be competitively dominant due to faster growth rates, and that such differences should be greater on low quality (as compared to high quality host plants. To provide a preliminary test of these predictions, we conducted an empirical study comparing the effects of plant (Baccharis salicifolia quality and predators between a specialist (Uroleucon macolai and a generalist (Aphis gossypii aphid herbivore. Consistent with predictions, these three factors interactively determine herbivore performance in ways not addressed by existing hypotheses. Compared to the specialist, the generalist was less fecund, competitively inferior, and more sensitive to low plant quality. Correspondingly, predator effects were contingent upon plant quality only for the generalist. Contrary to predictions, predator effects were weaker for the generalist and on low-quality plants, likely due to density-dependent benefits provided to the generalist by mutualist ants. Because the TTI hypothesis predicts the superior performance of specialists, mutualist ants may be critical to A. gossypii persistence under competition from U. macolai. In summary, the integrative nature of the TTI hypothesis offers novel insight into the determinants of plant-herbivore and herbivore-predator interactions and the coexistence of specialist and generalist herbivores.

  5. Ultrastructure of compatible and incompatible interactions in phloem sieve elements during the stylet penetration by cotton aphids in melon.

    Science.gov (United States)

    Garzo, Elisa; Fernández-Pascual, Mercedes; Morcillo, Cesar; Fereres, Alberto; Gómez-Guillamón, M Luisa; Tjallingii, W Fred

    2017-02-18

    Resistance of the melon line TGR-1551 to the aphid Aphis gossypii is based on preventing aphids from ingesting phloem sap. In electrical penetration graphs (EPGs), this resistance has been characterized with A. gossypii showing unusually long phloem salivation periods (waveform E1) mostly followed by pathway activities (waveform C) or if followed by phloem ingestion (waveform E2), ingestion was not sustained for more than 10 min. Stylectomy with aphids on susceptible and resistant plants was performed during EPG recording while the stylet tips were phloem inserted. This was followed by dissection of the penetrated leaf section, plant tissue fixation, resin embedding, and ultrathin sectioning for transmission electron microscopic observation in order to study the resistance mechanism in the TGR. The most obvious aspect appeared to be the coagulation of phloem proteins inside the stylet canals and the punctured sieve elements. Stylets of 5 aphids per genotype were amputated during sieve element (SE) salivation (E1) and SE ingestion (E2). Cross-sections of stylet bundles in susceptible melon plants showed that the contents of the stylet canals were totally clear and also, no coagulated phloem proteins occurred in their punctured sieve elements. In contrast, electron-dense coagulations were found in both locations in the resistant plants. Due to calcium binding, aphid saliva has been hypothesized to play an essential role in preventing/suppressing such coagulations that cause occlusion of sieves plate and in the food canal of the aphid's stylets. Doubts about this role of E1 salivation are discussed on the basis of our results. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  6. Traits underlying community consequences of plant intra-specific diversity.

    Directory of Open Access Journals (Sweden)

    Luis Abdala-Roberts

    Full Text Available A plant's performance and interactions with other trophic levels are recorgnized to be contingent upon plant diversity and underlying associational dynamics, but far less is known about the plant traits driving such phenomena. We manipulated diversity in plant traits using pairs of plant and a substitutive design to elucidate the mechanisms underlying diversity effects operating at a fine spatial scale. Specifically, we measured the effects of diversity in sex (sexual monocultures vs. male and female genotypes together and growth rate (growth rate monocultures vs. fast- and slow-growing genotypes together on growth of the shrub Baccharis salicifolia and on above- and belowground consumers associated with this plant. We compared effects on associate abundance (# associates per plant vs. density (# associates per kg plant biomass to elucidate the mechanisms underlying diversity effects; effects on abundance but not density suggest diversity effects are mediated by resource abundance (i.e. plant biomass alone, whereas effects on density suggest diversity effects are mediated by plant-based heterogeneity or quality. Sexual diversity increased root growth but reduced the density (but not abundance of the dietary generalist aphid Aphis gossypii and its associated aphid-tending ants, suggesting sex mixtures were of lower quality to this herbivore (e.g. via reduced plant quality, and that this effect indirectly influenced ants. Sexual diversity had no effect on the abundance or density of parasitoids attacking A. gossypii, the dietary specialist aphid Uroleucon macolai, or mycorrhizae. In contrast, growth rate diversity did not influence plant growth or any associates except for the dietary specialist aphid U. macolai, which increased in both abundance and density at high diversity, suggesting growth rate mixtures were of higher quality to this herbivore. These results highlight that plant associational and diversity effects on consumers are contingent

  7. What do spring migrants reveal about sex and host selection in the melon aphid?

    Directory of Open Access Journals (Sweden)

    Thomas Sophie

    2012-04-01

    Full Text Available Abstract Background Host plants exert considerable selective pressure on aphids because the plants constitute their feeding, mating and oviposition sites. Therefore, host specialisation in aphids evolves through selection of the behavioural and chemical mechanisms of host-plant location and recognition, and through metabolic adaptation to the phloem content of the host plant. How these adaptive traits evolve in an aphid species depends on the complexity of the annual life cycle of that species. The purpose of this field study was to determine how winged spring-migrant populations contribute to the evolution and maintenance of host specialisation in Aphis gossypii through host-plant choice and acceptance. We also assessed whether host-specialised genotypes corresponded exclusively to anholocyclic lineages regardless of the environmental conditions. Results The spring populations of cotton-melon aphids visiting newly planted melon crops exhibited an unexpectedly high level of genetic diversity that contrasted with the very low diversity characterising the host-specialised populations of this aphid species. This study illustrated in natura host-plant-selection pressure by showing the great differences in genetic diversity between the spring-migrant populations (alate aphids and the melon-infesting populations (the apterous offspring of the alate aphids. Moreover, an analysis of the genetic composition of these alate and apterous populations in four geographic regions suggested differences in life-history strategies, such as host choice and reproductive mode, and questioned the common assertion that A. gossypii is an anholocyclic species throughout its distribution area, including Europe. Conclusions Our results clearly demonstrate that the melon plant acts as a selective filter against the reproduction of non-specialised individuals. We showed that olfactory cues are unlikely to be decisive in natura for host recognition by spring-migrant aphid

  8. The effect of insecticide applications to melon crop on melon aphid and its natural enemies

    International Nuclear Information System (INIS)

    Guerra, J.; Gonzalez, J.E.; Ceballos, J.; Checa, B.

    1999-01-01

    Melons are an important export crop for Panama and are cultivated on more than 1000 ha of land. Long growing season, extending well into January, allows several generations and build up of heavy populations of an important insect pest, Aphis gossypii, the melon aphid. Growers find it difficult to cultivate melons without several applications of insecticides. Although the insecticide applications control the aphids, they may also have adverse effects on the natural enemies of the aphid, in particular the two predatory insects Cycloneda sanguinea and Chrysoperla carnea. The purpose of this research was to evaluate the impact of insecticide applications on these insects and on the yield of melons, and to estimate residues of the applied insecticides in soil. The insecticides were applied as four different type of treatments to melon crop. The treatments were (i) three periodic applications of endosulfan (Thiodan 35EC), each at 0.52 kg a.i./ha, (ii) three applications of fenitrothion (Sumithion 50WP), each at 0.35 kg a.i./ha, (iii) two applications of fenitrothion and one of endosulfan, and (iv) grower's treatment, which included applications of six different insecticides. The effect of the insecticide applications was evaluated by estimating numbers of each of the three type of insects before and within 72 hours after the applications and estimating yield of melons. All insecticide treatments reduced the populations of Aphis gossypii, but they also reduced the numbers of the benificial insects. Endosulfan was somewhat less toxic to C. carnea than the other insecticides were, since greater number of C. carnea were recorded from the plots treated with endosulfan than the other treated plots. The best yield of melons was recorded in the plots which were sprayed with fenitrothion, followed by the plots sprayed with endosulfan. and then those with grower's insecticides. Soon after the application of endosulfan the residue in the soil was 0.2 mg/kg, but it declined to less

  9. Formation of Stylet Sheaths in āere (in air from eight species of phytophagous hemipterans from six families (Suborders: Auchenorrhyncha and Sternorrhyncha.

    Directory of Open Access Journals (Sweden)

    J Kent Morgan

    Full Text Available Stylet sheath formation is a common feature among phytophagous hemipterans. These sheaths are considered essential to promote a successful feeding event. Stylet sheath compositions are largely unknown and their mode of solidification remains to be elucidated. This report demonstrates the formation and solidification of in āere (in air produced stylet sheaths by six hemipteran families: Diaphorina citri (Psyllidae, Asian citrus psyllid, Aphis nerii (Aphididae, oleander/milkweed aphid, Toxoptera citricida (Aphididae, brown citrus aphid, Aphis gossypii (Aphididae, cotton melon aphid, Bemisia tabaci biotype B (Aleyrodidae, whitefly, Homalodisca vitripennis (Cicadellidae, glassy-winged sharpshooter, Ferrisia virgata (Pseudococcidae, striped mealybug, and Protopulvinaria pyriformis (Coccidae, pyriform scale. Examination of in āere produced stylet sheaths by confocal and scanning electron microscopy shows a common morphology of an initial flange laid down on the surface of the membrane followed by continuous hollow core structures with sequentially stacked hardened bulbous droplets. Single and multi-branched sheaths were common, whereas mealybug and scale insects typically produced multi-branched sheaths. Micrographs of the in āere formed flanges indicate flange sealing upon stylet bundle extraction in D. citri and the aphids, while the B. tabaci whitefly and H. vitripennis glassy-winged sharpshooter flanges remain unsealed. Structural similarity of in āere sheaths are apparent in stylet sheaths formed in planta, in artificial diets, or in water. The use of 'Solvy', a dissolvable membrane, for intact stylet sheath isolation is reported. These observations illustrate for the first time this mode of stylet sheath synthesis adding to the understanding of stylet sheath formation in phytophagous hemipterans and providing tools for future use in structural and compositional analysis.

  10. ORF Alignment: NC_005785 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gossypii ATCC 10895] ref|NP_983966.1| ADL130Wp ... [Eremothecium gossypii] ... Length = 150 ... Query: 59 ... EGPLGSASME...LPDFVSLDHDAASGQVAVTVHDAANKSQRAMWGTVRSTLGSHVQGVNEGH 118 ... EGPLGSASMELPDFVSLDHDAA...SGQVAVTVHDAANKSQRAMWGTVRSTLGSHVQGVNEGH Sbjct: 1 ... EGPLGSASMELPDFVSLDHDAASGQVAVTVH

  11. ORF Alignment: NC_005788 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 286 ESYQTKRQRLMKQLKENYAGHTAFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS 345 ... ESYQTKRQRLMKQLKENYAGHT...AFCVTALDEICWFLNIRGSDVEYNPVFYAYFVIHQDSS Sbjct: 1 ... ESYQTKRQRLMKQLKENYAGHTAFCVTALDE...gossypii ATCC 10895] ref|NP_986634.1| AGL032Cp ... [Eremothecium gossypii] ... Length = 385 ... Q

  12. The mitochondrial genome of the Russian wheat aphid Diuraphis noxia: large repetitive sequences between trnE and trnF in aphids.

    Science.gov (United States)

    Zhang, Bo; Ma, Chuan; Edwards, Owain; Fuller, Susan; Kang, Le

    2014-01-01

    To characterize aphid mitochondrial genome (mitogenome) features, we sequenced the complete mitogenome of the Russian wheat aphid, Diuraphis noxia. The 15,784-bp mitogenome with a high A+T content (84.76%) and strong C skew (-0.26) was arranged in the same gene order as that of the ancestral insect. Unlike typical insect mitogenomes, D. noxia possessed a large tandem repeat region (644 bp) located between trnE and trnF. Sequencing partial mitogenome of the cotton aphid (Aphis gossypii) further confirmed the presence of the large repeat region in aphids, but with different repeat length and copy number. Another motif (58 bp) tandemly repeated 2.3 times in the control region of D. noxia. All repeat units in D. noxia could be folded into stem-loop secondary structures, which could further promote an increase in copy numbers. Characterization of the D. noxia mitogenome revealed distinct mitogenome architectures, thus advancing our understanding of insect mitogenomic diversities and evolution. © 2013 Elsevier B.V. All rights reserved.

  13. Comparative transcriptional analysis of asexual and sexual morphs reveals possible mechanisms in reproductive polyphenism of the cotton aphid.

    Directory of Open Access Journals (Sweden)

    Li-Jun Liu

    Full Text Available Aphids, the destructive insect pests in the agriculture, horticulture and forestry, are capable of reproducing asexually and sexually upon environmental change. However, the molecular basis of aphid reproductive mode switch remains an enigma. Here we report a comparative analysis of differential gene expression profiling among parthenogenetic females, gynoparae and sexual females of the cotton aphid Aphis gossypii, using the RNA-seq approach with next-generation sequencing platforms, followed by RT-qPCR. At the cutoff criteria of fold change ≥2 and P<0.01, we identified 741 up- and 879 down-regulated genes in gynoparae versus parthenogenetic females, 2,101 up- and 2,210 down-regulated genes in sexual females compared to gynoparae, and 1,614 up- and 2,238 down-regulated genes in sexual females relative to parthenogenetic females. Gene ontology category and KEGG pathway analysis suggest the involvement of differentially expressed genes in multiple cellular signaling pathways into the reproductive mode transition, including phototransduction, cuticle composition, progesterone-mediated oocyte maturation and endocrine regulation. This study forms a basis for deciphering the molecular mechanisms underlying the shift from asexual to sexual reproduction in the cotton aphid. It also provides valuable resources for future studies on this host-alternating aphid species, and the insight into the understanding of reproductive mode plasticity in different aphid species.

  14. Natural incidence of tomato viruses in the North of Iran

    Directory of Open Access Journals (Sweden)

    Alireza Mohammadi HAJIABADI

    2012-09-01

    Full Text Available A survey was conducted in Qazvin province in the North of Iran, to determine the incidence of tomato viruses including: Tobacco mosaic virus (TMV, Tomato yellow leaf curl virus (TYLCV, Tomato chlorotic spot virus (TCSV, Tomato bushy stunt virus (TBSV, Tomato spotted wilt virus (TSWV, Tomato ring spot virus (ToRSV, Tomato aspermy virus (TAV, Potato virus Y (PVY, Beet curly top virus (BCTV, and Cucumber mosaic virus (CMV. A total of 742 tomato symptomatic samples were collected during the summer of 2007 in five regions of Qazvin province (Qazvin, Takestan, Boeen-Zahra, Alborz and Abiyek and tested by enzyme-linked immunosorbent assay (ELISA. TSWV was detected in Alborz (4.4 % and Abiyek (3.57% regions but TMV and CMV were detected in all five regions. The greatest and least incidence of tomato viruses were recorded in Alborz (40.7 % and Takestan (11.1 %, respectively. The presence of these viruses was also evaluated in the weed hosts as natural sources of plant viruses. The greatest and least incidence of tomato viruses in weed hosts were recorded in Boeen-Zahra (25.6 % and Qazvin (12.8 %, respectively. TSWV was not detected in weeds. Transmission tests demonstrated that Thrips tabaci acts as TSWV carrier and Myzus persicae and Aphis gossypii were CMV carriers. Seed transmission tests were positive for TMV (13 tomato seedlings from 100 seedlings, but no TSWV transmission was observed through the seeds of infected tomato fruits.

  15. Resistance gene homologues in melon are linked to genetic loci conferring disease and pest resistance.

    Science.gov (United States)

    Brotman, Y.; Silberstein, L.; Kovalski, I.; Perin, C.; Dogimont, C.; Pitrat, M.; Klingler, J.; Thompson, A.; Perl-Treves, R.

    2002-05-01

    Genomic and cDNA fragments with homology to known disease resistance genes (RGH fragments) were cloned from Cucumis melo using degenerate-primer PCR. Fifteen homologues of the NBS-LRR gene family have been isolated. The NBS-LRR homologues show high divergence and, based on the partial NBS-fragment sequences, appear to include members of the two major subfamilies that have been described in dicot plants, one that possesses a TIR-protein element and one that lacks such a domain. Genomic organization of these sequences was explored by DNA gel-blot analysis, and conservation among other Cucurbitaceae was assessed. Two mapping populations that segregate for several disease and pest resistance loci were used to map the RGH probes onto the melon genetic map. Several NBS-LRR related sequences mapped to the vicinity of genetic loci that control resistance to papaya ringspot virus, Fusarium oxysporum race 1, F. oxysporum race 2 and to the insect pest Aphis gossypii. The utility of such markers for breeding resistant melon cultivars and for cloning the respective R-genes is discussed.

  16. Transfer of Cry1Ac and Cry2Ab proteins from genetically engineered Bt cotton to herbivores and predators.

    Science.gov (United States)

    Meissle, Michael; Romeis, Jörg

    2017-04-04

    With the cultivation of Bt cotton, the produced insecticidal Cry proteins are ingested by herbivores and potentially transferred along the food chain to natural enemies, such as predators. In laboratory experiments with Bollgard II cotton, concentrations of Cry1Ac and Cry2Ab were measured in Lepidoptera larvae (Spodoptera littoralis, Heliothis virescens), plant bugs (Euschistus heros), aphids (Aphis gossypii), whiteflies (Bemisia tabaci), thrips (Thrips tabaci, Frankliniella occidentalis), and spider mites (Tetranychus urticae). Tritrophic experiments were conducted with caterpillars of S. littoralis as prey and larvae of ladybird beetles (Harmonia axyridis, Adalia bipunctata) and lacewings (Chrysoperla carnea) as predators. Immunological measurements (ELISA) indicated that herbivores feeding on Bt cotton contained 5%-50% of the Bt protein concentrations in leaves except whiteflies and aphids, which contained no or only traces of Bt protein, and spider mites, which contained 7 times more Cry1Ac than leaves. Similarly, predators contained 1%-30% of the Cry protein concentration in prey. For the nontarget risk assessment, this indicates that Bt protein concentrations decrease considerably from one trophic level to the next in the food web, except for spider mites that contain Bt protein concentrations higher than those measured in the leaves. Exposure of phloem sucking hemipterans is negligible. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  17. Cotton fertilization using PGPR Bacillus amyloliquefaciens FZB42 and compost: Impact on insect density and cotton yield in North Benin, West Africa

    Directory of Open Access Journals (Sweden)

    Thiery B. Charles Alavo

    2015-12-01

    Full Text Available This work has compared the effects of the biofertilizer Bacillus amyloliquefaciens FZB42 with that of compost for cotton production. The population dynamics of pests and predators have been studied in order to check whether the use of both fertilization materials can contribute to pest management in cotton. Three treatments were considered: (i dressing of seeds in rhizobacteria suspension, (ii introduction of rhizobacterial suspension directly in the pocket, same time with the seeds, and (iii fertilization with compost. The study was carried out in northwest Benin (West Africa. Results showed that cotton aphids, Aphis gossypii, pink bollworm, Pectinophora gossypiella, leaf roller, Sylepta derogata, and cotton bugs, Dysdercus sp. are the major insect pests encountered in the experimental plots. Cotton bollworm, Helicoverpa armigera, was present but under the economic threshold. The coccinellid predators, Cheilomenes spp., occurred in the experimental plots and almost suppressed aphid proliferation. Other natural enemies such as chrysopids and ant species also occurred and probably contributed to maintain the cotton bollworm under the economic threshold. The treatment with seeds dressed with the rhizobacteria suspension yielded 39% more cotton compared to the compost fertilization. The use of both fertilization materials without application of chemicals can contribute to pest management in cotton.

  18. Selection of entomopathogenic fungi for aphid control.

    Science.gov (United States)

    Vu, Van Hanh; Hong, Suk Il; Kim, Keun

    2007-12-01

    Twelve strains of entomopathogenic fungi such as Lecanicillium lecanii, Paecilomyces farinosus, Beauveria bassiana, Metarhizium anisopliae, Cordyceps scarabaeicola, and Nomuraea rileyi were screened for aphid control. At 25 degrees C and 75% relative humidity (RH), among tested entomopathogenic fungi, L. lecanii 41185 showed the highest virulent pathogenicity for both Myzus persicae and Aphis gossypii, and their control values were both nearly 100% 5 and 2 d after treatment, respectively. Moreover, at an RH of 45% and in a wide temperature range (20-30 degrees C), L. lecanii 41185 also exhibited the highest virulence to M. persicae. The control value of M. persicae and the 50% lethal time (LT50) decreased significantly as the applied conidial concentration increased. The 50% lethal concentration (LC50) of the conidial suspension of this fungus was determined to be 6.55x10(5) conidia/ml. The control values of M. persicae resulting from the application of 1x10(7) and 1x10(8) conidia/ml were nearly the same and were significantly higher than that of 1x10(6) conidia/ml. The tested entomopathogenic fungi grew in a broad temperature range (15-30 degrees C). Lecanicillium strains showed optimum growth at 25 degrees C. The aerial conidia of Lecanicillium strains also could germinate in a broad temperature range (15-30 degrees C) and L. lecanii 41185 was the only strain with conidial germination at 35 degrees C.

  19. Purification and characterization of a lectin with high hemagglutination property isolated from Allium altaicum.

    Science.gov (United States)

    Upadhyay, Santosh Kumar; Saurabh, Sharad; Singh, Rahul; Rai, Preeti; Dubey, Neeraj Kumar; Chandrashekar, K; Negi, Kuldeep Singh; Tuli, Rakesh; Singh, P K

    2011-08-01

    A lectin was purified from the leaves of Allium altaicum and corresponding gene was cloned. The lectin namely Allium altaicum agglutinin (AAA) was ~24 kDa homodimeric protein and similar to a typical garlic leaf lectin. It was synthesized as 177 amino acid residues pre-proprotein, which consisted of 28 and 43 amino acid long N and C-terminal signal peptides, respectively. The plant expressed this protein more in scapes and flowers in comparison to the bulbs and leaves. Hemagglutination activity (with rabbit erythrocytes) was 1,428 fold higher as compared to Allium sativum leaf agglutinin (ASAL) although, the insecticidal activity against cotton aphid (Aphis gossypii) was relatively low. Glycan array revealed that AAA had higher affinity towards GlcAb1-3Galb as compared to ASAL. Homology analysis showed 57-94% similarity with other Allium lectins. The mature protein was expressed in E. coli as a fusion with SUMO peptide in soluble and biologically active form. Recombinant protein retained high hemagglutination activity.

