WorldWideScience

Sample records for ap radiographs including

  1. Hip and pelvis diseases on lumbar AP radiographs including both hip joints

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Hyun Soo; Juhng, Seon Kwan; Kim, Eun A; Kim, Jeong Ho; Song, Ha Heon; Shim, Dae Moo [Wonkwang University School of Medicine, Iksan (Korea, Republic of)

    2002-12-01

    To determine the frequency of disease, and to evaluate the methods used for lumbar spine radiography in Korea. Sixty university and training hospitals were randomly selected and asked to describe the projections, film size and radiographic techniques employed for routine radiography in patients with suspected disease of the lumbar spine. Plain radiographs of 1215 patients, taken using 14x17 inch film and depicting both hip joints and the lumbar region, were analysed between March 1999 and February 2000. In 15 patients (1.2%), the radiographs revealed hip or pelvic lesion, confirmed as follows: avascular necrosis of the femoral head (n=11, with bilateral lesion in four cases); sustained ankylosing spondylitis (n=2); acetabular dysplasia (n=1); and insufficiency fracture of the pubic rami secondary to osteoporosis (n=1). In 11 or the 20 hospitals which responded, 14{sup x}17{sup f}ilm was being used for lumbar radiography, while in the other nine, film size was smaller. Plain radiography of the lumbar spine including both hip joints, may be a useful way to simultaneously evaluate lesions not only of the lumbar spine but also of the hip and/or pelvis.

  2. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  3. Supine and Standing AP Pelvis Radiographs in the Evaluation of Pincer Femoroacetabular Impingement.

    Science.gov (United States)

    Jackson, Timothy J; Estess, Allyson A; Adamson, Gregory J

    2016-07-01

    Pelvic tilt can affect the presence of the ischial spine sign and crossover sign. Numerous studies of pelvic tilt on radiographic measurements of pincer impingement have shown that increasing anterior tilt is associated with more radiographic signs of pincer impingement. However, to our knowledge, no study has directly compared supine and standing plain radiographs in patients with respect to lateral center-edge (LCE) angle, acetabular inclination, crossover sign, and ischial spine sign. The purpose of this study was to evaluate the differences in supine and standing AP pelvis radiographs as they relate to the radiographic parameters of pincer impingement in an adult population evaluated for femoroacetabular impingement, specifically intrapelvic distances (sacrococcygeal to symphysis [SC-S] and coccyx tip to symphysis [T-S]), crossover sign (presence and percentage), LCE angle, inclination, and ischial spine sign. Between August 2013 and June 2014, we obtained supine and standing radiographs for all new patients younger than 60 years who were evaluated for hip pain, when the diagnosis of fracture was not being considered; these formed the basis of this retrospective study. Patients were excluded if they had arthritis (Tönnis grade ≥ 2), lumbar fusion, previous hip surgery, or malrotated films. Forty-six hips, symptomatic side, met the inclusion criteria (age of patients, 33 ± 14 years; 13 males, 33 females). Radiographic data that were collected included SC-S distance, T-S distance, LCE angle, acetabular inclination, presence and percentage of crossover sign, and presence of ischial spine sign. A paired t-test was used to compare continuous variables and chi-square test was used for categorical variables. Two independent readers performed measurements. From supine to standing films, the T-S distance decreased from 19 ± 18 mm to 6 ± 19 mm (p pain, specifically pincer femoroacetabular impingement. Surgeons should use caution in interpreting supine AP

  4. Cross sectional CT morphology of the three lower lumbar vertebrae: with contributions to a more accurate interpretation of AP radiographs of the lumbar spine

    International Nuclear Information System (INIS)

    Schaik, J.P.J. van.

    1984-01-01

    This thesis is concerned with a cross-sectional morphological analysis of certain structures contained in the bony portion of the motion segments between L3 and S1, the vertebral bodies included. Measurements of lengths and angles were based on the use of constant reference points, which permitted comparative studies. Reference points were selected which were sufficiently well defined as to avoid gross errors in measurements. The lateral borders of the vertebral body of L3 are well visualized in AP radiographs, as well as the entire circumference of the pedicles. The bony cortical margins of these structures are more or less orientated in a sagittal direction, and are therefore caught by the X ray beam tangentially over the major part of their length. This tangential projection results in a sharp definition of these margins. Radiographic analysis of wired specimens of lumbar vertebrae showed that the shadow cast by the spinous process in the AP projection corresponds with its posterior portion. (Auth.)