  20. 78 FR 58267 - Notice of Request for Extension of Approval of an Information Collection; Requirements for...

    Science.gov (United States)

    2013-09-23

    ... Ramirez, Senior Staff Veterinarian, NCIE, APHIS, 4700 River Road Unit 40, Riverdale, MD 20737; (301) 851... carry the USDA seal and be endorsed by an authorized APHIS veterinarian. In addition, APHIS requires...

  1. Project APhiD: A Lorenz-gauged A-Φ decomposition for parallelized computation of ultra-broadband electromagnetic induction in a fully heterogeneous Earth

    Science.gov (United States)

    Weiss, Chester J.

    2013-08-01

    An essential element for computational hypothesis testing, data inversion and experiment design for electromagnetic geophysics is a robust forward solver, capable of easily and quickly evaluating the electromagnetic response of arbitrary geologic structure. The usefulness of such a solver hinges on the balance among competing desires like ease of use, speed of forward calculation, scalability to large problems or compute clusters, parsimonious use of memory access, accuracy and by necessity, the ability to faithfully accommodate a broad range of geologic scenarios over extremes in length scale and frequency content. This is indeed a tall order. The present study addresses recent progress toward the development of a forward solver with these properties. Based on the Lorenz-gauged Helmholtz decomposition, a new finite volume solution over Cartesian model domains endowed with complex-valued electrical properties is shown to be stable over the frequency range 10-2-1010 Hz and range 10-3-105 m in length scale. Benchmark examples are drawn from magnetotellurics, exploration geophysics, geotechnical mapping and laboratory-scale analysis, showing excellent agreement with reference analytic solutions. Computational efficiency is achieved through use of a matrix-free implementation of the quasi-minimum-residual (QMR) iterative solver, which eliminates explicit storage of finite volume matrix elements in favor of "on the fly" computation as needed by the iterative Krylov sequence. Further efficiency is achieved through sparse coupling matrices between the vector and scalar potentials whose non-zero elements arise only in those parts of the model domain where the conductivity gradient is non-zero. Multi-thread parallelization in the QMR solver through OpenMP pragmas is used to reduce the computational cost of its most expensive step: the single matrix-vector product at each iteration. High-level MPI communicators farm independent processes to available compute nodes for simultaneous computation of multi-frequency or multi-transmitter responses.

  2. An exponential growth model with decreasing r captures bottom-up effects on the population growth of Aphis glycines Matsumura (Hemiptera: Aphididae)

    NARCIS (Netherlands)

    Costamagna, A.C.; Werf, van der W.; Bianchi, F.J.J.A.; Landis, D.A.

    2007-01-01

    1 There is ample evidence that the life history and population dynamics of aphids are closely linked to plant phenology. Based on life table studies, it has been proposed that the growth of aphid populations could be modeled with an exponential growth model, with r decreasing linearly with time.

  3. A new species of Lysiphlebus Förster 1862 (Hymenoptera: Braconidae, Aphidiinae) attacking soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae) from China

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Rakhshani, E.; Tomanović, Ž.; Hoelmer, K.; Kavallieratos, N. G.; Yu, J.; Wang, M.; Heimpel, G. E.

    2010-01-01

    Roč. 19, č. 1 (2010), s. 179-186 ISSN 1070-9428 Grant - others:Ministry of Science and Technological Developments of the Republic of Serbia(SR) 143006B Institutional research plan: CEZ:AV0Z50070508 Keywords : Lysiphlebus orientalis sp. n. * aphid parasitoids * Glycine max Subject RIV: EG - Zoology Impact factor: 0.500, year: 2010

  4. Assessing the value and pest management window provided by neonicotinoid seed treatments for management of soybean aphid (Aphis glycines Matsumura) in the Upper Midwestern United States.

    Science.gov (United States)

    Krupke, Christian H; Alford, Adam M; Cullen, Eileen M; Hodgson, Erin W; Knodel, Janet J; McCornack, Brian; Potter, Bruce D; Spigler, Madeline I; Tilmon, Kelley; Welch, Kelton

    2017-10-01

    A 2-year, multi-state study was conducted to assess the benefits of using soybean seed treated with the neonicotinoid thiamethoxam to manage soybean aphid in the upper Midwestern USA and compare this approach with an integrated pest management (IPM) approach that included monitoring soybean aphids and treating with foliar-applied insecticide only when the economic threshold was reached. Concentrations of thiamethoxam in soybean foliage were also quantified throughout the growing season to estimate the pest management window afforded by insecticidal seed treatments. Both the IPM treatment and thiamethoxam-treated seed resulted in significant reductions in cumulative aphid days when soybean aphid populations reached threshold levels. However, only the IPM treatment resulted in significant yield increases. Analysis of soybean foliage from thiamethoxam-treated seeds indicated that tissue concentrations of thiamethoxam were statistically similar to plants grown from untreated seeds beginning at the V2 growth stage, indicating that the period of pest suppression for soybean aphid is likely to be relatively short. These data demonstrate that an IPM approach, combining scouting and foliar-applied insecticide where necessary, remains the best option for treatment of soybean aphids, both in terms of protecting the yield potential of the crop and of break-even probability for producers. Furthermore, we found that thiamethoxam concentrations in foliage are unlikely to effectively manage soybean aphids for most of the pests' activity period across the region. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  5. Evaluación de barreras vegetales en el manejo integrado de la mancha anular del papayo (PRSV-P en Michoacán, México Evaluation of plant barriers in an integrated management of papayo ringspot in Michoacan, Mexico

    Directory of Open Access Journals (Sweden)

    Patricia Rivas-Valencia

    2008-12-01

    Full Text Available El efecto de barreras vegetales como componente de un programa de manejo integrado (MI, se validó y adaptó en 1999 en Michoacán, México, para controlar la Mancha Anular del Papayo, enfermedad causada por el Papaya ringspot potyvirus type-P (PRSV-P. Se estableció un experimento en parcelas divididas con dos factores experimentales: barreras vegetales (Hibiscus sabdariffa, y componentes de MI: MI sin aspersión de citrolina (1.5% (MI-A, MI sin eliminación de plantas con síntomas iniciales de virosis antes de floración (MI-D y MI. Las barreras vegetales sembradas 20 días antes del trasplante del papayo y el desplante retrasaron en 19 días el inicio del progreso de epidemias en el MI lo que resultó en una mayor producción (14.2% que el resto de tratamientos, aunque fue superado por MI-A en vigor (4% en diámetro de tallo. La citrolina fue fitotóxica, disminuyó el vigor de plantas (5.3% y no limitó significativamente el desarrollo de la enfermedad ya que la intensidad de las epidemias (X0 = 47días, Yf = 84% y ABCPE = 3220% días fue similar al testigo. El uso de barreras vegetales por si sola aparentemente no es suficiente para la reducción de la incidencia y dispersión de la enfermedad. Los áfidos más abundantes, con reconocida capacidad transmisora del PRSV-P, fueron Aphis gossypii, A. nerii, A. spiraecola y Macrosiphum euphorbiae, los cuales representaron aproximadamente el 13% del total de áfidos capturados.The effect of plant barriers as a component of an integrated management program (IM was validated and adapted in 1999, in Michoacan, Mexico, to control papaya ringspot, caused by papaya ringspot potyvirus type-P (PRSV-P. A split-plot design was established with two experimental factors: plant barriers and components of IM: IM without oil sprinkling (IM-O, IM without plant rouging (IM-R, and complete IM. Plant barriers (Hibiscus sabdariffa, sowed 20 days before papaya transplanting, and plant rouging delayed the epidemics

  6. Interação entre inseticidas e umidade do solo no controle do pulgão e da mosca-branca em algodoeiro Interaction between insecticides and soil moisture in the control of whitefly and aphid in cotton

    Directory of Open Access Journals (Sweden)

    Jorge Braz Torres

    2008-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o controle exercido por tiametoxam e pimetrozine, em aplicação foliar ou ao solo, sobre Bemisia tabaci e Aphis gossypii, em algodoeiro, e determinar a interação entre formas de aplicação e a umidade do solo, em diferentes intervalos após a aplicação. Foram aplicados inseticidas via pulverização ou esguicho ao solo, em plantas de algodoeiro submetidas a três faixas de umidade do solo. Os inseticidas foram testados separadamente, em arranjos fatoriais, com formas de aplicação (tiametoxam, pragas (pimetrozine e teores de umidade no solo como fatores de variação, com as avaliações repetidas no tempo. Foram realizadas avaliações após 3 horas e aos 3, 6, 12, 24 e 32 dias após a aplicação. Os inseticidas, em pulverização, apresentaram controle superior a 80%, até 6 dias depois da aplicação, para mosca-branca e pulgão. O uso de tiametoxam com esguicho, na menor faixa de umidade, propiciou controle inferior a 60%, no dia da aplicação, superior a 90%, aos 3 e 6 dias, e superior a 80%, aos 12 dias após aplicação. O grau de estresse hídrico em que se encontra a planta é importante para a escolha do inseticida e da modalidade de aplicação mais adequados ao controle das pragas avaliadas.The objective of this work was to evaluate the control, in cotton plants, of Bemisia tabaci and Aphis gossypii by thiamethoxam and pymetrozine, with foliar or soil drench applications, and to determine the interaction between application method and soil humidity, in different intervals after insecticide application. Insecticide application consisted of foliar spray and soil drench, using cotton plants submitted to three levels of soil moisture. The insecticides were tested separately, in factorial arrangements, with application methods (thiamethoxam, pest species (pymetrozine and soil moisture levels, as treatments, with repeated measures on time. Evaluations were carried out after 3 hours, and at 3

  7. Vermelhão do algodoeiro Cotton "vermelhão" or anthocyanosis

    Directory of Open Access Journals (Sweden)

    A. S. Costa

    1954-01-01

    Full Text Available Uma moléstia do algodoeiro associada à infestação pelo pulgão Aphis gossypii, é descrita. É proposto que o nome vermelhão fique restrito a essa moléstia e que quando esta designação for usada em associação com outras moléstias, seja qualificada em seu emprêgo. São apontadas algumas diferenças que permitem distinguir o vermelhão do afídio de outras condições em que a coloração das fôlhas do algodoeiro é mais ou menos semelhante. Foi verificado que, quando afídios coletados de plantas com vermelhão eram alimentados em algodoeiros novos por 48 horas apenas, os sintomas da moléstia se manifestavam dentro de 12 a 30 dias. Infestações com um afídio por planta foram suficientes para reproduzir a moléstia em alguns casos ; com cinco afídios por planta conseguiu-se reproduzir a moléstia com maior freqüência ; com 25 afídios, em praticamente todos os casos. Insetos da mesma espécie, coletados de plantas de pepino, não produziram o vermelhão quando colocados sobre algodoeiros. Reprodução de vermelhão foi obtida por enxertia, passando os sintomas a se manifestar nos cavalos ; houve também perpetuação dos sintomas por enxertia em terceira reprodução vegetativa. A evidência obtida nos ensaios de reprodução da moléstia é discutida, sendo apontado que tudo indica ser um vírus a causa primária da moléstia e não toxina do inseto ou deficiência de elementos. Outras hipóteses alternativas são mencionadas.A disease associated with the infestation of cotton plants by the cotton or melon aphid, Aphis gossypii Glov. is described under the name of "vermelhão" or anthocyanosis. Symptoms of the disease resemble those resulting from magnesium deficiency. Aphids collected from diseased plants reproduced the disease when fed on cotton seedlings for 48 hours. Symptoms usually appeared from 12 to 30 days after inoculation, as chlorotic areas or spots that later turned reddish or purplish under strong light conditions

  8. Concours annuels

    Directory of Open Access Journals (Sweden)

    Royal Academy for Overseas Sciences

    2016-01-01

    Full Text Available Yearly competitions. Pour améliorer le rendement agricole, on est amené à établir des programmes de fertilisation des sols et de protection phytosanitaire souvent basés essentiellement sur l'utilisation des intrants chimiques. Cependant, l'utilisation des engrais chimiques peut entraîner la dégradation des sols et favoriser le développement des insectes ravageurs piqueurs-suceurs. Il est donc nécessaire de rechercher des méthodes de fertilisation alternatives qui permettraient de limiter la prolifération des insectes. La rhizobactérie Bacillus amyloliquefaciens est connue comme bio-fertilisant. Le présent travail vise à évaluer la dynamique des populations du puceron A. gossypii Glover sur le cotonnier en fonction du matériel de fertilisation utilisé, à savoir la souche de B. amyloliquefaciens FZB 42 et l'engrais minéral (NPKSMgB: 21-17-10-4,5-3,5-0,75. A cet effet, trois variantes ont été testées: trempage des semences dans la suspension de la rhizobactérie, application de NPKSMgB et un témoin (sans apport de fertilisant. Les résultats ont montré que les cotonniers fertilisés avec de l'engrais minéral ont de façon significative attiré plus de pucerons que les plantes fertilisées avec B. amyloliquefaciens. Sur la base de ces résultats et de données obtenues dans d'autres essais menés en plein champ qui montraient un effet positif de l'application de B. amyloliquefaciens sur le rendement du cotonnier, on peut conclure que l'utilisation de cette rhizobactérie peut constituer une solution intéressante pour la fertilisation du cotonnier.

  9. Dispersal strategies of phytophagous insects at a local scale: adaptive potential of aphids in an agricultural environment

    Directory of Open Access Journals (Sweden)

    Boll Roger

    2006-10-01

    Full Text Available Abstract Background The spread of agriculture greatly modified the selective pressures exerted by plants on phytophagous insects, by providing these insects with a high-level resource, structured in time and space. The life history, behavioural and physiological traits of some insect species may have evolved in response to these changes, allowing them to crowd on crops and to become agricultural pests. Dispersal, which is one of these traits, is a key concept in evolutionary biology but has been over-simplified in most theoretical studies. We evaluated the impact of the local-scale dispersal strategy of phytophagous insects on their fitness, using an individual-based model to simulate population dynamics and dispersal between leaves and plants, by walking and flying, of the aphid Aphis gossypii, a major agricultural pest, in a melon field. We compared the optimal values for dispersal parameters in the model with the corresponding observed values in experimental trials. Results We show that the rates of walking and flying disperser production on leaves were the most important traits determining the fitness criteria, whereas dispersal distance and the clustering of flying dispersers on the target plant had no effect. We further show that the effect of dispersal parameters on aphid fitness depended strongly on plant characteristics. Conclusion Parameters defining the dispersal strategies of aphids at a local scale are key components of the fitness of these insects and may thus be essential in the adaptation to agricultural environments that are structured in space and time. Moreover, the fact that the effect of dispersal parameters on aphid fitness depends strongly on plant characteristics suggests that traits defining aphid dispersal strategies may be a cornerstone of host-plant specialization.

  10. Influence of intraguild predation among generalist insect predators on the suppression of an herbivore population.

    Science.gov (United States)

    Rosenheim, Jay A; Wilhoit, Lawrence R; Armer, Christine A

    1993-12-01

    We evaluated the influence of intraguild predation among generalist insect predators on the suppression of an herbivore, the aphid Aphis gossypii, to test the appropriateness of the simple three trophic level model proposed by Hairston, Smith, and Slobodkin (1960). We manipulated components of the predator community, including three hemipteran predators and larvae of the predatory green lacewing Chrysoperla carnea, in field enclosure/exclosure experiments to address four questions: (1) Do generalist hemipteran predators feed on C. carnea? (2) Does intraguild predation (IGP) represent a substantial source of mortality for C. carnea? (3) Do predator species act in an independent, additive manner, or do significant interactions occur? (4) Can the experimental addition of some predators result in increased densities of aphids through a trophic cascade effect? Direct observations of predation in the field demonstrated that several generalist predators consume C. carnea and other carnivorous arthropods. Severely reduced survivorship of lacewing larvae in the presence of other predators showed that IGP was a major source of mortality. Decreased survival of lacewing larvae was primarily a result of predation rather than competition. IGP created significant interactions between the influences of lacewings and either Zelus renardii or Nabis predators on aphid population suppression. Despite the fact that the trophic web was too complex to delineate distinct trophic levels within the predatory arthropod community, some trophic links were sufficiently strong to produce cascades from higher-order carnivores to the level of herbivore population dynamics: experimental addition of either Z. renardii or Nabis predators generated sufficient lacewing larval mortality in one experiment to release aphid populations from regulation by lacewing predators. We conclude that intraguild predation in this system is wide-spread and has potentially important influences on the population

  11. Rapid assessment of insect fauna based on local knowledge: comparing ecological and ethnobiological methods.

    Science.gov (United States)

    Lima, Daniele Cristina de Oliveira; Ramos, Marcelo Alves; da Silva, Henrique Costa Hermenegildo; Alves, Angelo Giuseppe Chaves

    2016-03-01

    The rapid assessment of biodiversity making use of surveys of local knowledge has been successful for different biological taxa. However, there are no reports on the testing of such tools for sampling insect fauna. The present study aimed to evaluate the efficiency of different ethnobiological techniques for rapid sampling of insect fauna. Field research for the conventional survey of insect fauna was conducted on a private farm (9 ° 43'38.95 "S, 37 ° 45'11.97" W) , where there was intensive cultivation of okra (Abelmoschus esculentus L. (Moench)). The survey of local entomological knowledge was conducted among all the producers of okra living in the rural villages Pereira, Santa Luzia, and Nassau de Souza, within the Jacaré Curituba irrigated settlement scheme. The combined use of the techniques "free list" and projective interviews was analyzed, using two types of visual stimuli: stock photos and an entomological box. During the conventional survey of insect fauna, the species Bemisia tabaci biotype B, Aphis gossypii, Phenacoccus sp., Icerya purchasi and Lagria villosa were the primary pests found in the okra crop. Regarding the survey of insect pests, the results were convergent  in both techniques (conventional sampling and free list). Comparing the interview with visual stimuli (pictures) and specimen witnesses (entomological box) revealed that the latter was more effective. Techniques based on the recording and analysis of local knowledge about insects are effective for quick sampling of pest insects, but ineffective in sampling predator insects. The utilization of collected insects, infested branches, or photos of the symptoms of damage caused by pests in projective interviews is recommended.

  12. EFFECTIVENESS OF SOME PATHOGENIC CONTROL AGENTS AGAINST PESTS IN GREENHOUSE VEGETABLE CROPS

    Directory of Open Access Journals (Sweden)

    Dima Markova

    2017-09-01

    Full Text Available Greenhouse tomato and cucumber are attacked by a great number of pests. The most frequently occurred pests are: greenhouse whitefly (Trialeurodes vaporariorum Westw., cotton aphids (Aphis gossypii Glov., tobacco and western flower thrips (Thrips tabaci Lindeman, Frankliniella occidentalis Perg., cotton bollworm (Helicoverpa armigera Hb. and two spotted spider mite (Tetranychus urticae Koch.. Plant protection products applied in practice are not always efficient enough due to arising of resistance to these products in the populations. Moreover their use could results in accumulation of residual amounts and environmental pollution. Recently a great interest to find alternative solutions for pest control is observed. Some viruses, bacteria and fungi which are pathogenic to the pests but safety for human, could be used. There are products with good efficacy, which are developed on this basis and applied for pest control. Investigations for determining of the biological activity in the following products were carried out during the period 2016-2017 in the “Maritsa” Vegetable Crops Research Institute - Plovdiv: Naturalis (a. i. Beauveria bassiana strain АТСС 74040 at a dose of 100 ml/da, Rapax (a. i. Bacillus thuringiensis subsp. kurstaki strain EG 2348 at a dose of 100 ml/da and Helicovex (a. i. Helicoverpa armigera nucleopolyhedrovirus Hear NVP, DSMZ-BV0003 – 7,5 x 1012 NPV/liter at a dose of 20 ml/da. The product Naturalis at a dose 100 ml/da has a good effectiveness (over 75% against greenhouse whitefly, cotton aphids, thrips, and movable forms of the two spotted spider mite in tomato and cucumber grown under greenhouses. The products Rapax at a dose of 100 ml/da and Helicovex at a dose of 20 ml/da have a good biological activity (E = 76,32% and E = 76,92%, respectively towards to the larvae of the cotton bollworm in greenhouse tomatoes.

  13. The impact of task constraints on the planning and control of interceptive hitting movements

    NARCIS (Netherlands)

    Caljouw, S.R.; van der Kamp, J.; Savelsbergh, G.J.P.

    2006-01-01

    On the basis of research in self-paced aiming movements, Glover [S. Glover, Separate visual representations in the planning and control of action, Behav. Brain Sci., 27 (2004) 3-24] proposed a dichotomy between visual systems that accommodate planning and on-line control of action. Specifically, the

  14. Use Google Scholar, Scopus and Web of Science for Comprehensive Citation Tracking. A review of: Bakkalbasi, Nisa, Kathleen Bauer, Janis Glover and Lei Wang. “Three Options for Citation Tracking: Google Scholar, Scopus and Web of Science.” Biomedical Digital Libraries 3.7 (2006.

    Directory of Open Access Journals (Sweden)

    Lorie A. Kloda

    2007-09-01

    Full Text Available Objective – To determine whether three competing citation tracking services result in differing citation counts for a known set of articles, and to assess the extent of any differences.Design – Citation analysis, observational study.Setting – Three citation tracking databases: Google Scholar, Scopus and Web of Science. Subjects – Citations from eleven journals each from the disciplines of oncology and condensed matter physics for the years 1993 and 2003.Methods – The researchers selected eleven journals each from the list of journals from Journal Citation Reports 2004 for the categories “Oncology” and “Condensed Matter Physics” using a systematic sampling technique to ensure journals with vary ingimpact factors were included. All references from these 22 journals were retrieved for the years 1993 and 2003 by searching three databases: Web of Science, INSPEC, and PubMed. Only research articles were included for the purpose of the study. From these, a stratified random sample was created to proportionally represent the content of each journal (oncology 1993: 234 references, 2003: 259 references; condensed matter physics 1993: 358 references, 2003: 364 references. In November of 2005, citations counts were obtained for all articles from Web of Science, Scopus and GoogleScholar. Due to the small sample size and skewed distribution of data, non‐parametric tests were conducted to determine whether significant differences existed between sets.Main Results – For 1993, mean citation counts were highest in Web of Science for both oncology (mean = 45.3, SD = 77.4 and condensed matter physics (mean = 22.5, SD= 32.5. For 2003, mean citation counts were higher in Scopus for oncology (mean = 8.9,SD = 12.0, and in Web of Science for condensed matter physics (mean = 3.0, SD =4.0. There was not enough data for the set of citations from Scopus for condensed matter physics for 1993 and it was therefore excluded from analysis. A Friedman test to measure for differences between all remaining groups suggested a significant difference existed, and so pairwise post‐hoc comparisons were performed. The Wilcoxon Signed Ranked tests demonstrated significant differences “in citation counts between all pairs (p Conclusion – The study does not confirm the authors’ hypothesis that differing scholarly coverage would result in different citation counts from the three databases. While there were significant differences in mean citation rates between all pairs of databases except for Google Scholar and Scopus in condensed matter physics for 2003, no one database performed better overall. Different databases performed better for different subjects, as well as for different years, especially Scopus, which only includes references starting in 1996. The results of this study suggest that the best citation database will depend on the years being searched as well as the subject area. For a complete picture of citation behaviour, the authors suggest all three be used.

  15. Comparative transcriptome analysis of Gossypium hirsutum L. in response to sap sucking insects: aphid and whitefly.

    Science.gov (United States)

    Dubey, Neeraj Kumar; Goel, Ridhi; Ranjan, Alok; Idris, Asif; Singh, Sunil Kumar; Bag, Sumit K; Chandrashekar, Krishnappa; Pandey, Kapil Deo; Singh, Pradhyumna Kumar; Sawant, Samir V

    2013-04-11

    Cotton (Gossypium hirsutum L.) is a major fiber crop that is grown worldwide; it faces extensive damage from sap-sucking insects, including aphids and whiteflies. Genome-wide transcriptome analysis was performed to understand the molecular details of interaction between Gossypium hirsutum L. and sap-sucking pests, namely Aphis gossypii (Aphid) and Bemisia tabacci (Whiteflies). Roche's GS-Titanium was used to sequence transcriptomes of cotton infested with aphids and whiteflies for 2 h and 24 h. A total of 100935 contigs were produced with an average length of 529 bp after an assembly in all five selected conditions. The Blastn of the non-redundant (nr) cotton EST database resulted in the identification of 580 novel contigs in the cotton plant. It should be noted that in spite of minimal physical damage caused by the sap-sucking insects, they can change the gene expression of plants in 2 h of infestation; further change in gene expression due to whiteflies is quicker than due to aphids. The impact of the whitefly 24 h after infestation was more or less similar to that of the aphid 2 h after infestation. Aphids and whiteflies affect many genes that are regulated by various phytohormones and in response to microbial infection, indicating the involvement of complex crosstalk between these pathways. The KOBAS analysis of differentially regulated transcripts in response to aphids and whiteflies indicated that both the insects induce the metabolism of amino acids biosynthesis specially in case of whiteflies infestation at later phase. Further we also observed that expression of transcript related to photosynthesis specially carbon fixation were significantly influenced by infestation of Aphids and Whiteflies. A comparison of different transcriptomes leads to the identification of differentially and temporally regulated transcripts in response to infestation by aphids and whiteflies. Most of these differentially expressed contigs were related to genes involved in biotic

  16. Identification of two acetylcholinesterases in Pardosa pseudoannulata and the sensitivity to insecticides.

    Science.gov (United States)

    Zhang, Yixi; Shao, Ying; Jiang, Feng; Li, Jian; Liu, Zewen

    2014-03-01

    Pardosa pseudoannulata is an important predatory enemy against insect pests, such as rice planthoppers and leafhoppers. In order to understand the insecticide selectivity between P. pseudoannulata and insect pests, two acetylcholinesterase genes, Pp-ace1 and Pp-ace2, were cloned from this natural enemy. The putative proteins encoded by Pp-ace1 and Pp-ace2 showed high similarities to insect AChE1 (63% to Liposcelis entomophila AChE1) and AChE2 (36% to Culex quinquefasciatus AChE2) with specific functional motifs, which indicated that two genes might encode AChE1 and AChE2 proteins respectively. The recombinant proteins by expressing Pp-ace1 and Pp-ace2 genes in insect sf9 cells showed high AChE activities. The kinetic parameters, Vmax and Km, of two recombinant AChE proteins were significantly different. The sensitivities to six insecticides were determined in two recombinant AChEs. Pp-AChE1 was more sensitive to all tested insecticides than Pp-AChE2, such as fenobucarb (54 times in Ki ratios), isoprocarb (31 times), carbaryl (13 times) and omethoate (6 times). These results indicated that Pp-AChE1 might be the major synaptic enzyme in the spider. By sequence comparison of P. pseudoannulata and insect AChEs, the key amino acid differences at or close to the functional sites were found. The locations of some key amino acid differences were consistent with the point mutation sites in insect AChEs that were associated with insecticide resistance, such as Phe331 in Pp-AChE2 corresponding to Ser331Phe mutation in Myzus persicae and Aphis gossypii AChE2, which might play important roles in insecticide selectivity between P. pseudoannulata and insect pests. Of course, the direct evidences are needed through further studies. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. 7 CFR 372.4 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE... as follows: APHIS. The Animal and Plant Health Inspection Service (APHIS). Decisionmaker. The agency..., the analytical unit in Biotechnology, Biologics, and Environmental Protection responsible for...

  18. 9 CFR 50.9 - Appraisals.

    Science.gov (United States)

    2010-01-01

    ... part must be appraised at their fair market value by an appraiser selected by APHIS. APHIS may decline... veterinarian in charge may grant a reasonable time for the presentation of their registration papers. [67 FR...

  19. Research

    African Journals Online (AJOL)

    ebutamanya

    2016-05-27

    . PubMed | Google Scholar. 24. Glover-Amengor M, Owusu W, Akanmori B. Determinants of anaemia in pregnancy in Sekyere West District, Ghana. Ghana. Medical Journal. 2005;39(3):102. PubMed | Google Scholar. 25.

  20. 76 FR 54193 - Fiscal Year 2012 Veterinary Import/Export, Diagnostic Services, and Export Certification for...

    Science.gov (United States)

    2011-08-31

    ..., FMD, APHIS, 4700 River Road, Unit 55, Riverdale, MD 20737-1231; (301) 734-0882. For information on.... Tuszynski, Director, Planning, Finance, and Strategy, VS, APHIS, 4700 River Road Unit 58, Riverdale, MD... Health Programs, PPQ, APHIS, 4700 River Road Unit 50, Riverdale, MD 20737-1231; (301) 734-8414. For...

  1. 75 FR 52505 - Fiscal Year 2011 Veterinary Import/Export Services, Veterinary Diagnostic Services, and Export...

    Science.gov (United States)

    2010-08-26

    ..., VS, APHIS, 4700 River Road Unit 39, Riverdale, MD 20737- 1231; (301) 734-0832. For information on..., Quarantine Policy, Analysis & Support, PPQ, APHIS, 4700 River Road Unit 39, Riverdale, MD 20737-1231; (301... Head, User Fees Section, Financial Services Branch, FMD, MRPBS, APHIS, 4700 River Road Unit 54...

  2. 77 FR 13258 - Biotechnology Regulatory Services; Changes Regarding the Solicitation of Public Comment for...

    Science.gov (United States)

    2012-03-06

    ...] Biotechnology Regulatory Services; Changes Regarding the Solicitation of Public Comment for Petitions for..., Chief of Staff, Biotechnology Regulatory Services, APHIS, 4700 River Road Unit 147, Riverdale, MD 20737... process changes APHIS is making to our petition process, go to http://www.aphis.usda.gov/biotechnology/pet...

  3. 9 CFR 96.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... FOREIGN ANIMAL CASINGS OFFERED FOR ENTRY INTO THE UNITED STATES § 96.1 Definitions. Administrator. The... States Department of Agriculture (APHIS or Service). Animal casings. Intestines, stomachs, esophagi, and... as sausage. APHIS representative. An individual employed by APHIS who is authorized to perform the...

  4. Aphid (Hemiptera: Aphididae) species determined on herbaceous ...

    African Journals Online (AJOL)

    This study aimed to find out the Aphidoidea species feeding on herbaceous and shrub plants of Bartýn province. As a result, total of 28 aphid species belonging to 14 genus and 4 tribes of the super family Aphidoidea were determined. Of these determined species, Aphis fabae Scopoli, Aphis farinosa J. F. Gmelin, Aphis ...

  5. ORF Alignment: NC_005786 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ossypii ATCC 10895] ref|NP_985218.1| AER362Wp ... [Eremothecium gossypii] ... Length = 115 ... Query: 54 ... RPTASIA...EFNNRYVGKLSNDEPERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNH 113 ... RPTASIAEFNNRYVGKLSNDEPE...RTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNH Sbjct: 1 ... RPTASIAEFNNRYVGKLSNDEPERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNH 60 ...

  6. Ocorrência do vírus do mosqueado do morangueiro no estado de São Paulo Occurrence of the strawberry mottle virus in São Paulo

    Directory of Open Access Journals (Sweden)

    Ana Maria B. Carvalho

    1961-01-01

    Full Text Available Verificou-se a ocorrência de estirpes do vírus do grupo denominado mosqueado («strawberry mottle» em plantações de morangueiro no Estado de São Paulo. Variedades antigas, como a Dr. Morère. acham-se totalmente infetatas. sendo portadoras sem sintomas. Alguns clones novos plantados apenas por poucos anos em campo, já se acham parcialmente infetados, indicando que há transmissão da moléstia sob condições naturais. Sintomas de palidez das nervuras, mosqueado, paralisação no crescimento e encrespamento são apresentados por plantas de Fragaria vesca infetadas pelos vírus dêsse grupo. Numerosas espécies de plantas-teste habituais foram inoculadas com diferentes isolados do vírus, por meio do vetor, mas os resultados foram geralmente negativos. Afídios virulíferos, colonizados sôbre plantas novas de Cassia accidentalis, Chenopodiam quinoa, Leonotis nepaetifolia e Leonurus sibiricus. induziram o aparecimento de sintomas. Não se conseguiu retransmitir o vírus dessas espécies para F. vesca, existindo, portanto, dúvidas sôbre a verdadeira identidade do vírus que infetava tais plantas. O vírus do mosqueado não foi aparentemente transmitido pela semente. Também não se mostrou transmissível mecânicamente para Frogaria vesca. O virus obtido por inoculação com o vetor em Chenopodium quinoa e que se supõe ser o do mosqueado, pôde se transmitido mecânicamente de C. quinoa para C. quinoa. mas não para F. vesca. O pulgão Pentatrichopus fragaefolii mostrou-se eficiente vetor do mosqueado, conseguindo-se obter em média mais de 50% de infecção em infestações com 1 afidio por planta. Aphis gossypii também transmitiu o vírus do mosqueado, mas com muito menor eficiência. Não se conseguiu transmitir o mosqueado com uma espécie de Cuscuta que ocorre comumeute em Campinas. Em testes de transmissão por enxertia de fôlhas, os resultados foram muito fracos devido ao mau pegamento. O pulgão Pentatrichopus fragaefolii

  7. Local Purchasing of Journals is Required in Addition to a Nationally Purchased Collection to Meet the Information Needs of NHS Staff. A review of: Glover, Steven William, John Addison, Colette Gleghorn, and John Bramwell. “Journal Usage in NHS Hospitals: A Comparison Report of Total Usage at an Acute NHS Trust and a Specialist NHS Trust in the North West of England.” Health Information and Libraries Journal 24.3 (2007: 193‐9.

    Directory of Open Access Journals (Sweden)

    Jennie Kelson

    2008-03-01

    Full Text Available Objective ‐ To compare journal usage between an acute National Health Service (NHS Trust and a specialist NHS Trust located in North West England to provide some evidence as to how well the National Core Content Collection (provided by ProQuest meets the needs of staff in these settings.Design ‐ Comparative studySetting ‐ An acute NHS Trust, comprising four hospital sites, and a cancer specialist NHS Trust based on a single site. Both Trusts are located in North West England. The cancer specialist NHS Trust is a teaching hospital with undergraduate nurses, medical students, and student radiographers. This Trust is also closely associated with an adjoining cancer research institute. The acute NHS Trust has a large number of healthcare staff in training and was not described as a teaching hospital.Subjects ‐ Staff of the respective NHS Trusts. The staff numbers for each organisation were not provided.Methods ‐ COUNTER usage statistics of online journals, obtained from publisher administration tools, were collected for one year covering the period 1 December 2005 to 30 November 2006. Where available, the number of photocopies made from print journals during the same period by library users for their own use was also included. All full‐text downloads of journal articles were counted as part of this study, hence the possibility of double counting if a single article was requested in both HTML and PDF versions. Details of free or open access articles accessed without the need for a username and password were not included in the study. To encourage use of the electronic journals, library services at both Trusts implemented a number of initiatives to maximize publicity. These included direct e‐mails to staff, posters, and presentations to staff. Athens registration, required for access to the electronic journal collections, was promoted as part of the induction process for new library users. Staff members were encouraged to apply for the electronic table of contents alert for journals in their area of specialty. An A‐Z list of journals was accessible via the Trusts’ intranet and internet sites, and direct links to electronic journals were added to the NHS Dialog/Datastar databases and on PubMed.Main results ‐ The libraries at both Trusts in the study provide the majority of their journals in electronic‐only format. In addition to the National Core Content titles, the cancer specialist Trust provides access to an additional five journal collections: Science Direct Health Sciences, Blackwell Synergy Medical and Nursing collection, five journals selected from Nature Publishing Group, selected society journals via HighWire Press and Oxford University Press titles. Staff members of the acute Trust have access to an additional three journal collections: Science Direct Health Sciences, the BMJ Publishing Group (BMJPG collection and 16 LWW titles via Ovid. During the study period, a total of 93,376 articles were downloaded or copied. Of these, 47,079 articles were downloaded or copied by staff of the cancer specialist NHS Trust and 46,297 articles were downloaded or copied by staff of the acute NHS Trust. The usage of each of the journal collections during the study period for each Trust is shown in the table below with the most used resource shown in bold. (See article for table General information regarding some of the commonly used journal titles by staff of each Trust was included in the commentary, but levels of use were not enumerated. Staff of the cancer specialist NHS Trust favoured cancer‐related titles, whilst staff of the acute NHS Trust accessed journal titles over a greater range of subject areas. Details of the top titles accessed from the National Core Content collection were not provided for either Trust. A possible reason given for the lower usage level of the National Core Content collection by the cancer specialist NHS Trust compared to the acute NHS Trust was the presence of embargoes on many cancer‐related titles within the National Core Content collection. Information about training offered to staff, their level of access to computer facilities,or familiarity with accessing electronic journal collections was not provided.Conclusion ‐ Staff of both Trusts in the study recorded a high level of journal use, with a total of 93,376 articles downloaded or photocopied during the study period. There was a marked difference in the usage patterns of the National Core Content journals between the two Trusts studied with the acute NHS Trust showing a higher proportion of usage (29.9%compared with the cancer specialist Trust(4.5%. Staff members of the acute NHS Trust accessed a greater range of subject areas, while staff those at the cancer specialist NHS Trust favoured cancer related titles.The results indicated that the National Core Content collection did not meet the information needs of the specialist cancer Trust as well as it met the needs of the more generalist acute Trust. The National Core Content collection appears insufficient to meet the diverse information needs of all NHS staff. Local purchasing of journals, in addition to national level provision, is therefore required to ensure that the needs of local specialties are adequately supported.

  8. Atropine’s Effects upon the Heart and Its Systemic Output,

    Science.gov (United States)

    1986-01-01

    1968. 7. ALLEN, G.S., A.B. GLOVER, M.W McCULLOCH , M.J. RAND, and D.F STORY. Modulation by acetyl- choline of adrenergic transmission in the rabbit ear...Bethesda, Maryland: American Physiological Society, 1979, p 581-620. 208. LEWIS, R.P. and J.V. WARREN . Beneficial effect of intravenous atropine in the...1928. 347. STORY, D.E, G.S. ALLEN, A.B. GLOVER, W. HOPE, M.W. McCULLOCH , M.J. RAND, and C. SARANTOS. Modulation of adrenergic transmission by

  9. The EU needs more anticipatory funding of health and environmental research

    DEFF Research Database (Denmark)

    Hansen, Steffen Foss; Gee, David

    2014-01-01

    In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety of nanote......In recent months, there have been several attacks on the Precautionary Principle and how the principle has been used in the EU. For example, the scientific advisor to the President of the European Commission, Ann Glover, has accused Commissioners of having “crazy ideas” about the safety...

  10. Microsatellite DNA reveals population genetic differentiation among sprat (Sprattus sprattus) sampled throughout the Northeast Atlantic, including Norwegian fjords

    DEFF Research Database (Denmark)

    Glover, Kevin A.; Skaala, Øystein; Limborg, Morten

    2011-01-01

    Glover, K. A., Skaala, Ø., Limborg, M., Kvamme, C., and Torstensen, E. Microsatellite DNA reveals population genetic differentiation among sprat (Sprattus sprattus) sampled throughout the Northeast Atlantic, including Norwegian fjords. – ICES Journal of Marine Science, 68: 2145–2151. Sprat (Sprat...... display population genetic differentiation throughout the Northeast Atlantic, and there may be limited connectivity between Norwegian fjord and sea-going populations.......Glover, K. A., Skaala, Ø., Limborg, M., Kvamme, C., and Torstensen, E. Microsatellite DNA reveals population genetic differentiation among sprat (Sprattus sprattus) sampled throughout the Northeast Atlantic, including Norwegian fjords. – ICES Journal of Marine Science, 68: 2145–2151. Sprat...

  11. 77 FR 31720 - Asian Longhorned Beetle; Quarantined Areas in Massachusetts, Ohio, and New York

    Science.gov (United States)

    2012-05-30

    ... native to China, Japan, Korea, and the Isle of Hainan, is a destructive pest of hardwood trees. The ALB... to Docket No. APHIS-2012-0003, Regulatory Analysis and Development, PPD, APHIS, Station 3A-03.8, 4700... performed an initial regulatory flexibility analysis, which is summarized below, regarding the economic...

  12. 75 FR 57200 - National Poultry Improvement Plan and Auxiliary Provisions

    Science.gov (United States)

    2010-09-20

    ... 147 [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary... proposing to amend the National Poultry Improvement Plan (the Plan) and its auxiliary provisions by... Coordinator, Poultry Improvement Staff, National Poultry Improvement Plan, Veterinary Services, APHIS, USDA...

  13. 78 FR 68327 - Importation of Ovine Meat From Uruguay

    Science.gov (United States)

    2013-11-14

    ... Veterinarian, Regionalization Evaluation Services Staff, VS, APHIS, 4700 River Road Unit 38, Riverdale, MD... covered. The COOL law is enforced by USDA's Agricultural Marketing Service and Food Safety and Inspection... approximately 2 weeks are needed to ensure that APHIS and Department of Homeland Security, Bureau of Customs and...

  14. 76 FR 28414 - Notice of Request for Approval of an Information Collection; National Animal Health Monitoring...

    Science.gov (United States)

    2011-05-17

    .... APHIS-2011-0008, Regulatory Analysis and Development, PPD, APHIS, Station 3A-03.8, 4700 River Road Unit.... Reading Room: You may read any comments that we receive on this docket in our reading room. The reading...., Washington, DC. Normal reading room hours are 8 a.m. to 4:30 p.m., Monday through Friday, except holidays. To...

  15. International Illegal Trade in Wildlife: Threats and U.S. Policy

    Science.gov (United States)

    2008-05-19

    25 Animal and Plant Health Inspection Service . . . . . . . . . . . . . . . . . . . . 25 National Oceanic and...detection. However, the USDA’s Animal and Plant Health Inspection Service (APHIS) may confiscate illegal bushmeat detected at the border, if suspected...Atmospheric Administration (NOAA), the Department of Agriculture’s Animal and Plant Health Inspection Service (APHIS), and the Department of Health and Human

  16. Environmental Assessment for Aerial Application of Pesticide for Gypsy Moth Control, Andrews Air Force Base, Maryland

    Science.gov (United States)

    2008-04-01

    limited quantities by a cooperative effort of the USDA Forest Service and the Animal Plant Health Inspection Service (APHIS). The active...AFB, 2007 18 SECTION 12 - ACRONYMS AND ABBREVIATIONS AFB Air Force Base AFI Air Force Instruction APHIS Animal Plant Health Inspection Service AWS

  17. 77 FR 42256 - Notice of Request for a Revision to and Extension of Approval of an Information Collection...

    Science.gov (United States)

    2012-07-18

    ... Delivery: Send your comment to Docket No. APHIS-2012-0054, Regulatory Analysis and Development, PPD, APHIS... these programs. They are routinely used whenever specimens (such as blood, milk, tissue, or urine) from... to collect and submit specimens for laboratory analysis, and herd owners. Estimated annual number of...

  18. 77 FR 50980 - Notice of Request for a Revision to and Extension of Approval of an Information Collection...

    Science.gov (United States)

    2012-08-23

    ... State or zone status, and submission by States of an annual report to APHIS for renewal of State or zone... ;D=APHIS-2012- 0066 or in our reading room, which is located in Room 1141 of the USDA South Building, 14th Street and Independence Avenue SW., Washington, DC. Normal reading room hours are 8 a.m. to 4:30 p...

  19. 9 CFR 130.50 - Payment of user fees.

    Science.gov (United States)

    2010-01-01

    ... compliance agreement signed in accordance with this chapter, must be paid when specified in the agreement. (3... made at an APHIS office 7 or an Animal Import Center; 7 A list of APHIS offices and Animal Import..., MD 20738-1231. (2) All types of checks, including traveler's checks, drawn on a U.S. bank in U.S...