  5. Measurement of hemothorax amount in patients with non-penetrating chest trauma by supine chest AP radiograph

    Energy Technology Data Exchange (ETDEWEB)

    Han, Heon; Yang, Joo Hyun; Na, Myung Hoon; Baik, Hee Jong [Chung-Ang Gil Hospital, Incheon (Korea, Republic of)

    1994-10-15

    To evaluate the predictability of amount of hemothorax in the patients with blunt chest trauma, supine chest AP radiographs of 66 patients were reviewed and statistically analyzed. In 66 patients, rib fractures were present in 53 patients, hemothorax in 46 patients, pneumothorax in 25 patients, and pulmonary contusions in 18 patients. Width and length of hemothorax were measured on supine chest AP radiograph, and were correlated with known drained amount of hemothorax. The presence and number of rib fracture, pulmonary contusion, subcutaneous emphysema, fracture of scapula and clavicle, and total opacification of hemithorax were also correlated with the drained amount of hemothorax. In multiple logistic regression analysis, width of hemothorax had the highest correlation with drained amount of hemothorax(regression coeffcient 0.718, p value 0.00005). The presence and number of rib fracture, scapular fracture, subcutaneous emphysema were also correlated with drained amount of hemothorax. But length of hemothorax, pulmonary contusion, clavicular fracture, total opacification of hemithorax were not correlated with drained amount of hemothorax. Measured width of hemothorax in supine chest AP radiograph is the most reliable predictor for estimation of the amount of hemothorax, and may also be used as an indication for the application of closed thoracostomy in the treatment of hemothorax.

  6. Antiphospholipid syndrome (APS) revisited: Would migraine headaches be included in future classification criteria?

    Science.gov (United States)

    Noureldine, Mohammad Hassan A; Haydar, Ali A; Berjawi, Ahmad; Elnawar, Rody; Sweid, Ahmad; Khamashta, Munther A; Hughes, Graham R V; Uthman, Imad

    2017-02-01

    Headaches have been extensively reported in Antiphospholipid syndrome (APS)/Antiphospholipid antibodies (aPL)-positive patients. The aim of this study was to highlight the prevalence of headaches among APS/aPL-positive patients and discuss its association with laboratory, clinical and imaging findings. We searched the literature through Google Scholar and PubMed for publications on the epidemiology, pathogenesis, laboratory, imaging and clinical findings, and management of headaches in APS/aPL-positive patients. The following keywords were used: Antiphospholipid, Hughes syndrome, anticardiolipin, lupus anticoagulant, anti-β2 glycoprotein I, headache, migraine, tension, and cluster. All reports published between 1969 and 2015 were included. Migraine is the most commonly reported type of headache in APS/aPL-positive patients. Thrombotic and platelet dysfunction hypotheses have been studied to uncover the pathogenic role of aPL in the development of headaches. Several studies are reporting higher levels of aPL in primary and secondary APS migraineurs, but only few reached statistical significance. Migraine patients without clinical signs/symptoms of cerebral infarction rarely show positive imaging findings. Digital subtraction angiography shows promise in demonstrating small vascular lesions otherwise not detected on computed tomography, magnetic resonance imaging, or cerebral angiograms. Although it may be solitary and harmless in many cases, the deleterious effect of migraine on the quality of life of APS patients prompts rapid diagnosis and proper management. An anticoagulation trial is advisable in APS patients with migraine as many cases of severe, refractory migraine resolved with anticoagulation therapy. The profile of migraine headaches discussed in this study permits its candidacy for inclusion in future APS classification criteria.

  7. 77 FR 50100 - AP&G Holdings LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for...

    Science.gov (United States)

    2012-08-20

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER12-2430-000] AP&G Holdings LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for Blanket Section 204 Authorization This is a supplemental notice in the above-referenced proceeding, of AP&G Holdings...