  20. No choice but to find resistance to soybean aphid biotype 4

    Science.gov (United States)

    Host plant resistance in soybean [Glycine max (L.) Merr] utilizes its natural defenses to limit soybean aphid (Aphis glycines Matsamura, SBA) injury, reducing insecticide reliance. Specific genes called Rag or Resistance to Aphis glycines are unfavorable to SBA and may suppress their development and...

  1. Host specificity of Aphelinus species collected from soybean aphid in Asia

    Science.gov (United States)

    The soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae), is native to Asia where it is an occasional pest of soybean, Glycine max (L.). Aphis glycines was found during 2000 in North America and since then has spread throughout much of the area where soybean is grown. In Asia, A. glycines ...

  2. De verspreiding van virusziekten van de aardappel (Solanum tuberosum L.) door insekten

    NARCIS (Netherlands)

    Elze, D.L.

    1927-01-01

    The object was to study the relation between virus and the transmitting insect, especially the aphids Myzus persicae Sulz., Myzus pseudosolani Theob., Macrosiphum solanifold Ashm., Aphis rhamni Fonsc. and Aphis fabae Scop. The diseases studied were leafroll, common mosaic (virus A), crinckle (virus

  3. 78 FR 32231 - Pioneer Hi-Bred International, Inc.; Availability of Plant Pest Risk Assessment, Environmental...

    Science.gov (United States)

    2013-05-29

    ...] Pioneer Hi-Bred International, Inc.; Availability of Plant Pest Risk Assessment, Environmental Assessment... has prepared a preliminary determination regarding a request from Pioneer Hi-Bred International, Inc... 340. APHIS received a petition (APHIS Petition Number 11-063-01p) from Pioneer Hi-Bred International...

  4. 77 FR 6056 - Notice of Request for Extension of Approval of an Information Collection; Requirements for...

    Science.gov (United States)

    2012-02-07

    ... to Docket No. APHIS-2011-0121, Regulatory Analysis and Development, PPD, APHIS, Station 3A-03.8, 4700... United States of animal diseases and pests. Regulations governing the importation of animals and animal... biosecurity for such movements; livestock demographics and marketing practices in the region; diagnostic...

  5. 7 CFR 371.5 - Marketing and Regulatory Programs Business Services.

    Science.gov (United States)

    2010-01-01

    ... Administration (GIPSA), and other APHIS, AMS, and GIPSA officials in the planning and formulation of MRP policies... functions for APHIS and designated functions for other MRP agencies, including finance, personnel, and... implementation of policies and procedures and to assess the accomplishments of program objectives. (4) Evaluating...

  6. 9 CFR 56.4 - Determination of indemnity amounts.

    Science.gov (United States)

    2010-01-01

    ... appraisals must show the number of birds and the value per head. (2) Indemnity for disposal of poultry... compliance agreement between the claimant, the Cooperating State Agency, and APHIS. APHIS will review claims... in § 56.5 and in the initial State response and containment plan described in § 56.10. If disposal is...

  7. 78 FR 44092 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-07-23

    ... activities, including the completion of VS forms 17-129, Fish Import Permit Application, 17-29, Application... authority. APHIS has import restrictions at title 9, parts 92 through 98, of the CFR. Sections 93.900... or treatments for the virus. Need and Use of the Information: APHIS has developed import requirements...

  8. 78 FR 4121 - Notice of Request for Revision to and Extension of Approval of an Information Collection; Cut...

    Science.gov (United States)

    2013-01-18

    ... Animal and Plant Health Inspection Service (APHIS) regulates the importation of cut flowers from certain... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2012-0111] Notice of Request for Revision to and Extension of Approval of an Information Collection; Cut Flowers...

  9. 9 CFR 95.4 - Restrictions on the importation of processed animal protein, offal, tankage, fat, glands, certain...

    Science.gov (United States)

    2010-01-01

    ... the cost for APHIS personnel to conduct one inspection. As funds from that amount are obligated, a bill for costs incurred based on official accounting records will be issued to restore the deposit to... facility must be current in paying all costs for a veterinarian of APHIS to inspect the facility (it is...

  10. 75 FR 48302 - Notice of Request for Extension of Approval of an Information Collection; Credit Account Approval...

    Science.gov (United States)

    2010-08-10

    ... services, contact Mrs. Kris Caraher, User Fees Section Head, Financial Management Division, MRBBS, APHIS... services are repeat customers who request that we bill them. We need to collect certain information to... Inspection Service [Docket No. APHIS-2010-0071] Notice of Request for Extension of Approval of an Information...

  11. 9 CFR 54.6 - Amount of indemnity payments.

    Science.gov (United States)

    2010-01-01

    ... Administrator may take into consideration the producer's purchase records and sales records for the preceding 12... transport costs, is less than the base indemnity, APHIS will pay the owner the difference. APHIS will also... public scale at his own expense, provided that the sheep may not come in contact with other sheep or...

  12. 78 FR 6227 - Importation of Fresh Apricots From Continental Spain

    Science.gov (United States)

    2013-01-30

    .... Mitigations for C. funebrana Under proposed Sec. 319.56-58(f), APHIS would require the NPPO of Spain to use.... APHIS-2011-0132] RIN 0579-AD62 Importation of Fresh Apricots From Continental Spain AGENCY: Animal and... continental Spain. As a condition of entry, fresh apricots from continental Spain would have to be produced in...

  13. 77 FR 46373 - Field Release of Aphelinus glycinis for the Biological Control of the Soybean Aphid in the...

    Science.gov (United States)

    2012-08-03

    ... of the Soybean Aphid in the Continental United States; Availability of an Environmental Assessment... for the biological control of the soybean aphid, Aphis glycines, in the continental United States. We... INFORMATION: Background The soybean aphid, Aphis glycinis, which is native to Asia, was found in North America...

  14. 78 FR 56129 - Interstate Movement of Sharwil Avocados From Hawaii

    Science.gov (United States)

    2013-09-12

    ... Sharwil avocados could stop in California first before making its way to Connecticut. APHIS agrees that... Agriculture reported that there were a total of 8,245 avocado farms in the United States, with about 76.... APHIS-2012-0008] RIN 0579-AD70 Interstate Movement of Sharwil Avocados From Hawaii AGENCY: Animal and...

  15. 78 FR 32230 - Notice of Request for Extension of Approval of an Information Collection; Federally Recognized...

    Science.gov (United States)

    2013-05-29

    ... State's plant pest containment, eradication, or exclusion program as a Federally Recognized State... Delivery: Send your comment to Docket No. APHIS-2013-0030, Regulatory Analysis and Development, PPD, APHIS... Agriculture to prohibit or restrict the importation, entry, or interstate movement of plants, plant products...

  16. 78 FR 8960 - Texas (Splenetic) Fever in Cattle

    Science.gov (United States)

    2013-02-07

    .... APHIS-2012-0069] Texas (Splenetic) Fever in Cattle AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Final rule. SUMMARY: We are amending the Texas (Splenetic) Fever regulations by updating... Fever Tick Eradication Program Manager, VS, APHIS, 4700 River Road Unit 39, Riverdale, MD 20737-1231...

  17. 76 FR 9319 - Notice of Request for Reinstatement of an Information Collection; National Animal Health...

    Science.gov (United States)

    2011-02-17

    ... information about APHIS and its programs is available on the Internet at http://www.aphis.usda.gov . FOR... feedlots; Describe the management practices in feedlots that impact product quality; Identify factors... antimicrobial usage in feedlots; and Describe biosecurity practices and capabilities in feedlots. The Feedlot...

  18. 76 FR 39812 - Scotts Miracle-Gro Co.; Regulatory Status of Kentucky Bluegrass Genetically Engineered for...

    Science.gov (United States)

    2011-07-07

    ...] Scotts Miracle-Gro Co.; Regulatory Status of Kentucky Bluegrass Genetically Engineered for Herbicide... Scotts Miracle-Gro Company seeking confirmation that their Kentucky bluegrass, which has been genetically... letter from Scotts and APHIS' response letter on the Internet at http://www.aphis.usda.gov/biotechnology...

  19. 9 CFR 11.6 - Inspection space and facility requirements.

    Science.gov (United States)

    2010-01-01

    ... Veterinarian, in which horses may be physically, thermographically, or otherwise inspected. (b) Protection from... Show Veterinarian. (c) A means to control crowds or onlookers in order that APHIS personnel may carry... APHIS Show Veterinarian. (d) An accessible, reliable, and convenient 110-volt electrical power source...

  20. 9 CFR 50.20 - Claims for payment.

    Science.gov (United States)

    2010-01-01

    .... The APHIS veterinarian in charge or the official designated by him or her will record on the claim... of the APHIS payment claim form. The veterinarian in charge or official designated by him or her will... copies of the relevant documentation for relocation of equipment to the veterinarian in charge. 1,2 3...

  1. 9 CFR 51.30 - Claims for indemnity.

    Science.gov (United States)

    2010-01-01

    ... if the claimant has submitted a complete indemnity claim form to the Veterinarian in Charge and the claim has been approved by the Veterinarian in Charge or by an APHIS representative designated by him or her. The Veterinarian in Charge or an APHIS representative designated by the Veterinarian in Charge...

  2. Polynomial Approximation Algorithms for the TSP and the QAP with a Factorial Domination Number

    DEFF Research Database (Denmark)

    Gutin, Gregory; Yeo, Anders

    2002-01-01

    Glover and Punnen (J. Oper. Res. Soc. 48 (1997) 502) asked whether there exists a polynomial time algorithm that always produces a tour which is not worse than at least n!/p(n) tours for some polynomial p(n) for every TSP instance on n cities. They conjectured that, unless P = NP, the answer to t...

  3. Modeling and Control for Microgrids

    Science.gov (United States)

    Steenis, Joel

    Traditional approaches to modeling microgrids include the behavior of each inverter operating in a particular network configuration and at a particular operating point. Such models quickly become computationally intensive for large systems. Similarly, traditional approaches to control do not use advanced methodologies and suffer from poor performance and limited operating range. In this document a linear model is derived for an inverter connected to the Thevenin equivalent of a microgrid. This model is then compared to a nonlinear simulation model and analyzed using the open and closed loop systems in both the time and frequency domains. The modeling error is quantified with emphasis on its use for controller design purposes. Control design examples are given using a Glover McFarlane controller, gain scheduled Glover McFarlane controller, and bumpless transfer controller which are compared to the standard droop control approach. These examples serve as a guide to illustrate the use of multi-variable modeling techniques in the context of robust controller design and show that gain scheduled MIMO control techniques can extend the operating range of a microgrid. A hardware implementation is used to compare constant gain droop controllers with Glover McFarlane controllers and shows a clear advantage of the Glover McFarlane approach.

  4. Black Women's Faculty Voices in New Mexico: Invisible Assets Silent No More

    Science.gov (United States)

    Woodley, Xeturah Monique

    2014-01-01

    There continues to exist a lack of Black women faculty at institutions of higher education (Moses, 1989; Collins, 1991; Gregory, 2001). Although we can see an increase in the number of research projects focused on Black women faculty there still remains a significant gap in the research (Glover, 2006; Foster-Williamson, 2002; Thomas &…

  5. A review and critical analysis of how cognitive neuroscientific investigations using dance can contribute to sport psychology

    NARCIS (Netherlands)

    Cross, E.S.; Acquah, D.; Ramsey, R.

    2014-01-01

    Whether watching Michael Jackson moonwalk or Savion Glover tap dance, it is striking how skilfully some people can move their bodies. The emerging field of cognitive neuroscience has produced important advances in understanding the control and perception of complex action. Here we outline the merits

  6. Children's Use of Allocentric Cues in Visually- and Memory-Guided Reach Space

    Science.gov (United States)

    Cordova, Alberto; Gabbard, Carl

    2012-01-01

    Theory suggests that the vision-for-perception and vision-for-action processing streams operate under very different temporal constraints (Glover, 2004; Goodale, Jackobson, & Keillor, 1994; Graham, Bradshaw, & Davis, 1998; Hu, Eagleson, & Goodale, 1999). With the present study, children and young adults were asked to estimate how far a cued target…

  7. a method for grouping sweet corn genotypes

    Indian Academy of Sciences (India)

    ity improvement and plant nutrition. I. Genetic mutations affect- ing carbohydrate properties of the maize endosperm. Qual. Plant. Mat. Veget. 13, 86–97. Holder D. G., Glover D. V. and Shannon J. C 1974 Interaction of shrunken-2 with five other carbohydrate genes in Zea mays L. endosperm. Crop Sci. 14, 643–646. Hossain ...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 351 - 400 of 488 ... Vol 8, No 2 (2011), Pneumatic reduction of intussusception in children at Korle Bu Teaching Hospital: An initial experience, Abstract. Y Boateng Mensah, H Glover-Addy, V Etwire, MB Twum, S Asiamah, W Appeadu-Mensah, AAJ Hesse. Vol 3, No 1 (2006), Post Polio Paralysis: A Clarion Call For ...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 309 ... Issue, Title. Vol 19, No 1 (2011), Calibration and Performance Testing of Sodium Iodide, NaI (Tl), Detector at the Food and Environmental Laboratory of the Radiation Protection Institute of the Ghana Atomic Energy Commission, Abstract PDF. A Faanu, G Emi-Reynolds, EO Darko, R Awudu, ET Glover, ...

  10. Molecular genetic analysis of consanguineous families with primary ...

    Indian Academy of Sciences (India)

    MUZAMMIL AHMAD KHAN

    that reduction in brain size is due to misorientation of mitotic spindle fibres, which also affects the ratio of symmetric to asymmetric cell divisions and thus, decrease the number of neuronal cells (do Carmo Avides and Glover 1999). Keywords. primary microcephaly; Pakistani families; exome sequencing; ASPM gene; ...

  11. Water Quality Criteria for 2,4-Dinitrotoluene and 2,6-Dinitrotoluene

    Science.gov (United States)

    1987-08-01

    Bestimmung der biolgischen Schadwir-kung wassergefahrdender Stoffe gegen Protozoen . Z. Wasser Abwasser .- Forsch. 11(6):210-214. Bringmann, G. and R. Kuhn...bakterienfressende sowie saprozoische protozoen . Gas- Wasserfach: Wasser/Abwasser 122(7):308-313. Burlinson, N.E. and D.J. Glover. 1977a. Photochemistry of

  12. 78 FR 46796 - Federal Acquisition Regulation; Federal Acquisition Circular 2005-69; Small Entity Compliance Guide

    Science.gov (United States)

    2013-08-01

    ... and III of the Iran Threat Reduction and Syria Human Rights Act of 2012. This final rule will not have... 2012-009 Glover. Performance. IV Repeal of Sunset for 2013-011 Jackson. Certain Protests of Task or... impose any additional requirements on small business. ] Item IV--Repeal of Sunset for Certain Protests of...

  13. African Journal of Library, Archives and Information Science - Vol 25 ...

    African Journals Online (AJOL)

    A Comparison of Cataloguing and Classification Education (CCE) in Library and Information Science in South Africa, Brazil and the USA (SOBUSA): An Overview. Dennis N. Ocholla, Lyudmila Ocholla, Hope A. Olson, Jeannette R. Glover, José Augusto Guimarães ...

  14. Indonesia's Fires and Haze : The Cost of Catastrophe (mise à jour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Indonesia's Fires and Haze : The Cost of Catastrophe (mise à jour en 2006). Couverture du livre Indonesia's Fires and Haze : The Cost of Catastrophe (mise à jour. Directeur(s):. David Glover et Timothy Jessup. Maison(s) d'édition: ISEAS, CRDI. 1 janvier 1999. ISBN : 9812300066. 160 pages. e-ISBN : 1552503321.

  15. Cloning and expression analysis of a new anther-specific gene ...

    Indian Academy of Sciences (India)

    separation of the sporogenous cells, microspore mitosis, pollen differentiation and others (Glover et al. 1988). Anther and pollen formation, and development are a critical period in the plant life cycle, which involves the precise expression of coordinated genes and a wide variety of gene interactions (Goldberg et al. 1993).

  16. Complementary Health Approaches for Smoking Cessation: What the Science Says

    Science.gov (United States)

    ... Tang R, Posner MI. Brief meditation training induces smoking reduction. Proc Natl Acad Sci USA. 2013;110(34):13971-13975. Walker N, Howe C, Glover M, et al. Cytisine versus nicotine for smoking cessation. N Engl J Med. 2014;371(25): ...

  17. Perspectives on Liberal Education: Pioneers and Pallbearers.

    Science.gov (United States)

    Watson, JoAnna M., Ed.; Stevens, Rex P., Ed.

    Nine essays on education in the humanities and the debate surrounding liberal education are presented by the faculty of Mercer University. "Liberal Education and the Christian Intellectual Tradition," by Willis B. Glover, addresses the root question of what liberal education means. In "Science as a Liberal Arts Discipline," Dan R. Quisenberry…

  18. 78 FR 43205 - Federal Acquisition Regulation; Submission for OMB Review; Bankruptcy (FAR Subpart 42.9; 52.242-13)

    Science.gov (United States)

    2013-07-19

    ... Regulation; Submission for OMB Review; Bankruptcy (FAR Subpart 42.9; 52.242-13) AGENCY: Department of Defense... approved information collection requirement concerning Bankruptcy. A notice was published in the Federal...-0108, Bankruptcy, in all correspondence. FOR FURTHER INFORMATION CONTACT: Curtis E. Glover, Sr...

  19. Flavour Compounds in Fungi

    DEFF Research Database (Denmark)

    Ravasio, Davide Antonio

    are encoded by the ARO gene family which represents a widely conserved set of genes in the Saccharomyces clade. Comparative genomic analysis revealed conservation of these genes also in the riboflavin over producer Ashbya gossypii, a closely related species belonging to the Eremothecium clade. ARO80...

  20. field evaluation of non-synthetic insecticides for the management of ...

    African Journals Online (AJOL)

    Preferred Customer

    of the variegated grasshopper, Zonocerus variegatus. (L.), caused extensive defoliation to okra plants. Effect of actellic, Bt and neem seed extract on insect population. Actellic, neem extract and Bt caused a significant. (P<0.05) reduction in the population of P. uniformis,. A. gossypii, E. similis, S. doragata, P. litura and S.

  1. 7 CFR 305.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE... matters affecting this part. APHIS. The Animal and Plant Health Inspection Service, United States... the purposes of this part: Administrator. The Administrator, Animal and Plant Health Inspection...

  2. 78 FR 72859 - Concurrence With OIE Risk Designations for Bovine Spongiform Encephalopathy

    Science.gov (United States)

    2013-12-04

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2013-0064... classifications of the following countries: Regions of negligible risk for BSE: Austria, Belgium, Brazil, Colombia....pdf (page 46). [[Page 72860

  3. Permanent Genetic Resources added to Molecular Ecology Resources Database 1 April 2010 – 31 May 2010

    NARCIS (Netherlands)

    Andree, K.; Axtner, J.; Bagley, M.J.; Govers, F.; Jacobsen, E.; Mendes, O.; Lee, van der T.A.J.

    2010-01-01

    This article documents the addition of 396 microsatellite marker loci to the Molecular Ecology Resources Database. Loci were developed for the following species: Anthocidaris crassispina, Aphis glycines, Argyrosomus regius, Astrocaryum sciophilum, Dasypus novemcinctus, Delomys sublineatus,

  4. Saving Utah's Landscape, Biocontrol of Tamarisk

    OpenAIRE

    Extension, USU

    2000-01-01

    Scientists at the Animal, Plant and Health Inspection Service (APHIS) have been working for years to determine if beetles imported from China and Kazakhstan would effectively consume tamarisk (salt cedar) in the U.S. without threatening desirable vegetation.

  5. Cumulative Index to Chemicals and to Common and Scientific Names of Species Listed in Contaminant Hazard Reviews 1 Through 34.

    Science.gov (United States)

    1999-03-01

    Apheloria kleinpeteri: 23 15. Apheloria spp.: 23 20. Aphids Black bean, Aphis fabae Various, Lipaphis erysimi, Macrosiphium gei...timidus: 29 59. Leristapuctorittata: 21 33. Lethrinus spp.: 26 25. Lettuce Common, Lactuca saliva, Lactuca spp. Sea, Ulva lactuca Leuciscus

  6. 77 FR 34041 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2012-06-08

    ..., Prime Hook National Wildlife Refuge, Development of a Comprehensive Conservation Plan, Implementation.... 20120178, Final EIS, APHIS, 00, Glyphosate-Tolerant H7-1 Sugar Beet, Request for Nonregulated Status...

  7. 76 FR 68438 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2011-11-04

    ..., Draft EIS, BLM, UT, Alton Coal Tract Lease by Application Project, The Exploration and Development of.... 20110345, Draft EIS, APHIS, 00, Glyphosate -Tolerant H7-1 Sugar Beets, Request for Nonregulated Status...

  8. 77 FR 41363 - BASF Plant Science, LP; Availability of Petition for Determination of Nonregulated Status of...

    Science.gov (United States)

    2012-07-13

    .... FOR FURTHER INFORMATION CONTACT: Dr. John Turner, Director, Environmental Risk Analysis Programs..., email: john.t.turner@aphis.usda.gov . To obtain copies of the petition, contact Ms. Cindy Eck at (301...

  9. 9 CFR 56.7 - Mortgage against poultry or eggs.

    Science.gov (United States)

    2010-01-01

    ... PATHOGENIC AVIAN INFLUENZA § 56.7 Mortgage against poultry or eggs. When poultry or eggs have been destroyed... holding a mortgage on the poultry or eggs must sign the APHIS-furnished form, consenting to the payment of...

  10. 78 FR 64908 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-10-30

    ...: Highly Pathogenic Avian Influenza, All Subtypes, and Newcastle Disease; Additional Restrictions. OMB... Inspection Service (APHIS), through its Veterinary Services (VS) Program. Highly pathogenic avian influenza... declaration or affirmation; notification of signs of disease in a recently imported bird; cooperative service...

  11. 78 FR 13308 - Monsanto Co.; Availability of Petition for Determination of Nonregulated Status of Dicamba and...

    Science.gov (United States)

    2013-02-27

    [email protected] . To obtain copies of the petition, contact Ms. Cindy Eck at (301) 851-3892, email: cynthia.a.eck@aphis.usda.gov . SUPPLEMENTARY INFORMATION: Background Under the authority of the plant pest...

  12. 77 FR 10472 - Dow AgroScience LLC; Availability of Petition, Plant Pest Risk Assessment, and Environmental...

    Science.gov (United States)

    2012-02-22

    ... petition, draft environmental assessment, or plant pest risk assessment, contact Ms. Cindy Eck at (301) 851-3892, email: cynthia.a.eck@aphis.usda.gov . SUPPLEMENTARY INFORMATION: On December 27, 2011, we...

  13. 76 FR 27303 - Monsanto Co.; Availability of Petition, Plant Pest Risk Assessment, and Environmental Assessment...

    Science.gov (United States)

    2011-05-11

    ... petition, draft environmental assessment, or plant pest risk assessment, contact Ms. Cindy Eck at (301) 734-0667, e-mail: cynthia.a.eck@aphis.usda.gov . SUPPLEMENTARY INFORMATION: Background Under the authority...

  14. 76 FR 37769 - Bayer CropScience LP; Availability of Petition, Plant Pest Risk Assessment, and Environmental...

    Science.gov (United States)

    2011-06-28

    ... petition, draft environmental assessment, or plant pest risk assessment, contact Ms. Cindy Eck at (301) 734-0667, e-mail: cynthia.a.eck@aphis.usda.gov . SUPPLEMENTARY INFORMATION: Background Under the authority...

  15. 76 FR 44503 - Availability of a Risk Analysis Evaluating the Foot-and-Mouth Disease Status of Japan

    Science.gov (United States)

    2011-07-26

    ... Inspection Service 9 CFR Part 94 [Docket No. APHIS-2010-0077] Availability of a Risk Analysis Evaluating the...: Notice of availability and request for comments. SUMMARY: We are advising the public that a risk analysis... 44504

  16. 76 FR 61251 - Tuberculosis in Cattle and Bison; State and Zone Designations; New Mexico

    Science.gov (United States)

    2011-10-04

    .... APHIS-2011-0093] Tuberculosis in Cattle and Bison; State and Zone Designations; New Mexico AGENCY...: We are amending the bovine tuberculosis regulations regarding State and zone classifications by...

  17. 75 FR 60586 - Tuberculosis in Cattle and Bison; State and Zone Designations; Minnesota

    Science.gov (United States)

    2010-10-01

    .... APHIS-2010-0097] Tuberculosis in Cattle and Bison; State and Zone Designations; Minnesota AGENCY: Animal... are amending the bovine tuberculosis regulations regarding State and zone classifications by... . FOR FURTHER INFORMATION CONTACT: Dr. Alecia Naugle, Coordinator, National Tuberculosis Eradication...

  18. 77 FR 4982 - Notice of Request for Extension of Approval of an Information Collection; Treatments for Fruits...

    Science.gov (United States)

    2012-02-01

    ..., contact Mr. David Lamb, Import Specialist, Regulatory Permits and Manuals, PPQ, APHIS, 4700 River Road... Administrator of the Animal and Plant Health Inspection Service, which administers regulations to implement the...

  19. 76 FR 78228 - Notice of Request for Extension of Approval of an Information Collection; Citrus Greening and...

    Science.gov (United States)

    2011-12-16

    .... Lynn Evans-Goldner, National Program Manager, Emergency and Domestic Programs, PPQ, APHIS, 4700 River...; (3) Enhance the quality, utility, and clarity of the information to be collected; and (4) Minimize...

  20. 78 FR 58992 - Notice of Request for Extension of Approval of an Information Collection; Citrus Canker...

    Science.gov (United States)

    2013-09-25

    ... quarantined areas, contact Ms. Lynn Evans-Goldner, National Policy Manager, PHP, PPQ, APHIS, 4700 River Road..., including the validity of the methodology and assumptions used; (3) Enhance the quality, utility, and...

  1. 78 FR 48644 - Notice of Request for Extension of Approval of an Information Collection; Plum Pox Compensation

    Science.gov (United States)

    2013-08-09

    ... plum pox compensation, contact Ms. Lynn Evans-Goldner, National Policy Manager, PHP, PPQ, APHIS, 4700... quality, utility, and clarity of the information to be collected; and (4) Minimize the burden of the...

  2. Kaolin particle films suppress many apple pests, disrupt natural enemies and promote woolly apple aphid

    NARCIS (Netherlands)

    Markó, V.; Blommers, L.H.M.; Bogya, S.; Helsen, H.H.M.

    2008-01-01

    Multiple applications of hydrophobic kaolin particle film in apple orchards suppressed numbers of blossom weevil (Anthonomus pomorum), brown leaf weevil (Phyllobius oblongus), attelabid weevil (Caenorhinus pauxillus), leafhoppers (Empoasca vitis and Zygina flammigera) and green apple aphid (Aphis

  3. 78 FR 50023 - Importation of Fresh Oranges and Tangerines From Egypt Into the United States

    Science.gov (United States)

    2013-08-16

    ... INFORMATION CONTACT: Mr. Tony Rom[aacute]n, Regulatory Policy Specialist, APHIS, PPQ, 4700 River Road Unit 156... containers, which keeps the larvae from developing further. In addition, proper containment methods described...

  4. 78 FR 51133 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-08-20

    ... Service (APHIS) the authority to promulgate regulations designed to prevent the importation, preparation... enforces regulation concerning production, packaging, labeling, and shipping of veterinary biological... Federal Regulations. The minimum standards cover among other things the food, water, and rest provided to...

  5. 7 CFR 371.1 - General statement.

    Science.gov (United States)

    2010-01-01

    ... headquartered in Washington, DC, and Riverdale, MD. The APHIS Management Team at these locations consists of the...) Deputy Administrator, Veterinary Services (VS) Deputy Administrator, Marketing and Regulatory Programs Business Services (MRPBS) Deputy Administrator, Wildlife Services (WS) Deputy Administrator, Animal Care...

  6. 75 FR 23223 - Multi-Agency Informational Meeting Concerning Compliance With the Federal Select Agent Program...

    Science.gov (United States)

    2010-05-03

    ... Select Agent Program established under the Public Health Security and Bioterrorism Preparedness and... discussed include entity registration, security risk assessments, biosafety requirements, and security... Nugget Hotel, 1100 Nugget Avenue, Sparks, NV. FOR FURTHER INFORMATION CONTACT: APHIS: Ms. Sherylyn...

  7. 78 FR 14508 - Availability of an Environmental Assessment and Finding of No Significant Impact for the Field...

    Science.gov (United States)

    2013-03-06

    ... INFORMATION: Background The soybean aphid, Aphis glycinis, which is native to Asia, was found in North America... most soybean production regions in North America, including numerous U.S. States and three Canadian...

  8. 77 FR 74787 - Notice of Availability of an Evaluation of the Swine Vesicular Disease Status of Certain Regions...

    Science.gov (United States)

    2012-12-18

    ... Evaluation Services, Sanitary Trade Issues Team, National Center for Import and Export, VS, APHIS, 4700 River... surveillance, prevention, and control measures implemented by Italy in the four Regions and two autonomous...

  9. 9 CFR 96.10 - Uncertified casings; transportation for disinfection; original shipping containers; disposition...

    Science.gov (United States)

    2010-01-01

    ... United States without certification may be forwarded in customs custody to a USDA-approved facility for disinfection under APHIS supervision and release by the United States Customs authorities, provided that...

  10. 77 FR 42256 - Notice of Request for Extension of Approval of an Information Collection; Brucellosis Program

    Science.gov (United States)

    2012-07-18

    ...] Notice of Request for Extension of Approval of an Information Collection; Brucellosis Program AGENCY... an information collection associated with the Cooperative State-Federal Brucellosis Eradication... Brucellosis Eradication Program, contact Dr. Debbi Donch, Brucellosis Program Manager, VS, APHIS, 4700 River...

  11. Link Between Deployment Factors and Parenting Stress in Navy Families

    Science.gov (United States)

    2016-04-11

    spiritual experiences and psychological well -being among US adults. Social Indicators Research, 88(2), 247-271. doi:10.1007/s11205- 007-9187-2...Psychiatric Services, 62(1), 28-34. Hamlin-Glover, D. L. (2009). Spirituality , religion , and resilience among military families (Doctoral...study was two-fold: 1) to look at parenting stress in Navy active duty fathers; and 2) to evaluate spirituality and social support in both civilian

  12. Photochemical Transformation of Munitions Constituents in Marine Waters

    Science.gov (United States)

    2012-05-01

    solutions or natural marine systems. Nitroaromatic compounds (TNT, DNT) absorb electromagnetic radiation in the ultraviolet (UV) range of 200...under the 395 nm filter as shown in Figure 5 for 2,4-DNT and 2,6-DNT. This shows that the effective wavelengths for photolysis are in the ultraviolet ...Environ. Sci. Technol. 32: 3004-3010. Burlinson, N. E., Sitzmann, M. E., Glover, D. J., Kaplan, L. A. 1979. Photochemistry of TNT and related

  13. Management of ports and maritime trade of Orissa and Andhra Pradesh during the historical period

    Digital Repository Service at National Institute of Oceanography (India)

    Tripati, S.

    Bengal as well as Assam. Similarly, Rouletted ware and Knobbed ware have been reported from Bali, Bangladesh, Java, Malaysia, Sri Lanka, Thailand and Vietnam (Schenk 2006 and Glover 1996). The occurrence of Northern Black Polished ware and silver punch... marked coins along the port and coastal sites of the east coast of India indicate the existence of coastal trade (Sila Tripati 2002). Semi- precious stone beads have even been reported from Thailand, Indonesia, Burma, Malaysia and Philippines...

  14. Filamentous Growth in Eremothecium Fungi

    DEFF Research Database (Denmark)

    Oskarsson, Therese

    The fungal kingdom encompasses a diverse group of organisms some of which have a great impact on human lives, either as domesticated benefactors or as human and crop pathogens. Using the filamentous fungus Ashbya gossypii and its close relative Eremothecium cymbalariae as model organisms, this th...... of molecular tools for E. cymbalariae to enable a faster and more efficient approach for genetic comparisons between Eremothecium genus fungi.......-regulatory activity of AgGts1, the protein could have additional actin organizing properties. In the second and third part, this thesis addresses the use of A. gossypii and its relative E. cymbalariae as model organisms for filamentous growth. A series of assays analyzed the capability of Eremothecium genus fungi...

  15. Allelopathic potential and chemical constituents of volatiles from Ageratum conyzoides under stress.

    Science.gov (United States)

    Kong, Chuihua; Hu, Fei; Xu, Xiaohua

    2002-06-01

    The allelopathic potential of Ageratum conyzoides was investigated under different environmental stress conditions, including nutrient deficiency. physical damage, 2.4-D treatment, competition with Bidens pilosa, infection with Erysiphe cichoracearum, and feeding by Aphiids gossypii. The inhibitory effects of A. conyzoides volatiles on peanut (Arachis hypogaea), redroot amaranth (Amaranthus retroflexus), cucumber (Cucumis sativus), and ryegrass (Lolium multiforum) increased when plants were grown under nutrient-deficient conditions or in competition with B. pilosa; however, there was no difference with physical damage or 2.4-D treatment. Phytoinhibitory effects decreased under fungal infection and aphid feeding. Volatiles from A. conyzoides plants infected with E. cichoracearum or exposed to A. gossypii feeding inhibited or killed fungi and insects. Precocenes and their derivatives, monoterpenes, and sesquiterpenes were the major volatile components of A. conyzoides.

  16. Filamentous Growth in Eremothecium Fungi

    DEFF Research Database (Denmark)

    Oskarsson, Therese

    , this thesis deals with some of the aspects of hyphal growth, which is an important virulence factor for pathogenic fungi infecting both humans and plants. Hyphal establishment through continuous polar growth is a complex process, requiring the careful coordination of a large subset of proteins involved...... in polarity establishment and maintenance, cytoskeleton dynamics and intracellular transport. The first part of this thesis addresses the A. gossypii Arf3 small GTPase and its GEF- and GAP regulators; Yel1 and Gts1, which has been implicated in polar growth in a wide range of organisms. We could demonstrate......-regulatory activity of AgGts1, the protein could have additional actin organizing properties. In the second and third part, this thesis addresses the use of A. gossypii and its relative E. cymbalariae as model organisms for filamentous growth. A series of assays analyzed the capability of Eremothecium genus fungi...

  17. Nuclear anarchy: asynchronous mitosis in multinucleated fungal hyphae.

    Science.gov (United States)

    Gladfelter, Amy S

    2006-12-01

    Multinucleated cells are found in diverse contexts and include filamentous fungi, developing insect embryos, skeletal muscle and metastasizing tumor cells. Some multinucleated cells such as those in muscles arise from cell fusion events, but many are formed through specialized cell cycles in which nuclear and cell division are uncoupled. Recent work in the fungus Ashbya gossypii illustrates how unique spatial and temporal regulation of conserved cell cycle regulators directs mitosis in multinucleated cells.

  18. Plant genotype shapes ant-aphid interactions: implications for community structure and indirect plant defense.

    Science.gov (United States)

    Mooney, Kailen A; Agrawal, Anurag A

    2008-06-01

    Little is known about the mechanisms by which plant genotype shapes arthropod community structure. In a field experiment, we measured the effects of milkweed (Asclepias syriaca) genotype and ants on milkweed arthropods. Populations of the ant-tended aphid Aphis asclepiadis and the untended aphid Myzocallis asclepiadis varied eight- to 18-fold among milkweed genotypes, depending on aphid species and whether ants were present. There was no milkweed effect on predatory arthropods. Ants increased Aphis abundance 59%, decreased Myzocallis abundance 52%, and decreased predator abundance 56%. Milkweed genotype indirectly influenced ants via direct effects on Aphis and Myzocallis abundance. Milkweed genotype also modified ant-aphid interactions, influencing the number of ants attracted per Aphis and Myzocallis. While ant effects on Myzocallis were consistently negative, effects on Aphis ranged from antagonistic to mutualistic among milkweed genotypes. As a consequence of milkweed effects on ant-aphid interactions, ant abundance varied 13-fold among milkweed genotypes, and monarch caterpillar survival was negatively correlated with genetic variation in ant abundance. We speculate that heritable variation in milkweed phloem sap drives these effects on aphids, ants, and caterpillars. In summary, milkweed exerts genetic control over the interactions between aphids and an ant that provides defense against foliage-feeding caterpillars.

  19. Tritrophic associations and taxonomic notes on Lysiphlebus fabarum (Marshall (Hymenoptera: Braconidae: Aphidiinae, a keystone aphid parasitoid in Iran

    Directory of Open Access Journals (Sweden)

    Rakhshani Ehsan

    2013-01-01

    Full Text Available An investigation of host associations, distribution and types of reproduction (sexual, asexual of Lysiphlebus fabarum (Marshall across 20 provinces of Iran during 2006-2011 was undertaken. The parasitoid was reared from three groups of host aphids belonging to genera Aphis and Brachycaudus, and occasional host aphid genera. Aphis craccivora Koch was the most frequent host aphid for L. fabarum on various host plants, including economically important crops. The field sex ratio generally favored females, but in some cases, only thelytokous (uniparental populations were found. In those cases, the host was always an Aphis species. Specimens reared from Brachycaudus aphids were all biparental, indicating the presence of a sibling biological species. Overall analysis of diagnostic morphological characters in the forewing indicated intra-specific variability in forewing marginal setae as well as variations in length of the R1 vein. [Projekat Ministarstva nauke Republike Srbije, br. 43001

  20. Effects of chicken anemia virus and infectious bursal disease virus in commercial chickens.

    Science.gov (United States)

    Toro, H; van Santen, V L; Hoerr, F J; Breedlove, C

    2009-03-01

    The effects of chicken anemia virus (CAV) and infectious bursal disease virus (IBDV) coinfection in commercial layer-type and meat-type (broiler) chickens with specific maternal immunity were evaluated. In addition, the broiler progeny used had been vaccinated in ovo against IBDV. Layer chickens were inoculated intramuscularly on day 3 of age with CAV and orally on day 7 of age with an IBDV standard strain (APHIS). Broiler chickens were exposed to CAV and/or an IBDV variant strain (AL2) via the drinking water on days 3 and 14 of age. Following CAV and IBDV inoculation neither mortality nor overt clinical disease was observed in any layer or broiler group. In spite of maternal immunity against both IBDV and CAV, mean hematocrits of all layer groups inoculated with CAV (CAV, CAV + APHIS) were lower than uninfected chickens. IBDV APHIS alone or in combination with CAV did not affect the layer weight gain. However, on day 30 of age and concomitantly with maternal antibody decay, bursa lymphocyte depletion became evident in CAV + APHIS-infected layer chickens. These birds (CAV + APHIS) also seroconverted to IBDV on day 35 of age. CAV persisted at low levels in the layer chickens throughout the experimental period in CAV- and CAV+APHIS-infected chickens. Similarly, infected broiler chickens did not show changes in weight gain. Compared to CAV-infected or uninfected controls, CAV+AL2- and AL2-infected broiler chickens showed significant lymphocyte depletion in the bursa as assessed both by bursal indices and histomorphometry. Broilers also seroconverted to IBDV after day 30 of age confirming that bursal lymphocyte depletion was due to IBDV resuming replication. Thymus histomorphometry revealed significant lymphocyte depletion in all infected broiler groups at 30 days of age, but only in CAV+AL2-infected broiler chickens at 41 days of age, suggesting that IBDV infection delayed repopulation of the thymus.

  1. Metaheuristics progress as real problem solvers

    CERN Document Server

    Nonobe, Koji; Yagiura, Mutsunori

    2005-01-01

    Metaheuristics: Progress as Real Problem Solvers is a peer-reviewed volume of eighteen current, cutting-edge papers by leading researchers in the field. Included are an invited paper by F. Glover and G. Kochenberger, which discusses the concept of Metaheuristic agent processes, and a tutorial paper by M.G.C. Resende and C.C. Ribeiro discussing GRASP with path-relinking. Other papers discuss problem-solving approaches to timetabling, automated planograms, elevators, space allocation, shift design, cutting stock, flexible shop scheduling, colorectal cancer and cartography. A final group of methodology papers clarify various aspects of Metaheuristics from the computational view point.

  2. 7th February 2011 - Scottish Cabinet Secretary for Education and Lifelong Learning M. Russell MSP signing the guest book with Beams Department Head P. Collier and Adviser J. Ellis

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    01-17:Scottish Cabinet Secretary for Education and Lifelong Learning M. Russell MSP signing the guest book with Beams Department Head P. Collier and Adviser J. Ellis 18-22: Teachers and Pupils signing the guest book 23-27: visiting the CERN control centre with P. Collier 28-32: visiting the LHCb underground area 33-74: visitng the ATLAS underground area Other members of the delegation: Chief Scientific Adviser to the Scottish Government and Chair in Molecular and Cell Biology at the University of Aberdeen A. Glover; Assistant Private Secretary M. Gallagher; Associate Director Institute for Gravitational Research, University of Glasgow J.Hough.

  3. Selenium in the central nervous system of the rat after exposure to L-selenomethionine

    DEFF Research Database (Denmark)

    Grønbæk, Henning; Thorlacius-Ussing, O.

    1990-01-01

    ~ek and Thorlacius-Ussing 1988). Earlier studies have correlated this selenium accumulation in the anterior pituitary to endocrine dysfunction in selenium-intoxicated animals (Jensen 1975; Glover et al. 1979). Recent results from our laboratory have demonstrated a substantial decrease in growth hormone secretion...... in the anterior pituitary of rats exposed to sodium selenite (Thorlacius-Ussing and Danscher 1985). This histochemical method demonstrates complexes of exogenous selenium and endogenous metal. In the central nervous system and the anterior pituitary, selenium is suggested to form bonds with zinc (Danscher 1984...

  4. [An unpublished contribution of Melanie Klein "On Reassurance"].

    Science.gov (United States)

    Frank, Claudia; Klein, Melanie

    2005-01-01

    Melanie Klein's unpublished paper on reassurance is presented in German translation. The author shows that it was a contribution to Glover's investigation on psychoanalytic technique in the 1930s. The paper is discussed against the background of the technical discussions conducted in London at that time (e. g. M. Schmideberg, J. Strachey) and of Klein's relevant publications. Although Klein consistently considered "correct" interpretation to be the most effective means of reassurance, she occasionally also accepted a non-interpreting approach. In this respect the paper presented here goes further than any other of her writings.

  5. The recombinant pea defensin Drr230a is active against impacting soybean and cotton pathogenic fungi from the genera Fusarium, Colletotrichum and Phakopsora.

    Science.gov (United States)

    Lacerda, Ariane Ferreira; Del Sarto, Rafael Perseghini; Silva, Marilia Santos; de Vasconcelos, Erico Augusto Rosas; Coelho, Roberta Ramos; Dos Santos, Vanessa Olinto; Godoy, Claudia Vieira; Seixas, Claudine Dinali Santos; da Silva, Maria Cristina Mattar; Grossi-de-Sa, Maria Fatima

    2016-06-01

    Plant defensins are antifungal peptides produced by the innate immune system plants developed to circumvent fungal infection. The defensin Drr230a, originally isolated from pea, has been previously shown to be active against various entomopathogenic and phytopathogenic fungi. In the present study, the activity of a yeast-expressed recombinant Drr230a protein (rDrr230a) was tested against impacting soybean and cotton fungi. First, the gene was subcloned into the yeast expression vector pPICZαA and expressed in Pichia pastoris. Resulting rDrr230a exhibited in vitro activity against fungal growth and spore germination of Fusarium tucumaniae, which causes soybean sudden death syndrome, and against Colletotrichum gossypii var. cephalosporioides, which causes cotton ramulosis. The rDrr230a IC 50 corresponding to inhibition of fungal growth of F. tucumaniae and C. gossypii var. cephalosporioides was 7.67 and 0.84 µM, respectively, demonstrating moderate activity against F. tucumaniae and high potency against C. gossypii var. cephalosporioides. Additionally, rDrr230a at 25 ng/µl (3.83 µM) resulted in 100 % inhibition of spore germination of both fungi, demonstrating that rDrr230a affects fungal development since spore germination. Moreover, rDrr230a at 3 µg/µl (460.12 µM) inhibited 100 % of in vitro spore germination of the obligatory biotrophic fungus Phakopsora pachyrhizi, which causes Asian soybean rust. Interestingly, rDrr230a substantially decreased the severity of Asian rust, as demonstrated by in planta assay. To our knowledge, this is the first report of a plant defensin active against an obligatory biotrophic phytopathogenic fungus. Results revealed the potential of rDrr230a as a candidate to be used in plant genetic engineering to control relevant cotton and soybean fungal diseases.