  8. The dyad palindromic glutathione transferase P enhancer binds multiple factors including AP1.

    Science.gov (United States)

    Diccianni, M B; Imagawa, M; Muramatsu, M

    1992-10-11

    Glutathione Transferase P (GST-P) gene expression is dominantly regulated by an upstream enhancer (GPEI) consisting of a dyad of palindromically oriented imperfect TPA (12-O-tetradecanoyl-phorbol-13-acetate)-responsive elements (TRE). GPEI is active in AP1-lacking F9 cells as well in AP1-containing HeLa cells. Despite GPEI's similarity to a TRE, c-jun co-transfection has only a minimal effect on transactivation. Antisense c-jun and c-fos co-transfection experiments further demonstrate the lack of a role for AP1 in GPEI mediated trans-activation in F9 cells, although endogenously present AP1 can influence GPEI in HeLa cells. Co-transfection of delta fosB with c-jun, which forms an inactive c-Jun/delta FosB heterodimer that binds TRE sequences, inhibits GPEI-mediated transcription in AP1-lacking F9 cells as well as AP1-containing HeLa cells. These data suggest novel factor(s) other than AP1 are influencing GPEI. Binding studies reveal multiple nucleoproteins bind to GPEI. These factors are likely responsible for the high level of GPEI-mediated transcription observed in the absence of AP1 and during hepatocarcinogenesis.

  9. Improvement in Detection of Wrong-Patient Errors When Radiologists Include Patient Photographs in Their Interpretation of Portable Chest Radiographs.

    Science.gov (United States)

    Tridandapani, Srini; Olsen, Kevin; Bhatti, Pamela

    2015-12-01

    This study was conducted to determine whether facial photographs obtained simultaneously with radiographs improve radiologists' detection rate of wrong-patient errors, when they are explicitly asked to include the photographs in their evaluation. Radiograph-photograph combinations were obtained from 28 patients at the time of portable chest radiography imaging. From these, pairs of radiographs were generated. Each unique pair consisted of one new and one old (comparison) radiograph. Twelve pairs of mismatched radiographs (i.e., pairs containing radiographs of different patients) were also generated. In phase 1 of the study, 5 blinded radiologist observers were asked to interpret 20 pairs of radiographs without the photographs. In phase 2, each radiologist interpreted another 20 pairs of radiographs with the photographs. Radiologist observers were not instructed about the purpose of the photographs but were asked to include the photographs in their review. The detection rate of mismatched errors was recorded along with the interpretation time for each session for each observer. The two-tailed Fisher exact test was used to evaluate differences in mismatch detection rates between the two phases. A p value of error detection rates without (0/20 = 0%) and with (17/18 = 94.4%) photographs were different (p = 0.0001). The average interpretation times for the set of 20 radiographs were 26.45 (SD 8.69) and 20.55 (SD 3.40) min, for phase 1 and phase 2, respectively (two-tailed Student t test, p = 0.1911). When radiologists include simultaneously obtained photographs in their review of portable chest radiographs, there is a significant improvement in the detection of labeling errors. No statistically significant difference in interpretation time was observed. This may lead to improved patient safety without affecting radiologists' throughput.

  10. The dyad palindromic glutathione transferase P enhancer binds multiple factors including AP1.

    OpenAIRE

    Diccianni, M B; Imagawa, M; Muramatsu, M

    1992-01-01

    Glutathione Transferase P (GST-P) gene expression is dominantly regulated by an upstream enhancer (GPEI) consisting of a dyad of palindromically oriented imperfect TPA (12-O-tetradecanoyl-phorbol-13-acetate)-responsive elements (TRE). GPEI is active in AP1-lacking F9 cells as well in AP1-containing HeLa cells. Despite GPEI's similarity to a TRE, c-jun co-transfection has only a minimal effect on transactivation. Antisense c-jun and c-fos co-transfection experiments further demonstrate the lac...