  6. Interactions between extrafloral nectaries, aphids and ants: are there competition effects between plant and homopteran sugar sources?

    NARCIS (Netherlands)

    Engel, V.; Fischer, M.D.; Wäckers, F.L.; Volkl, W.

    2001-01-01

    Broad bean (Vicia faba), an annual plant bearing extrafloral nectaries (EFN) at the base of the upper leaves, is regularly infested by two aphid species, Aphis fabae and Acyrthosiphon pisum. EFN and A. fabae are commonly attended by the ant, Lasius niger, while Ac. pisum usually remains uninfested.

  7. 78 FR 27853 - Asian Longhorned Beetle; Quarantined Areas in Ohio

    Science.gov (United States)

    2013-05-13

    .... Postal Mail/Commercial Delivery: Send your comment to Docket No. APHIS-2013-0004, Regulatory Analysis and... (ALB, Anoplophora glabripennis), an insect native to China, Japan, Korea, and the Isle of Hainan, is a destructive pest of hardwood trees. The ALB regulations in 7 CFR 301.51-1 through 301.51-9 (referred to below...

  8. 77 FR 3435 - General Conference Committee of the National Poultry Improvement Plan; Cancellation of Meeting

    Science.gov (United States)

    2012-01-24

    ...] General Conference Committee of the National Poultry Improvement Plan; Cancellation of Meeting AGENCY... Improvement Plan scheduled for January 25, 2012, has been canceled. FOR FURTHER INFORMATION CONTACT: Dr. C. Stephen Roney, Senior Coordinator, National Poultry Improvement Plan, VS, APHIS, 1506 Klondike Road, Suite...

  9. 75 FR 70712 - General Conference Committee of the National Poultry Improvement Plan; Reestablishment

    Science.gov (United States)

    2010-11-18

    ...] General Conference Committee of the National Poultry Improvement Plan; Reestablishment AGENCY: Animal and... Poultry Improvement Plan (Committee) for a 2-year period. The Secretary of Agriculture has determined that.... Rhorer, Senior Coordinator, National Poultry Improvement Plan, VS, APHIS, USDA, Suite 101, 1498 Klondike...

  10. 77 FR 46374 - National Poultry Improvement Plan; General Conference Committee Meeting and 41st Biennial Conference

    Science.gov (United States)

    2012-08-03

    ...] National Poultry Improvement Plan; General Conference Committee Meeting and 41st Biennial Conference AGENCY... notice of a meeting of the General Conference Committee of the National Poultry Improvement Plan (NPIP... CONTACT: Dr. C. Stephen Roney, Senior Coordinator, National Poultry Improvement Plan, VS, APHIS, 1506...

  11. 77 FR 59888 - General Conference Committee of the National Poultry Improvement Plan

    Science.gov (United States)

    2012-10-01

    ... Improvement Plan AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Notice of intent to renew... the General Conference Committee of the National Poultry Improvement Plan (Committee) for a 2year... Improvement Plan, VS, APHIS, USDA, 1506 Klondike Road, Suite 300, Conyers, GA 30094; (770) 922-3496...

  12. 76 FR 1592 - National Poultry Improvement Plan; General Conference Committee Meeting

    Science.gov (United States)

    2011-01-11

    ...] National Poultry Improvement Plan; General Conference Committee Meeting AGENCY: Animal and Plant Health... General Conference Committee of the National Poultry Improvement Plan. DATES: The General Conference... Improvement Plan, VS, APHIS, 1498 Klondike Road, Suite 101, Conyers, GA 30094-5104; (770) 922-3496...

  13. 76 FR 65935 - National Poultry Improvement Plan and Auxiliary Provisions; Correction

    Science.gov (United States)

    2011-10-25

    .... APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions; Correction... Poultry Improvement Plan (the Plan) and its auxiliary provisions by providing new or modified sampling and testing procedures for Plan participants and participating flocks. We also amended the regulations in 9...

  14. 77 FR 1051 - General Conference Committee of the National Poultry Improvement Plan; Meeting

    Science.gov (United States)

    2012-01-09

    ...] General Conference Committee of the National Poultry Improvement Plan; Meeting AGENCY: Animal and Plant... the General Conference Committee of the National Poultry Improvement Plan. DATES: The meeting will be... INFORMATION CONTACT: Dr. C. Stephen Roney, Senior Coordinator, National Poultry Improvement Plan, VS, APHIS...

  15. 75 FR 23222 - National Poultry Improvement Plan; General Conference Committee Meeting and 40th Biennial Conference

    Science.gov (United States)

    2010-05-03

    ...] National Poultry Improvement Plan; General Conference Committee Meeting and 40th Biennial Conference AGENCY... notice of a meeting of the General Conference Committee of the National Poultry Improvement Plan (NPIP... Coordinator, National Poultry Improvement Plan, VS, APHIS, 1498 Klondike Road, Suite 101, Conyers, GA 30094...

  16. 76 FR 22295 - National Poultry Improvement Plan and Auxiliary Provisions

    Science.gov (United States)

    2011-04-21

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection 9 CFR Part 145 [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions Correction In rule document 2011-6539 appearing on pages 15791-15798 in the issue of Tuesday, March 22, 2011, make the...

  17. 76 FR 15791 - National Poultry Improvement Plan and Auxiliary Provisions

    Science.gov (United States)

    2011-03-22

    ... [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions... the National Poultry Improvement Plan (the Plan) and its auxiliary provisions by providing new or... National Poultry Improvement Plan (NPIP, also referred to below as ``the Plan'') is a cooperative Federal...

  18. 77 FR 42257 - General Conference Committee of the National Poultry Improvement Plan; Solicitation for Membership

    Science.gov (United States)

    2012-07-18

    ...] General Conference Committee of the National Poultry Improvement Plan; Solicitation for Membership AGENCY... regional membership for the General Conference Committee of the National Poultry Improvement Plan. DATES... INFORMATION CONTACT: Dr. C. Stephen Roney, Senior Coordinator, National Poultry Improvement Plan, VS, APHIS...

  19. 78 FR 24738 - Ethylene Oxide; Receipt of Application for Emergency Exemption, Solicitation of Public Comment

    Science.gov (United States)

    2013-04-26

    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-OPP-2013-0276; FRL-9385-2] Ethylene Oxide; Receipt of... ethylene oxide (CAS No. 75-21-8) to sterilize the interior surfaces of enclosed animal isolator units to... APHIS has requested the EPA Administrator to issue a quarantine exemption for the use of ethylene oxide...

  20. 78 FR 60245 - Privacy Act Systems of Records; LabWare Laboratory Information Management System

    Science.gov (United States)

    2013-10-01

    ....regulations.gov/#!documentDetail ;D=APHIS-2012-0039-0001. Postal Mail/Commercial Delivery: Send your comment... routine uses of records include releases related to litigation or investigations of violations of law. A... a party to litigation or has an interest in such litigation, and the use of such records by the...

  1. 78 FR 37775 - Privacy Act Systems of Records; Phytosanitary Certificate Issuance and Tracking System

    Science.gov (United States)

    2013-06-24

    ...://www.regulations.gov/#!documentDetail ;D=APHIS-2012-0104-0001. Postal Mail/Commercial Delivery: Send... related to litigation. A complete listing of the routine uses for this system is included in the... party to litigation or has an interest in such litigation, and the use of such records by the Department...

  2. 75 FR 70896 - Notice of Revision and Request for Extension of Approval of an Information Collection; Johne's...

    Science.gov (United States)

    2010-11-19

    ... Animal and Plant Health Inspection Service Notice of Revision and Request for Extension of Approval of an Information Collection; Johne's Disease AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION....C. 8301 et seq.), the Animal and Plant Health Inspection ] Service (APHIS) is authorized, among...

  3. 7 CFR 301.38-5 - Assembly and inspection of regulated articles: issuance and cancellation of certificates.

    Science.gov (United States)

    2010-01-01

    ... Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... and Plant Health Inspection Service (APHIS), Plant Protection and Quarantine). The addresses and telephone numbers of local offices may also be obtained by writing to the Animal and Plant Health Inspection...

  4. 78 FR 32229 - Notice of Request for Revision to and Extension of Approval of an Information Collection; Virus...

    Science.gov (United States)

    2013-05-29

    ... Animal and Plant Health Inspection Service Notice of Request for Revision to and Extension of Approval of... and Plant Health Inspection Service's intention to request a revision to and extension of approval of... U.S.C. 151-159), the Animal and Plant Health Inspection Service (APHIS) is authorized to promulgate...

  5. 76 FR 33192 - Notice of Request for Extension of Approval of an Information Collection; Phytosanitary Export...

    Science.gov (United States)

    2011-06-08

    ... Animal and Plant Health Inspection Service Notice of Request for Extension of Approval of an Information Collection; Phytosanitary Export Certification AGENCY: Animal and Plant Health Inspection Service, USDA... approval of an information collection. Abstract: The Animal and Plant Health Inspection Service (APHIS...

  6. College of Natural Resources assists with oral rabies vaccination project

    OpenAIRE

    Davis, Lynn

    2006-01-01

    On August 8, 2006, the United States Department of Agriculture (USDA) Animal Plant and Health Inspection Service (APHIS), Wildlife Services (WS), will begin releasing approximately 300,000 Oral Rabies Vaccination (ORV) baits from low-flying aircraft and by car in Buchanan, Dickenson, Lee, Russell, Scott, Smyth, Tazewell, Washington, and Wise counties in southwestern Virginia.

  7. E-commerce and Caulerpa : unregulated dispersal of invasive species

    NARCIS (Netherlands)

    Walters, LJ; Brown, KR; Stam, WT; Olsen, JL

    Professional aquarists and hobbyists are thought to be the source of invasions of the aquarium strain of the green macroalga Caulerpa taxi folia in the Mediterranean, southern California, and Australia. The US Department of Agriculture, Animal and Plant Health Inspection Service (USDA-APHIS)

  8. 75 FR 75957 - Notice of Revision and Request for Extension of Approval of an Information Collection...

    Science.gov (United States)

    2010-12-07

    ... Animal and Plant Health Inspection Service Notice of Revision and Request for Extension of Approval of an... and Plant Health Inspection Service's intention to revise an information collection associated with... and Plant Health Inspection Service (APHIS) regulates the importation and interstate movement of...

  9. 78 FR 14509 - Availability of an Environmental Assessment and Finding of No Significant Impact for a Biological...

    Science.gov (United States)

    2013-03-06

    ... Animal and Plant Health Inspection Service Availability of an Environmental Assessment and Finding of No... no significant impact, the Animal and Plant Health Inspection Service has determined that an...: Background The Animal and Plant Health Inspection Service (APHIS) is proposing to issue permits for the...

  10. 7 CFR 351.1 - Joint treatment generally.

    Science.gov (United States)

    2010-01-01

    ... Animal and Plant Health Inspection Service (APHIS) under the authority of the Plant Protection Act (7 U.S... Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE IMPORTATION OF PLANTS OR PLANT PRODUCTS BY MAIL § 351.1 Joint treatment...

  11. 76 FR 44891 - Monsanto Co.; Availability of Petition, Plant Pest Risk Assessment, and Environmental Assessment...

    Science.gov (United States)

    2011-07-27

    ...] [FR Doc No: 2011-19039] DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket... Tolerance AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Notice; reopening of comment... public that the Animal and Plant Health Inspection Service (APHIS) has received a petition from the...

  12. A report on the transmissibility of Sugarcane mosaic virus and Sugarcane yellow leaf virus through seed in sugarcane

    Science.gov (United States)

    In the United States, exotic germplasm of sugarcane (Saccharum spp.) is mainly received as vegetative cuttings because the extensive actions required to meet existing APHIS (Animal and Plant Health Inspection Service) permit conditions make the importation of sugarcane seed impractical. While taking...

  13. Overview of the U.S. Cattle Fever Tick Eradication Program: History and Challenges

    Science.gov (United States)

    The Cattle Fever Tick Eradication Program (CFTEP) carried out by the Veterinary Services (VS) branch of the U.S. Department of Agriculture (USDA), Animal and Plant Health Inspection Service (APHIS) has been in continuous operation for 106 years. Through the efforts of this program cattle fever ticks...

  14. 78 FR 9851 - Importation of Plants for Planting

    Science.gov (United States)

    2013-02-12

    ... additions, deletions, re-orderings, and other amendments to paragraph (a); update paragraph (b); and make... site provides eAuthenticated persons with access to ePermits, APHIS' secure site for online permit... collected from the wild, and articles solely for food, analytical, or manufacturing purposes from these...

  15. 78 FR 24670 - Notice of a Determination Regarding the Swine Vesicular Disease Status of Certain Regions in Italy

    Science.gov (United States)

    2013-04-26

    ... Services, Sanitary Trade Issues Team, National Center for Import and Export, VS, APHIS, 4700 River Road... standards established by the World Organisation for Animal Health (OIE). Reconsideration of the status of... avoid any confusion. The language referenced by the commenter is what we commonly use to characterize...

  16. 75 FR 23220 - Notice of Revision and Request for Extension of Approval of an Information Collection...

    Science.gov (United States)

    2010-05-03

    ... Agricultural Pest Survey AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Revision and... intention to revise an information collection associated with the Cooperative Agricultural Pest Survey and....aphis.usda.gov ). FOR FURTHER INFORMATION CONTACT: For information on the Cooperative Agricultural Pest...

  17. The Cooperative Agricultural Pest Survey Program (CAPS): scientific support to optimize a national program

    Science.gov (United States)

    Lisa D. Jackson; Daniel A. Fieselmann

    2011-01-01

    The mission of the Cooperative Agricultural Pest Survey (CAPS) program is to provide a survey profile of exotic plant pests in the United States deemed to be of regulatory significance to USDA Animal and Plant Health Inspection Service (APHIS), Plant Protection and Quarantine (PPQ), State Departments of Agriculture, tribal governments, and cooperators by confirming the...

  18. 78 FR 14510 - Notice of Availability of New Guidelines for Pest Risk Assessments of Imported Fruits and Vegetables

    Science.gov (United States)

    2013-03-06

    ... the revised methodology that APHIS will use to conduct plant health pest risk assessments for imported... in our reading room. The reading room is located in room 1141 of the USDA South Building, 14th Street and Independence Avenue SW., Washington, DC. Normal reading room hours are 8 a.m. to 4:30 p.m., Monday...

  19. 78 FR 40940 - Lacey Act Implementation Plan; Definitions for Exempt and Regulated Articles

    Science.gov (United States)

    2013-07-09

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service 7 CFR Part 357 [Docket No. APHIS-2009-0018] RIN 0579-AD11 Lacey Act Implementation Plan; Definitions for Exempt and Regulated Articles AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Interim final rule. SUMMARY: In...

  20. 75 FR 34320 - Asian Longhorned Beetle; Quarantined Area and Regulated Articles

    Science.gov (United States)

    2010-06-17

    .... APHIS-2010-0004] Asian Longhorned Beetle; Quarantined Area and Regulated Articles AGENCY: Animal and... of quarantined areas and restricting the interstate movement of regulated articles from that area. We are also updating the list of regulated articles in order to reflect new information concerning host...

  1. 76 FR 52541 - Asian Longhorned Beetle; Quarantined Areas and Regulated Articles

    Science.gov (United States)

    2011-08-23

    .... APHIS-2010-0128] Asian Longhorned Beetle; Quarantined Areas and Regulated Articles AGENCY: Animal and... interstate movement of regulated articles from those areas will be restricted. We are also updating the list of regulated articles in order to reflect new information concerning host plants. These actions are...

  2. 75 FR 81832 - Asian Longhorned Beetle; Quarantined Area and Regulated Articles

    Science.gov (United States)

    2010-12-29

    .... APHIS-2010-0004] Asian Longhorned Beetle; Quarantined Area and Regulated Articles AGENCY: Animal and... interstate movement of regulated articles from that area. The interim rule also updated the list of regulated articles in order to reflect new information concerning host plants. The interim rule was necessary to...

  3. 9 CFR 77.33 - Testing procedures for tuberculosis in captive cervids.

    Science.gov (United States)

    2010-01-01

    ... veterinarian employed by USDA. (1) A designated accredited veterinarian may conduct the SCT test, except as... Programs, VS, APHIS, 4700 River Road Unit 43, Riverdale, MD 20737-1231. (d) Reporting of tests—(1) SCT and CCT tests. For the SCT and CCT tests, the testing veterinarian must submit a report to cooperating...

  4. 77 FR 44208 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-07-27

    ... information unless it displays a currently valid OMB control number. Animal and Plant Health Inspection... world market of animals and animal products trade. In connection with this mission, APHIS enforces... States would be at increase risk of an exotic disease incursion. Description of Respondents: Business or...

  5. 77 FR 7124 - Information Sharing With Agency Stakeholders; Public Meeting

    Science.gov (United States)

    2012-02-10

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF AGRICULTURE...., Washington, DC 20250; phone (202) 720-0378. SUPPLEMENTARY INFORMATION: The U.S. Department of Agriculture... focusing on ways to share timely information with its stakeholders and communicate the value APHIS places...

  6. 75 FR 29706 - Interstate Movement of Garbage from Hawaii; Availability of an Environmental Assessment and...

    Science.gov (United States)

    2010-05-27

    ... Inspection Service [Docket No. APHIS-2006-0172] Interstate Movement of Garbage from Hawaii; Availability of... Service relative to a request to allow the interstate movement of garbage from Hawaii to a landfill in the.... SUPPLEMENTARY INFORMATION: Background The importation and interstate movement of garbage is regulated by the...

  7. 75 FR 61121 - Interstate Movement of Garbage From Hawaii; Withdrawal of Finding of No Significant Impact

    Science.gov (United States)

    2010-10-04

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2006-0172] Interstate Movement of Garbage From Hawaii; Withdrawal of Finding of No Significant Impact AGENCY: Animal and... INFORMATION: Background The importation and interstate movement of garbage is regulated by the Animal and...

  8. 75 FR 2845 - ArborGen, LLC; Availability of an Environmental Assessment for Controlled Release of a...

    Science.gov (United States)

    2010-01-19

    ... Animal and Plant Health Inspection Service ArborGen, LLC; Availability of an Environmental Assessment for Controlled Release of a Genetically Engineered Eucalyptus Hybrid AGENCY: Animal and Plant Health Inspection... Internet at ( http://www.aphis.usda.gov ). FOR FURTHER INFORMATION CONTACT: Biotechnology Regulatory...

  9. 78 FR 25942 - J.R. Simplot Co.; Availability of Petition for Determination of Nonregulated Status of Potato...

    Science.gov (United States)

    2013-05-03

    ...] J.R. Simplot Co.; Availability of Petition for Determination of Nonregulated Status of Potato... Plant Health Inspection Service (APHIS) has received a petition from the J.R. Simplot Company (Simplot... Petition Number 13-022-01p) from the J.R. Simplot Company (Simplot) of Boise, ID, seeking a determination...

  10. 9 CFR 71.18 - Individual identification of certain cattle 2 years of age or over for movement in interstate...

    Science.gov (United States)

    2010-01-01

    ... other means approved by the Administrator, upon request in specific cases, and if except as provided in... representative” and “APHIS representative” are defined in § 78.1 of this chapter. 2 Other document means a shipping permit, an official health certificate, an official brand inspection certificate, a bill of lading...

  11. 77 FR 44107 - Information From Foreign Regions Applying for Recognition of Animal Health Status

    Science.gov (United States)

    2012-07-27

    .... Two of the three said that they oppose the concept of regionalization for animal health status. Two...-based regulatory measures. The United States has successfully applied the concept for decades in... that foreign country, stating that multinational meat packers might lobby APHIS to conduct such...

  12. 9 CFR 73.5 - Interstate shipment of undiseased cattle from quarantined area; when permitted.

    Science.gov (United States)

    2010-01-01

    ... (INCLUDING POULTRY) AND ANIMAL PRODUCTS SCABIES IN CATTLE § 73.5 Interstate shipment of undiseased cattle... diseased with scabies, may be shipped, transported, or otherwise moved interstate for any purpose upon... have been inspected for scabies by an APHIS or State inspector, that all the infected or exposed herds...

  13. 78 FR 23542 - Procurement List Additions

    Science.gov (United States)

    2013-04-19

    .../Locations: Janitorial Service, National Center for Cool and Cold Water Aquaculture, 11861 Leetown Road, Kearneysville, WV Appalachian Fruit Research Station, 2217 Wiltshire Road, Kearneysville, WV NPA: NW Works, Inc... Board, Washington DC Service Type/Location: Coating of Polypropylene Plastic Bleeding Tubes, USDA, APHIS...

  14. 76 FR 33191 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-06-08

    ... of animals and plants, to improve the agricultural productivity and competitiveness, and to... pesticide used in sensitive habitats. Need and Use of the Information: APHIS will collect information on the... actively monitoring the effects of pesticides in areas where the inappropriate use of these chemicals could...

  15. 76 FR 44455 - Importation of Shepherd's Purse With Roots From the Republic of Korea Into the United States

    Science.gov (United States)

    2011-07-26

    ... approved by the Office of Management and Budget (OMB) under OMB control number 0579-0366. E-Government Act Compliance The Animal and Plant Health Inspection Service is committed to compliance with the E-Government... pertinent to E-Government Act compliance related to this rule, please contact Mrs. Celeste Sickles, APHIS...

  16. 75 FR 32900 - Notice of Availability of a Pest Risk Analysis for the Importation of Sweet Limes From Mexico...

    Science.gov (United States)

    2010-06-10

    ... Importation of Sweet Limes From Mexico Into the Continental United States AGENCY: Animal and Plant Health... risk analysis that evaluates the risks associated with the importation of sweet limes from Mexico into... consignment. APHIS received a request from the Government of Mexico to allow the importation of sweet limes...

  17. 75 FR 41798 - Solicitation of Letters of Interest to Participate in Biotechnology Quality Management System...

    Science.gov (United States)

    2010-07-19

    ...] Solicitation of Letters of Interest to Participate in Biotechnology Quality Management System Program AGENCY... participate in the APHIS Biotechnology Quality Management System Program. The Biotechnology Quality Management..., audit-based compliance assistance program known as the Biotechnology Quality Management System Program...

  18. 76 FR 30091 - Notice of Request for Extension of Approval of an Information Collection; Accreditation of...

    Science.gov (United States)

    2011-05-24

    ... countries that the plants and plant products they are receiving from the United States are free of plant...=APHIS-2011-0026 to submit or view comments and to view supporting and related materials available....gov Web site (follow the link above and click ``View Docket Folder'') or in our reading room, which is...

  19. 9 CFR 2.50 - Time and method of identification.

    Science.gov (United States)

    2010-01-01

    ... Administrator. 2 In general, well fitted collars made of leather or plastic will be acceptable under this.... APHIS will determine the acceptability of a material proposed for usage as collars from the standpoint... approved by the Administrator; or (iii) A plastic-type collar acceptable to the Administrator which has...

  20. Two-year oscillation cycle in abundance of soybean aphid in Indiana

    Czech Academy of Sciences Publication Activity Database

    Rhainds, M.; Yoo, H. J. S.; Kindlmann, Pavel; Voegtlin, D.; Castillo, D.; Rutledge, C.; Sadof, C.; Yaninek, S.; O'Neil, R. J.

    2010-01-01

    Roč. 12, č. 3 (2010), s. 251-257 ISSN 1461-9555 Institutional research plan: CEZ:AV0Z60870520 Keywords : Aphididae * Aphis glycines * autumn migration * Hemiptera * heteroecy * Rhamnus * seesaw effect * soybean aphid Subject RIV: EH - Ecology, Behaviour Impact factor: 1.484, year: 2010

  1. 7 CFR 301.89-15 - Compensation for growers, handlers, and seed companies in the 1999-2000 and subsequent crop seasons.

    Science.gov (United States)

    2010-01-01

    ... the intention of producing certified wheat seed. (1) Growers. Growers of wheat in an area under the... intention of producing certified wheat seed, and wheat grain. (2) Handlers and seed companies. Handlers and... receive compensation only if the wheat was not tested by APHIS prior to purchase by the handler or seed...

  2. Heat treatment of firewood : meeting the phytosanitary requirements

    Science.gov (United States)

    Xiping Wang; Richard Bergman; Brian K. Brashaw; Scott Myers; Marc Joyal

    2011-01-01

    The movement of firewood within emerald ash borer- (EAB-) infested states and into adjoining states has been a major contributor to the spread of EAB throughout the United States and Canada. In an effort to stop the further spread of EAB from infested areas and to facilitate interstate commerce, USDA Animal and Plant Health Inspection Service (APHIS) has required and...

  3. 7 CFR 319.56-49 - Eggplant from Israel.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FOREIGN QUARANTINE NOTICES Fruits and Vegetables § 319.56-49 Eggplant...-exclusionary structures. APHIS-approved fruit fly traps with an approved protein bait must be placed inside the...

  4. 7 CFR 371.9 - Policy and Program Development.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Policy and Program Development. 371.9 Section 371.9 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION... effects of APHIS programs to ensure their compliance with environmental laws and regulations and providing...

  5. 77 FR 46373 - Availability of an Environmental Assessment for a Biological Control Agent for Hemlock Woolly...

    Science.gov (United States)

    2012-08-03

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2012-0060... that the Animal and Plant Health Inspection Service has prepared an environmental assessment relative... of the potential environmental effects associated with the proposed action are documented in detail...

  6. 76 FR 4859 - Availability of an Environmental Assessment and Finding of No Significant Impact for a Biological...

    Science.gov (United States)

    2011-01-27

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2010-0028] Availability of an Environmental Assessment and Finding of No Significant Impact for a Biological Control Agent... (Diaphorina citri Kuwayama). The environmental assessment considers the effects of, and alternatives to, the...

  7. 78 FR 79658 - Environmental Impact Statement; Animal Carcass Management

    Science.gov (United States)

    2013-12-31

    ... prepare an environmental impact statement to examine the potential environmental effects of animal carcass... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2013-0044] Environmental Impact Statement; Animal Carcass Management AGENCY: Animal and Plant Health Inspection Service...

  8. 78 FR 27182 - Notice of Request for Extension of Approval of an Information Collection; Commercial...

    Science.gov (United States)

    2013-05-09

    ... Act of 1995, this notice announces the Animal and Plant Health Inspection Service's intention to... facilities of equines considered to be unfit for travel, the use of electric prods on such animals in..., including a USDA-APHIS Owner/Shipper Certificate Fitness to Travel to a Slaughter Facility Form/Continuation...

  9. Survival and feeding rates of four aphid species (Hemiptera: Aphididae) on various sucrose concentrations in diets

    Science.gov (United States)

    Different concentrations of sucrose were used to investigate how survival and feeding was affected on four species of aphids (Hemiptera: Aphididae). Seven sucrose concentrations were evaluated in feeding chambers fitted with a parafilm membranes and infested with nymphs of Aphis glycines, Diuraphi...

  10. Characterization and genetics of multiple soybean aphid biotype resistance in five soybean plant introductions

    Science.gov (United States)

    Soybean aphid (Aphis glycines Matsumura) is the most important soybean [Glycine max (L.) Merr.] insect pest in the USA. The objectives of this study were to characterize the resistance expressed in the five plant introductions (PIs) to four soybean aphid biotypes, determine the mode of resistance in...

  11. Infestation ratings database for soybean aphid on early-maturity wild soybean lines

    Science.gov (United States)

    Soybean aphid (Aphis glycines Matsumura; SA) is a major invasive pest of soybean [Glycine max (L.) Merr.] in northern production regions of North America. Although insecticides are currently the main method for controlling this pest, SA-resistant cultivars are being developed to sustainably manage ...

  12. Stability of soybean aphid resistance in soybean across different temperatures

    Science.gov (United States)

    The soybean aphid, Aphis glycines Matsumura, is the most important insect pest posing a threat to soybean, Glycine max (L.) Merr., grain production in the United States. Soybean cultivars with resistance are currently being deployed to aid in management of the pest. Temperature has been reported to ...

  13. TMFunction data: 1623 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available ng L, Oberstein A, Yan H, Baker RP, Gu L, Jeffrey PD, Urban S, Shi Y. Nat Struct Mol Biol. 2006 Dec;13(12):1084-91. X-ray crystallogr...aphy ... 2NRF ... GLPG_ECOLI Helix ... rhomboid; catalytic; gating mechanism; substrate

  14. 7 CFR 370.3 - Index.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Index. 370.3 Section 370.3 Agriculture Regulations of... AGRICULTURE FREEDOM OF INFORMATION § 370.3 Index. Pursuant to the regulations in § 1.4(b) of this title, APHIS will maintain and make available for public inspection and copying a current index providing...

  15. 77 FR 43805 - Gull Hazard Reduction Program at John F. Kennedy International Airport; Record of Decision

    Science.gov (United States)

    2012-07-26

    ... Inspection Service [Docket No. APHIS-2006-0035] Gull Hazard Reduction Program at John F. Kennedy... environmental impact statement for the Gull Hazard Reduction Program at John F. Kennedy International Airport... around the John F. Kennedy International Airport. This action is a supplement to the Gull Hazard...

  16. 78 FR 58511 - Notice of Request for Extension of Approval of an Information Collection; Importation of Horses...

    Science.gov (United States)

    2013-09-24

    ... subcontinent, Southeast Asia, tropical and sub-Saharan Africa, and the Arabian peninsula. Screwworm causes... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2013-0065..., Ruminants, Swine, and Dogs; Inspection and Treatment for Screwworm AGENCY: Animal and Plant Health...

  17. 75 FR 31745 - Notice of Request for Extension of Approval of an Information Collection; Importation of Horses...

    Science.gov (United States)

    2010-06-04

    ... sub-Saharan Africa, and the Arabian peninsula. Screwworm causes extensive damage to livestock and... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2010-0033..., Ruminants, Swine, and Dogs; Inspection and Treatment for Screwworm AGENCY: Animal and Plant Health...

  18. 78 FR 63373 - Cold Treatment for Fresh Fruits and Vegetables; MidAmerica St. Louis Airport, Mascoutah, IL

    Science.gov (United States)

    2013-10-24

    ... biological barriers at this port that, along with certain safeguards, would prevent the introduction of fruit... Manual is available at http://www.aphis.usda.gov/import_export/plants/manuals/ports/downloads/treatment... that there are biological barriers in the area of this port that, along with certain safeguards, would...

  19. 76 FR 38601 - Notice of Request for Extension of Approval of an Information Collection; Self-Certification...

    Science.gov (United States)

    2011-07-01

    .... Resource management and administrative services, including human resource management, for the three MRP..., contact Mr. Eric Williams, Human Resources Specialist, Human Resources Division, APHIS, 100 N. 6th Street... domestic and international marketing of U.S. agricultural products and protect the health of domestic...

  20. 77 FR 28349 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-05-14

    ... and Plant Health Inspection Service Title: Health Certificate for the Export of Live Crustaceans... exporting any live crustaceans and their gametes, live finfish, and their gametes, or live mollucks and... by APHIS as the competent Federal authority who certifies the health status of the shipment being...

  1. 78 FR 41866 - Restructuring of Regulations on the Importation of Plants for Planting

    Science.gov (United States)

    2013-07-12

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service 7 CFR Parts 319 and 340 [Docket No. APHIS-2008-0011] RIN 0579-AD75 Restructuring of Regulations on the Importation of Plants for Planting AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Proposed rule; reopening of...

  2. Mind your elders: wild soybean’s contribution to soybean aphid resistance

    Science.gov (United States)

    Currently, biotype 4 soybean aphid (Aphis glycines Matsamura, SBA) is the most virulent SBA biotype. Overcoming the most aphid resistant genes, SBA biotype 4 has become the greatest challenge in utilizing plant resistance in soybean [Glycine max (L.) Merr.]. Soybean’s wild ancestor Glycine soja (Sie...

  3. 78 FR 63959 - Environmental Impact Statement; Animal Carcass Management

    Science.gov (United States)

    2013-10-25

    ... (APHIS) regulations regarding carcass management, including those found in 9 CFR 53.4, are based on World... comment on them during the scoping period: Effects on soil, air, and water quality. Effects on humans... announcing its availability and an opportunity to comment on it will be published in the Federal Register...

  4. 77 FR 58469 - Asian Longhorned Beetle; Quarantined Areas in Massachusetts, Ohio, and New York

    Science.gov (United States)

    2012-09-21

    .... APHIS-2012-0003] Asian Longhorned Beetle; Quarantined Areas in Massachusetts, Ohio, and New York AGENCY.... SUMMARY: We are adopting as a final rule, without change, an interim rule that amended the Asian... areas. The interim rule was necessary to prevent the artificial spread of Asian longhorned beetle to...

  5. 75 FR 11174 - Pesticide Product Registration Approval

    Science.gov (United States)

    2010-03-10

    .... Potentially affected entities may include, but are not limited to: Crop production (NAICS code 111). Animal... application from the U.S. Department of Agriculture, Animal and Plant Health Inspection Service (USDA, APHIS... Mammalian Gonadotropin Releasing Hormone (GnRH), and information on social, economic, and environmental...

  6. Evaluation phytosanitaire de varietes locales et de nouvelles ...

    African Journals Online (AJOL)

    In the frame of the adaptability study of 20 tomato varieties to the West African ecological conditions; the phytosanitary behavior of these varieties was accessed in the comparison with 2 local varieties. The major pests identified on the tomato plants were: whitefly, broad mites, fruitworm, aphis and leafhopper. The evaluation ...

  7. Novel methods of monitoring the feeding behavior of Homalodisca coagulata (Say) (Hemiptera; Cicadellidae)

    Czech Academy of Sciences Publication Activity Database

    Doležal, Petr; Bextine, B. R.; Doležalová, R.; Miller, T. A.

    2004-01-01

    Roč. 97, č. 5 (2004), s. 1055-1062 ISSN 0013-8746 Grant - others:USDA-APHIS Cooperative Agreement(US) 8500-0510-GR Institutional research plan: CEZ:AV0Z5007907 Keywords : Susceptible rice varieties * xylella-fastidosa * pierces--disease Subject RIV: ED - Physiology Impact factor: 1.083, year: 2004

  8. 78 FR 70515 - Petition To Promulgate Standards for Bears Under the Animal Welfare Act Regulations

    Science.gov (United States)

    2013-11-26

    ... Inspection Service 9 CFR Part 3 [Docket No. APHIS-2012-0106] Petition To Promulgate Standards for Bears Under... specific standards for the humane handling, care, treatment, and transportation of all species of bears held in captivity except polar bears, for which there are already standards. We are making this...

  9. 75 FR 33576 - Animal Traceability; Public Meetings

    Science.gov (United States)

    2010-06-14

    ...: Notice of public meetings. SUMMARY: This is a notice to inform the public of upcoming meetings in Salt... Bryce Ballroom, Sheraton Salt Lake City Hotel, 150 West 500 South, Salt Lake City, UT 84101. The public... Manager, Animal Disease Traceability, VS, APHIS, 4700 River Road Unit 46, Riverdale, MD 20737-1231; (301...

  10. 78 FR 33325 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-06-04

    ... Inspection Service Title: Cut Flowers from Countries with Chrysanthemum White Rust. OMB Control Number: 0579... and Plant Health Inspection Service Title: Tuberculosis Testing for Imported Cattle from Mexico. OMB... and Plant Health Inspection Service (APHIS) ability to compete in the global market of animal and...

  11. 75 FR 6346 - Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Male Summer Squash...

    Science.gov (United States)

    2010-02-09

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2010-0003] Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Male Summer Squash Flowers From Israel Into the Continental United States AGENCY: Animal and Plant Health Inspection Service, USDA...

  12. 76 FR 44571 - Notice of Decision To Authorize the Importation of Fresh Edible Flowers of Izote, Immature...

    Science.gov (United States)

    2011-07-26

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2010-0114] Notice of Decision To Authorize the Importation of Fresh Edible Flowers of Izote, Immature Inflorescences... Continental United States AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Notice. SUMMARY...

  13. 75 FR 29309 - Notice of Decision to Issue Permits for the Importation of Fresh Male Summer Squash Flowers From...

    Science.gov (United States)

    2010-05-25

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2010-0003] Notice of Decision to Issue Permits for the Importation of Fresh Male Summer Squash Flowers From Israel Into the Continental United States AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION...

  14. 76 FR 4278 - Notice of Availability of Pest Risk Analyses for the Importation of Fresh Edible Flowers of Izote...

    Science.gov (United States)

    2011-01-25

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2010-0114] Notice of Availability of Pest Risk Analyses for the Importation of Fresh Edible Flowers of Izote... Salvador Into the Continental United States AGENCY: Animal and Plant Health Inspection Service, USDA...

  15. Height preference of Scolytus schevyrewi Semenov, the banded elm bark beetle of American elm, Ulmus americana

    Science.gov (United States)

    S. McElwey; J. F. Negron; J. Withrow

    2007-01-01

    Scolytus schevyrewi Semenov, the banded elm bark beetle, was first detected in North America in April 2003 in Colorado and Utah by the Rapid Detection and Response Pilot Project sponsored by APHIS and USDA Forest Service, Forest Health Protection. It was captured in Lindgren funnel traps baited with a-pinene, ethanol, and the Ips typographus...

  16. 78 FR 24633 - Restructuring of Regulations on the Importation of Plants for Planting

    Science.gov (United States)

    2013-04-25

    ... issued by the exporting country's national plant protection organization (NPPO) accompany all restricted... others. The Plants for Planting Manual is available on the Web at http://www.aphis.usda.gov/import_export... plants for other uses are regulated in subparts pertaining to the importation of cotton; sugarcane; corn...

  17. Download this PDF file

    African Journals Online (AJOL)

    (APHIS) have played a pioneering role in establishing and promoting international harmonisation of biotechnology regulatory .... living organisms to address global to facilitate trade. The project was initiated with environmental issues such as the build up of a questionnaire, completed in 1994, which greenhouse gases.

  18. 78 FR 27937 - Environmental Impact Statement; Feral Swine Damage Management

    Science.gov (United States)

    2013-05-13

    ... management program to protect agriculture, natural resources, property, and human health and safety. This... public and resource management agencies, and direct control services in which APHIS-WS uses one or more..., local governments, and private individuals and organizations to protect American resources from damage...

  19. 78 FR 23209 - Plants for Planting Whose Importation Is Not Authorized Pending Pest Risk Analysis; Notice of...

    Science.gov (United States)

    2013-04-18

    ... Phytosanitary Measures (RSPM) No. 24 \\4\\ of the North American Plant Protection Organization, of which APHIS is... Rhododendron spp. Korea is now exempted from the NAPPRA action for Pinus spp. United Kingdom is now exempted... stated that the nursery industry is under a severe contraction due to the national economy, with many...

  20. 7 CFR 319.56-5 - Pest-free areas.

    Science.gov (United States)

    2010-01-01

    ...) Survey protocols. APHIS must approve the survey protocol used to determine and maintain pest-free status... insect-proof mesh screens or plastic tarpaulins, including while in transit to the packinghouse and while... transit to a port, they must be packed in insect-proof cartons or containers or be covered by insect-proof...

  1. 78 FR 48628 - Importation of Papayas From Peru

    Science.gov (United States)

    2013-08-09

    ... Inspection Service 7 CFR Part 319 [Docket No. APHIS-2012-0014] RIN 0579-AD68 Importation of Papayas From Peru... from Peru into the continental United States. The conditions for the importation of papayas from Peru... action would allow for the importation of papayas from Peru while continuing to provide protection...

  2. 75 FR 1 - Importation of Hass Avocados From Peru

    Science.gov (United States)

    2010-01-04

    .... APHIS-2008-0126] RIN 0579-AC93 Importation of Hass Avocados From Peru AGENCY: Animal and Plant Health... to allow the importation of Hass avocados from Peru into the continental United States. As a condition of entry, Hass avocados from Peru will have to be produced in accordance with a systems approach...

  3. 9 CFR 93.100 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., dogs, and poultry. APHIS representative. A veterinarian or other individual employed by the Animal and... subpart. Licensed veterinarian. Any person licensed by any region or political subdivision thereof to practice veterinary medicine. Pen-raised. Cared for in a fenced enclosure, such that the ratites are kept...

  4. 7 CFR 319.40-7 - Treatments and safeguards.

    Science.gov (United States)

    2010-01-01

    ... articles to the United States. (2) Pinus radiata wood chips from Chile and Eucalyptus (temperate species... Articles § 319.40-7 Treatments and safeguards. (a) Certification of treatments or safeguards. If APHIS determines that a document required for the importation of regulated articles is inaccurate, the regulated...

  5. 76 FR 62313 - Traceability for Livestock Moving Interstate

    Science.gov (United States)

    2011-10-07

    ... establish minimum national official identification and documentation requirements for the traceability of...://www.regulations.gov/#!documentDetail ;D=APHIS-2009-0091-0001. Postal Mail/Commercial Delivery: Send...-2009-0091) a proposal to establish minimum national official identification and documentation...

  6. Mountain aphid and parasitoid guilds on Aconitum spp. in Europe

    Czech Academy of Sciences Publication Activity Database

    Havelka, Jan; Tomanović, Ž.; Kos, K.; Kavallieratos, N. G.; Janeček, J.; Pons, X.; Rakhshani, E.; Starý, Petr

    2014-01-01

    Roč. 67, č. 1 (2014), s. 57-61 ISSN 1721-8861 Grant - others:Ministry of Education, Science and Technological Development(RS) III43001 Institutional support: RVO:60077344 Keywords : aphis * Aphididae * parasitoids Subject RIV: EH - Ecology, Behaviour Impact factor: 1.494, year: 2014 http://www.bulletinofinsectology.org/pdfarticles/vol67-2014-057-061havelka.pdf

  7. 9 CFR 94.6 - Carcasses, parts or products of carcasses, and eggs (other than hatching eggs) of poultry, game...

    Science.gov (United States)

    2010-01-01

    ..., Luxembourg, Mexico (States of Campeche, Quintana Roo, and Yucatan), New Zealand, Republic of Ireland, Spain... to the cost of one inspection. APHIS will charge the cooperative service account for travel, salary... origin or, if exported from Mexico, accompanied either by such a certificate or by a certificate issued...

  8. Bovine tuberculosis in Northern Ireland: quantification of the population disease-level effect from cattle leaving herds detected as a source of infection

    NARCIS (Netherlands)

    DOYLE, L. P.; COURCIER, E. A.; GORDON, A. W.; O'HAGAN, M. J. H.; STEGEMAN, J. A.; MENZIES, F. D.

    2017-01-01

    Determination of the proportion of bovine tuberculosis (bTB) breakdowns attributed to a herd purchasing infected animals has not been previously quantified using data from the Animal and Public Health Information System (APHIS) database in Northern Ireland. We used a case–control study design to

  9. 76 FR 3075 - Notice of Decision to Allow Interstate Movement of Guavas From Hawaii Into the Continental United...

    Science.gov (United States)

    2011-01-19

    ... Inspection Service [Docket No. APHIS-2010-0061] Notice of Decision to Allow Interstate Movement of Guavas... movement into the continental United States of fresh guava fruit from Hawaii. Based on the findings of a... interstate movement of guavas from Hawaii. DATES: Effective Date: January 19, 2011. FOR FURTHER INFORMATION...