  11. 77 FR 9227 - AP Gas & Electric (NJ), LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2012-02-16

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Gas & Electric (NJ), LLC; Supplemental Notice That Initial Market-Based... above-referenced proceeding of AP Gas & Electric (NJ), LLC's application for market-based rate authority...

  12. 77 FR 9227 - AP Gas & Electric (NY), LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2012-02-16

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Gas & Electric (NY), LLC; Supplemental Notice That Initial Market-Based... above-referenced proceeding of AP Gas & Electric (NY), LLC's application for market-based rate authority...

  13. 75 FR 70738 - AP Gas & Electric (PA), LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2010-11-18

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Gas & Electric (PA), LLC; Supplemental Notice That Initial Market-Based... supplemental notice in the above-referenced proceeding AP Gas & Electric (PA), LLC's application for market...

  14. 77 FR 9228 - AP Gas & Electric (MD), LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2012-02-16

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Gas & Electric (MD), LLC; Supplemental Notice That Initial Market-Based... above-referenced proceeding of AP Gas & Electric (MD), LLC's application for market-based rate authority...

  15. 75 FR 44788 - AP Holdings, LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes Request for...

    Science.gov (United States)

    2010-07-29

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Holdings, LLC; Supplemental Notice That Initial Market-Based Rate Filing... above-referenced proceeding of AP Holdings, LLC's application for market-based rate authority, with an...

  16. 77 FR 9228 - AP Gas & Electric (IL), LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2012-02-16

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Gas & Electric (IL), LLC; Supplemental Notice That Initial Market-Based... above-referenced proceeding of AP Gas & Electric (IL), LLC's application for market-based rate authority...

  17. 76 FR 6613 - AP Gas & Electric (TX), LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2011-02-07

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Gas & Electric (TX), LLC; Supplemental Notice That Initial Market-Based... supplemental notice in the above-referenced proceeding of AP Gas & Electric (TX), LLC's application for market...

  18. 77 FR 9227 - AP Gas & Electric (OH), LLC; Supplemental Notice That Initial Market-Based Rate Filing Includes...

    Science.gov (United States)

    2012-02-16

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission AP Gas & Electric (OH), LLC; Supplemental Notice That Initial Market-Based... above-referenced proceeding of AP Gas & Electric (OH), LLC's application for market-based rate authority...

  19. Combined scintigraphic and radiographic diagnosis of bone and joint diseases. Including gamma correction interpretation. 4. rev. and enl. ed.

    Energy Technology Data Exchange (ETDEWEB)

    Bahk, Yong-Whee [Sung Ae General Hospital, Seoul (Korea, Republic of). Dept. of Nuclear Medicine and Radiology

    2013-07-01

    In this fourth edition of Combined Scintigraphic and Radiographic Diagnosis of Bone and Joint Diseases, the text has been thoroughly amended, updated, and partially rearranged to reflect the latest advances. In addition to discussing the role of pinhole imaging in the range of disorders previously covered, the new edition pays detailed attention to the novel diagnostic use of gamma correction pinhole bone scan in a broad spectrum of skeletal disorders, including physical, traumatic, and sports injuries, infectious and non-infectious bone diseases, benign and malignant bone tumors, and soft tissue diseases. A large number of state of the art pinhole scans and corroborative CT, MRI, and/or ultrasound images are presented side by side. The book has been enlarged to encompass various new topics, including occult fractures; cervical sprain and whiplash trauma; bone marrow edema; microfractures of trabeculae; evident, gaping, and stress fractures; and differential diagnosis. This new edition will be essential reading for practitioners and researchers in not only nuclear medicine but also radiology, orthopedic surgery, and pathology.

  20. Combined scintigraphic and radiographic diagnosis of bone and joint diseases. Including gamma correction interpretation. 4. rev. and enl. ed.