  10. 77 FR 11480 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-02-27

    ... respond, including through the use of appropriate automated, electronic, mechanical, or other... Parts 17 and 23. APHIS will collect information using several PPQ forms. Need and Use of the Information... Health Inspection Service Title: Importation of Clementines from Spain. OMB Control Number: 0579-0203...

  11. 77 FR 58470 - Irradiation Treatment; Location of Facilities in the Southern United States; Technical Amendment

    Science.gov (United States)

    2012-09-21

    .... APHIS-2009-0100] RIN 0579-AD35 Irradiation Treatment; Location of Facilities in the Southern United... things, allow for irradiation treatment of mangoes from India upon arrival in the mainland United States... 20, 2012, we amended the regulations in Sec. 319.56-46 to allow for irradiation treatment of mangoes...

  12. 77 FR 42621 - Irradiation Treatment; Location of Facilities in the Southern United States

    Science.gov (United States)

    2012-07-20

    .... APHIS-2009-0100] RIN 0579-AD35 Irradiation Treatment; Location of Facilities in the Southern United... amending the phytosanitary treatment regulations to provide generic criteria for new irradiation treatment facilities in the Southern States of the United States. This action will allow irradiation facilities to be...

  13. Phytosanitary irradiation of Diatraea saccharalis, D. grandiosella, and Eoreuma loftini (Lepidoptera: Crambinae)

    Science.gov (United States)

    Phytosanitary irradiation (PI) is increasingly being used to disinfest horticultural commodities of invasive quarantine pests. Most disinfestation is done with generic treatments, where one dose is scheduled for a group of pests and/or commodities. The current generic treatment that USDA-APHIS uses...

  14. 75 FR 64984 - Availability of an Environmental Assessment for a Biological Control Agent for Hawkweeds

    Science.gov (United States)

    2010-10-21

    ... Regulations.gov and information on the location and hours of the reading room). You may request paper copies..., Riverdale, MD 20737-1238. Please state that your comment refers to Docket No. APHIS-2010-0078. Reading Room: You may read any comments that we receive on the environmental assessment in our reading room. The...

  15. 75 FR 28232 - Availability of an Environmental Assessment for a Biological Control Agent for Hemlock Woolly...

    Science.gov (United States)

    2010-05-20

    ... reading room). You may request paper copies of the EA by calling or writing to the person listed under FOR... 20737-1238. Please state that your comment refers to Docket No. APHIS-2010-0029. Reading Room: You may read any comments that we receive on the environmental assessment in our reading room. The reading room...

  16. 75 FR 69396 - Availability of an Environmental Assessment for a Biological Control Agent for Arundo donax

    Science.gov (United States)

    2010-11-12

    ... location and hours of the reading room). You may request paper copies of the EA by calling or writing to..., Riverdale, MD 20737-1238. Please state that your comment refers to Docket No. APHIS-2010-0108. Reading Room: You may read any comments that we receive on the environmental assessment in our reading room. The...

  17. 75 FR 52305 - Notice of Availability of a Treatment Evaluation Document

    Science.gov (United States)

    2010-08-25

    ... Regulations.gov and information on the location and hours of the reading room). You may request paper copies... 20737-1238. Please state that your comment refers to Docket No. APHIS-2010-0059. Reading Room: You may read any comments that we receive on this docket in our reading room. The reading room is located in...

  18. 75 FR 62500 - Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Strawberries From Jordan

    Science.gov (United States)

    2010-10-12

    ... and information on the location and hours of the reading room). You may request paper copies of the... 20737-1238. Please state that your comment refers to Docket No. APHIS-2010-0096. Reading Room: You may read any comments that we receive on this docket in our reading room. The reading room is located in...

  19. 78 FR 1825 - Importation of Fresh Barhi Dates From Israel Into the United States

    Science.gov (United States)

    2013-01-09

    ... Regulations.gov Web site or in our reading room. You may also request paper copies of the TED by calling or....regulations.gov/#!docketDetail ;D=APHIS 2012- 0004 or in our reading room, which is located in room 1141 of the USDA South Building, 14th Street and Independence Avenue SW., Washington, DC. Normal reading room...

  20. 78 FR 24155 - Notice of Availability of a Pest Risk Analysis for Interstate Movement of Sapote Fruit From...

    Science.gov (United States)

    2013-04-24

    ... reading room). You may request paper copies of the pest risk analysis by calling or writing to the person....regulations.gov/#!docketDetail ;D=APHIS-2013- 0017 or in our reading room, which is located in room 1141 of the USDA South Building, 14th Street and Independence Avenue SW., Washington, DC. Normal reading room...

  1. 76 FR 3076 - Availability of an Environmental Assessment for a Biological Control Agent for Air Potato

    Science.gov (United States)

    2011-01-19

    ... reading room). You may request paper copies of the EA by calling or writing to the person listed under FOR.... APHIS-2010-0115. Reading Room: You may read any comments that we receive on the environmental assessment in our reading room. The reading room is located in Room 1141 of the USDA South Building, 14th Street...

  2. 75 FR 6345 - Notice of Availability of a Pest Risk Analysis for the Importation of Fresh False Coriander From...

    Science.gov (United States)

    2010-02-09

    ... of the reading room). You may request paper copies of the pest risk analysis by calling or writing to..., Riverdale, MD 20737-1238. Please state that your comment refers to Docket No. APHIS-2009-0092. Reading Room: You may read any comments that we receive on this docket in our reading room. The reading room is...

  3. 75 FR 52302 - Notice of Availability of Pest Risk Analyses for the Importation of Fresh Celery, Arugula, and...

    Science.gov (United States)

    2010-08-25

    ... location and hours of the reading room). You may request paper copies of the pest risk analyses by calling... that your comment refers to Docket No. APHIS-2010-0074. Reading Room: You may read any comments that we receive on this docket in our reading room. The reading room is located in room 1141 of the USDA South...

  4. 76 FR 15280 - Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Persimmon From the...

    Science.gov (United States)

    2011-03-21

    ... and information on the location and hours of the reading room). You may request paper copies of the... to Docket No. APHIS-2011-0018. Reading Room: You may read any comments that we receive on this docket in our reading room. The reading room is located in room 1141 of the USDA South Building, 14th Street...

  5. 76 FR 46268 - Notice of Availability of Pest Risk Analyses for the Importation of Fresh Pitaya and Pomegranates...

    Science.gov (United States)

    2011-08-02

    ... of the reading room). You may request paper copies of the pest risk analyses by calling or writing to....regulations.gov/#!docketDetail ;D=APHIS-2011- 0031 or in our reading room, which is located in room 1141 of the USDA South Building, 14th Street and Independence Avenue SW., Washington, DC. Normal reading room...

  6. 75 FR 65293 - Draft Guidelines on Pharmacovigilance of Veterinary Medicinal Products: Electronic Standards for...

    Science.gov (United States)

    2010-10-22

    ... Regulations.gov and information on the location and hours of the reading room). You may request paper copies.... Please state that your comment refers to Docket No. APHIS-2010-0098. Reading Room: You may read any comments that we receive on this docket in our reading room. The reading room is located in room 1141 of...

  7. 75 FR 28233 - Availability of an Environmental Assessment for a Biological Control Agent for Asian Citrus Psyllid

    Science.gov (United States)

    2010-05-20

    ... reading room). You may request paper copies of the EA by calling or writing to the person listed under FOR... 20737-1238. Please state that your comment refers to Docket No. APHIS-2010-0028. Reading Room: You may read any comments that we receive on the environmental assessment in our reading room. The reading room...

  8. 77 FR 31829 - Importation of Fresh Bananas From the Philippines Into the Continental United States...

    Science.gov (United States)

    2012-05-30

    ... the location and hours of the reading room). You may request paper copies of the environmental... at http://www.regulations.gov/#!docketDetail ;D=APHIS-2011-0028 or in our reading room, which is.... Normal reading room hours are 8 a.m. to 4:30 p.m., Monday through Friday, except holidays. To be sure...

  9. 76 FR 30093 - Effectiveness Indications Statements in Veterinary Biologics Labeling; Notice of Public Meeting...

    Science.gov (United States)

    2011-05-24

    ... that your comment refers to Docket No. APHIS-2011-0049. Reading Room: You may view the concept paper... interested individuals, that we will be holding a public meeting to discuss a draft guideline (concept paper... concept paper available for review and comment. DATES: The public meeting will be held on Thursday, June...

  10. 75 FR 34422 - Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Mango Fruit From...

    Science.gov (United States)

    2010-06-17

    ... reading room). You may request paper copies of the analysis by calling or writing to the person listed..., Riverdale, MD 20737-1238. Please state that your comment refers to Docket No. APHIS-2010-0065. Reading Room: You may read any comments that we receive on this docket in our reading room. The reading room is...

  11. 77 FR 13260 - Notice of Availability of a Pest Risk Analysis for the Importation of Litchi, Longan, and...

    Science.gov (United States)

    2012-03-06

    ... on the location and hours of the reading room). You may request paper copies of the pest risk... http://www.regulations.gov/#!docketDetail ;D=APHIS-2012- 0005 or in our reading room, which is located.... Normal reading room hours are 8 a.m. to 4:30 p.m., Monday through Friday, except holidays. To be sure...

  12. 76 FR 20569 - Horse Protection Act; Petition for Amendments to Regulations

    Science.gov (United States)

    2011-04-13

    ... of Cruelty to Animals, the American Horse Protection Association, Inc., Friends of Sound Horses, Inc... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service 9 CFR Part 11 [Docket No. APHIS-2011-0006] Horse Protection Act; Petition for Amendments to Regulations AGENCY: Animal and Plant...

  13. Association mapping of aphid resistance in USDA cowpea (Vigna unguiculata L. Walp.) core collection using SNPs

    Science.gov (United States)

    Cowpea aphid (CPA; Aphis craccivora) is a destructive insect pest of cowpea, as well as other legume crops including alfalfa, beans, chickpea, lentils, lupins and peanuts. The utilization of aphid resistance in cowpea breeding is one of the most efficient and environmental friendly methods to contro...

  14. A Qualitative Risk Assessment of Kenya for Foot and Mouth Disease ...

    African Journals Online (AJOL)

    Therefore, in order to comply with the World Trade Organization [WTO] Sanitary Phytosanitary [SPS] regulations, this Risk Analysis was conducted in response in order to assure USDA-APHIS and FSIS that export of smoked and cooked pork frankfurters from Kenya will not introduce Foot and Mouth Disease [FMD] to USA.

  15. Presence and Effects of Chemical Toxin on Feeding of Cowpea ...

    African Journals Online (AJOL)

    Cowpea, Vigna unguiculata (L.) Walp is one of the most important grain legumes produced in Nigeria. It is mostly grown as a mixed crop with cereals in a traditional cereal/legume farming system. Cowpea aphid, Aphis craccivora Koch is the main aphid pest of cowpea. In view of the importance and serious damage caused ...

  16. Dicty_cDB: VFE585 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RATE SYNTHASE, MITOCHONDRIAL PRECURSOR ;, mRNA sequence. 34 2e-04 4 CD450751 |CD450751.1 USDA-FP_102714 Adult Alate Brown Citrus Aphi...sequence. 46 7e-04 3 CB832670 |CB832670.1 USDA-FP_100461 Adult Alate Brown Citrus Aphid

  17. Evaluation of neem seed extract for the control of major field pests of ...

    African Journals Online (AJOL)

    The insect pests studied were the cowpea aphid, Aphis craccivora Koch, legume bud thrips Megalurothrips sjostedti Tryb, legume pod borer, Maruca vitrata Fab. and pod sucking bugs under the application of 5% aqueous extract of neem seed kernel extract (NSKE). The trials were conducted during the early and late ...

  18. Development of groundnut rosette disease and vector resistant ...

    African Journals Online (AJOL)

    Mo

    It is transmitted by the aphid (Aphis craccivora) as the principal vector of the virus. It can cause up to 100% yield loss in severe attacks. Globally, rosette is estimated to cause annual yield losses worth US$ 156 million and potential yield gains in alleviating this constraint through crop improvement are estimated at US $ 121 ...

  19. Screening for Development of Host Plant Resistance to Infestation ...

    African Journals Online (AJOL)

    A study was carried out at International Institute of Tropical Agriculture (IITA) Kano station during 2009 and 2010 growing season, to screen fifty two (52) cowpea varieties for resistance to aphids (Aphis craccivora) attack. It was found that only seven (7) varieties were highly resistant, nine (9) were highly susceptible and the ...

  20. 7 CFR 319.56-6 - Trust fund agreements.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FOREIGN QUARANTINE NOTICES Fruits and Vegetables § 319.56-6 Trust fund... the exportation of fruits or vegetables and APHIS services are to be funded by the national plant...

  1. 75 FR 12961 - Regulation of the Interstate Movement of Lemons from Areas Quarantined for Mediterranean Fruit Fly

    Science.gov (United States)

    2010-03-18

    ... amending the list of regulated articles in our domestic fruit fly quarantine regulations. The regulations... Articles,'' lists articles subject to domestic quarantine regulations for several species of fruit fly.... APHIS-2009-0002) a proposal\\1\\ to amend the list of regulated articles in our domestic fruit fly...

  2. Scientific Opinion on a technical file submitted by the Japanese Authorities to support a derogation request from the EU import requirements for bonsai and topiary trees that are host plants of Anoplophora chinensis

    DEFF Research Database (Denmark)

    Baker, R.; Candresse, T.; Dormannsné Simon, E.

    2010-01-01

    Following a request from the EU Commission, the EFSA PLH Panel conducted a scientific opinion on risk analysis and supporting documents provided by APHIS/USDA in support of the request to remove the Union's plant health import requirement that citrus fruit imported into the EU be sourced from gro...

  3. 76 FR 1338 - Emerald Ash Borer; Quarantined Areas; Maryland, Michigan, Minnesota, Missouri, Pennsylvania...

    Science.gov (United States)

    2011-01-10

    .... APHIS-2008-0072] Emerald Ash Borer; Quarantined Areas; Maryland, Michigan, Minnesota, Missouri... emerald ash borer (EAB). The interim rule was necessary to prevent the artificial spread of EAB into... CONTACT: Mr. Paul Chaloux, National Program Coordinator, Emerald Ash Borer Program, Emergency and Domestic...

  4. The Role of Biocontrol of Emerald Ash Borer in Protecting Ash Regeneration after Invasion

    Science.gov (United States)

    Emerald ash borer (EAB) is an invasive Asian beetle that is destroying ash in forests over much of eastern North America because of the high susceptibility of our native ash and a lack of effective natural enemies. To increase mortality of EAB larvae and eggs, the USDA (FS, ARS and APHIS) is carryin...

  5. 75 FR 29189 - Emerald Ash Borer; Addition of Quarantined Areas in Kentucky, Michigan, Minnesota, New York...

    Science.gov (United States)

    2010-05-25

    .... APHIS-2009-0098] Emerald Ash Borer; Addition of Quarantined Areas in Kentucky, Michigan, Minnesota, New..., USDA. ACTION: Interim rule and request for comments. SUMMARY: We are amending the emerald ash borer... the emerald ash borer to noninfested areas of the United States. DATES: This interim rule is effective...

  6. 78 FR 57227 - Animal Welfare; Retail Pet Stores and Licensing Exemptions

    Science.gov (United States)

    2013-09-18

    ..., and transportation of animals covered by the AWA. Part 2 requires most dealers to be licensed by APHIS... requirements governing the humane handling, care, treatment, and transportation of certain animals by dealers... registries there is one other breeder that has not been identified who also uses remote marketing methods...

  7. 78 FR 13014 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-02-26

    ... Inspection Service (APHIS), Animal Care (AC) has the responsibility to enforce the AWA and the provisions of... exhibitor and owner, any names being used to promote the tour, and the current USDA licensee or registration... Respondents: 425 Frequency of Responses: Reporting: On occasion Total Burden Hours: 1,025 Ruth Brown...

  8. 78 FR 79658 - Okanagan Specialty Fruits, Inc.; Availability of Plant Pest Risk Assessment and Environmental...

    Science.gov (United States)

    2013-12-31

    ... Specialty Fruits, Inc., seeking a determination of nonregulated status of apple events designated as events... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2012-0025] Okanagan Specialty Fruits, Inc.; Availability of Plant Pest Risk Assessment and Environmental Assessment...

  9. 78 FR 67100 - Okanagan Specialty Fruits, Inc.; Availability of Plant Pest Risk Assessment and Environmental...

    Science.gov (United States)

    2013-11-08

    ... Fruits, Inc., seeking a determination of nonregulated status of apple events designated as events GD743... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2012-0025] Okanagan Specialty Fruits, Inc.; Availability of Plant Pest Risk Assessment and Environmental Assessment...

  10. 77 FR 41362 - Okanagan Specialty Fruits, Inc.; Availability of Petition for Determination of Nonregulated...

    Science.gov (United States)

    2012-07-13

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection Service [Docket No. APHIS-2012-0025] Okanagan Specialty Fruits, Inc.; Availability of Petition for Determination of Nonregulated Status of Apples Genetically Engineered To Resist Browning AGENCY: Animal and Plant Health Inspection Service, USDA...

  11. 76 FR 56635 - Tuberculosis in Cattle and Bison; State and Zone Designations; Michigan

    Science.gov (United States)

    2011-09-14

    .... APHIS-2011-0075] Tuberculosis in Cattle and Bison; State and Zone Designations; Michigan AGENCY: Animal... are amending the bovine tuberculosis regulations to adjust the boundaries of the modified accredited, modified accredited advanced, and accredited-free tuberculosis risk classification zones for the State of...

  12. 76 FR 61253 - Tuberculosis in Cattle and Bison; State and Zone Designations; Minnesota

    Science.gov (United States)

    2011-10-04

    .... APHIS-2011-0100] Tuberculosis in Cattle and Bison; State and Zone Designations; Minnesota AGENCY: Animal... are amending the bovine tuberculosis regulations regarding State and zone classifications by... for tuberculosis. DATES: This interim rule is effective October 4, 2011. We will consider all comments...

  13. 7 CFR 771.2 - Abbreviations and definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Abbreviations and definitions. 771.2 Section 771.2... AGRICULTURE SPECIAL PROGRAMS BOLL WEEVIL ERADICATION LOAN PROGRAM § 771.2 Abbreviations and definitions. The following abbreviations and definitions apply to this part: (a) Abbreviations: APHIS means the Animal and...

  14. 76 FR 60358 - Gypsy Moth Generally Infested Areas; Additions in Indiana, Maine, Ohio, Virginia, West Virginia...

    Science.gov (United States)

    2011-09-29

    .... APHIS-2010-0075] Gypsy Moth Generally Infested Areas; Additions in Indiana, Maine, Ohio, Virginia, West Virginia, and Wisconsin AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Affirmation of... amended the regulations to add areas in Indiana, Maine, Ohio, Virginia, West Virginia, and Wisconsin to...

  15. Interference of field evidence, morphology, and DNA analyses of three related Lysiphlebus aphid parasitoids (Hymenoptera: Braconidae. Aphidiinae)

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Kavallieratos, N. G.; Petrović, A.; Žikić, V.; Rakhshani, E.; Tomanović, S.; Tomanović, Ž.; Havelka, Jan

    2014-01-01

    Roč. 14, č. 1 (2014), article number 171 ISSN 1536-2442 Grant - others:Ministry of Education , Science, and Technological Development of the Republic of Serbia(RS) 173006 Institutional support: RVO:60077344 Keywords : Aphis fabae * Impatiens glandulifera * Lysiphlebus Subject RIV: EG - Zoology Impact factor: 1.025, year: 2014 http://jinsectscience.oxfordjournals.org/content/14/1/171

  16. The USDA Forest Service-RMRS forest fungi collection: Resource for fungal identification, developing biological controls, predicting invasive pathogens, and predicting potential impacts of climate change

    Science.gov (United States)

    Sara M. Ashiglar; John W. Hanna; Amy L. Ross-Davis; Ned B. Klopfenstein

    2014-01-01

    The Moscow Forestry Sciences Laboratory of the Rocky Mountain Research Station (RMRS) has a unique collection of forest/tree-associated fungi with over 15,000 living specimens. Based in Moscow, ID, this USDA APHIS-PPQ (Plant Protection and Quarantine) containment facility houses fungal archives from approximately 35 states and 30 countries. The collection involves the...

  17. 78 FR 49972 - Importation of Cape Gooseberry From Colombia Into the United States

    Science.gov (United States)

    2013-08-16

    ... involved with the NPPO in monitoring and auditing implementation of the systems approach. A bilateral... effect if OMB receives it within 30 days of publication of this proposed rule. APHIS is proposing to... monitoring and auditing implementation of the systems approach. (b) Place of production requirements. (1) All...

  18. 9 CFR 52.3 - Appraisal of swine.

    Science.gov (United States)

    2010-01-01

    ... an APHIS employee alone. (b) The appraisal of swine will be based on the fair market value as determined by the meat or breeding value of the animals. Animals may be appraised in groups, provided that where appraisal is by the head, each animal in the group is the same value per head, and where appraisal...

  19. 75 FR 26707 - Notice of Decision to Issue Permits for the Importation of Fresh Pomegranates and Baby Kiwi from...

    Science.gov (United States)

    2010-05-12

    ... commodities that, based on the findings of a pest risk analysis, can be safely imported subject to one or more..., APHIS publishes a notice in the Federal Register announcing the availability of the pest risk analysis... pest risk analysis; (2) the comments on the pest risk analysis revealed that no changes to the pest...

  20. 76 FR 13890 - Importation of Bromeliad Plants in Growing Media From Belgium, Denmark, and the Netherlands

    Science.gov (United States)

    2011-03-15

    ... certain plants and plant products to prevent the introduction of plant pests and noxious weeds. The...' Food and Agriculture Organization. Such analyses are conducted to determine the plant pest risks... accordance with Sec. 319.37-8(g), APHIS has conducted the required pest risk analysis. The pest risk analysis...