    International Nuclear Information System (INIS)

    Bahk, Yong-Whee

    2013-01-01

    In this fourth edition of Combined Scintigraphic and Radiographic Diagnosis of Bone and Joint Diseases, the text has been thoroughly amended, updated, and partially rearranged to reflect the latest advances. In addition to discussing the role of pinhole imaging in the range of disorders previously covered, the new edition pays detailed attention to the novel diagnostic use of gamma correction pinhole bone scan in a broad spectrum of skeletal disorders, including physical, traumatic, and sports injuries, infectious and non-infectious bone diseases, benign and malignant bone tumors, and soft tissue diseases. A large number of state of the art pinhole scans and corroborative CT, MRI, and/or ultrasound images are presented side by side. The book has been enlarged to encompass various new topics, including occult fractures; cervical sprain and whiplash trauma; bone marrow edema; microfractures of trabeculae; evident, gaping, and stress fractures; and differential diagnosis. This new edition will be essential reading for practitioners and researchers in not only nuclear medicine but also radiology, orthopedic surgery, and pathology.

  1. Is the lateral radiograph necessary for the management of intra-capsular proximal femoral fractures?

    International Nuclear Information System (INIS)

    Korim, Muhammad Tawfiq; Mohan Reddy, Venthurla Ram; Gibbs, David; Wildin, Clare

    2012-01-01

    Aims: To investigate if a lateral hip radiograph is always needed in the management of intra-capsular proximal femoral fractures. Furthermore, we sought to evaluate if a radiographer could accurately identify cases in which the lateral radiograph is not required. Methods: All patients who underwent surgical management of an intra-capsular proximal femoral fracture over a 3 month period at our unit were identified. Radiographs were reviewed by 6 observers: 2 consultant orthopaedic surgeons, 2 registrars, and 2 radiographers. Initially the observers viewed the AP radiographs alone and classified the fractures into displaced, undisplaced, or unclear categories. They were then shown the lateral view and asked for a diagnosis and management plan. Comparison of diagnosis and management based on AP views alone, and AP in-combination with a lateral view was made. Results: 90 patients were included; the mean age was 80.8 years with a range of 42–100 years. 73 underwent arthroplasty and 17 had internal fixation. All observers, including the radiographer were able to make a surgical decision in 90% of the cases based on AP views alone. Lateral radiographs improved the diagnostic accuracy by 6%. The availability of the lateral view did not alter the management in patients where the AP clearly demonstrated a displaced fracture. Conclusion: Elderly patients with a displaced intra-capsular fracture identifiable on the AP do not require a lateral radiograph. Such patients can be accurately identified by the radiographer. Patient discomfort experienced during positioning for the lateral view would be avoided, and a financial saving made.

  2. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  3. Applied pathology for radiographers

    International Nuclear Information System (INIS)

    Laudicina, P.

    1987-01-01

    This book presents a basic text for the student of radiologic sciences. It includes most of the pathology recommended by the ASRT Curriculum Guide. Radiographic technique and positioning are examined when relevant to obtaining quality radiographs of specific disease conditions. Brief overviews of these conditions include background etiology, diagnosis, treatment and prognosis. Many illustrations are included to enhance understanding

  4. Got AP?

    Science.gov (United States)

    Digby, Joan

    2016-01-01

    Families, especially those considering sending their children to a private four-year university, need all the help they can get in funding college. Annmarie Guzy's essay "AP, Dual Enrollment, and the Survival of Honors Education" in this issue powerfully spells out the financial benefits that accrue from using AP courses to satisfy…

  5. Radiographic evaluations

    International Nuclear Information System (INIS)

    Williams, J.L.

    1988-01-01

    The author describes how to: perform a systematic evaluation of a chest radiograph; state the classic radiographic description of hyaline membrane disease; list the conditions that cause hyperaeration and describe the radiologic feature of hyperaeration; describe the radiograph of a patient with a congenital diaphragmatic hernia; identify optimum placement of an endotracheal tube, gastric feeding tube, and umbilical artery catheter on a radiograph; differentiate between pulmonary interstitial air and hyaline membrane disease; select radiographic features that would indicate the presence of a tension pneumothorax; describe a lateral decubitus projection and state the type of problem it is most often used to identify; explain the procedure used in obtaining a lateral neck radiograph and list two problems that may require this view; and describe the radiograph of a patient with cystic fibrosis

  6. Transcriptional regulation of PP2A-A alpha is mediated by multiple factors including AP-2alpha, CREB, ETS-1, and SP-1.

    Directory of Open Access Journals (Sweden)

    He-Ge Chen

    2009-09-01

    Full Text Available Protein phosphatases-2A (PP-2A is a major serine/threonine phosphatase and accounts for more than 50% serine/threonine phosphatase activity in eukaryotes. The holoenzyme of PP-2A consists of the scaffold A subunit, the catalytic C subunit and the regulatory B subunit. The scaffold subunits, PP2A-A alpha/beta, provide a platform for both C and B subunits to bind, thus playing a crucial role in providing specific PP-2A activity. Mutation of the two genes encoding PP2A-A alpha/beta leads to carcinogenesis and likely other human diseases. Regulation of these genes by various factors, both extracellular and intracellular, remains largely unknown. In the present study, we have conducted functional dissection of the promoter of the mouse PP2A-A alpha gene. Our results demonstrate that the proximal promoter of the mouse PP2A-A alpha gene contains numerous cis-elements for the binding of CREB, ETS-1, AP-2 alpha, SP-1 besides the putative TFIIB binding site (BRE and the downstream promoter element (DPE. Gel mobility shifting assays revealed that CREB, ETS-1, AP-2 alpha, and SP-1 all bind to PP2A-A alpha gene promoter. In vitro mutagenesis and reporter gene activity assays reveal that while SP-1 displays negative regulation, CREB, ETS-1 and AP-2A alpha all positively regulate the promoter of the PP2A-A alpha gene. ChIP assays further confirm that all the above transcription factors participate the regulation of PP2A-A alpha gene promoter. Together, our results reveal that multiple transcription factors regulate the PP2A-A alpha gene.

  7. A radiographic study of pediatric ulnar anatomy.

    Science.gov (United States)

    Cravino, Mattia; Oni, Julius K; Sala, Debra A; Chu, Alice

    2014-01-01

    The adult ulna has a unique bony architecture that has been described in the literature, but, to the best of our knowledge, the ulnar anatomy in children has not been described. We examined 75 anteroposterior (AP) and 64 lateral radiographs (29 were bilateral) of 50, 0.5- to 11-year-old, healthy children's forearms. On AP radiographs, the total ulnar length, the ulnar proximal angle, the ulnar distal angle, and the distance between each angle from the tip of the triceps insertion; and, on lateral radiographs, the ulnar length and bow deviation were measured. The correlation between age and radiographic measurements, differences based on sex, differences compared with adults' measurements, and interobserver/intraobserver reliability were assessed. Age had a very strong/strong positive correlation with length/distance measurements on both AP and lateral radiographs. Only AP ulnar distal angle was significantly different between sexes (females > males). Compared with the adult ulnar studies, the AP proximal angle in children is significantly smaller and the location of this angle is significantly more distal. Interobserver and intraobserver reliability were very good for length/distance measurements on AP and lateral radiographs. The knowledge of pediatric ulnar anatomy could be helpful in the treatment of forearm deformities due to multiple hereditary exostosis and osteogenesis imperfecta, and in the treatment of ulnar fractures, particularly in Monteggia variants, where restoration of the correct forearm anatomy is essential to obtain good clinical and functional results. Study of diagnostic test, Level II.

  8. Radiographic testing

    International Nuclear Information System (INIS)

    Kuster, J.

    1978-01-01

    In view of great differencies in X-ray transmission it is more difficult to get optimum radiographs of plastics and especially of reinforced plastics than for example of metals. A procedure will be reported how to get with little effort optimum radiographs especially also in the range of long wave-length radiation corresponding 10 to 25 kV.P. (orig.) [de

  9. Plain chest radiographic findings of smoke inhalation

    International Nuclear Information System (INIS)

    Lee, Shin Ho; Lee, Eil Weong; Kim, Hyun Suk; Park, Ju Youn; Kim, Soo Hyun; Hong, Sung Hwan; Park, Hong Suk; Lee, Kwan Seop; Kang Ik Won

    2000-01-01

    To evaluate the plain chest radiographic findings of smoke inhalation. Our study included 72 burn patients who had suffered smoke inhalation. On admission, all underwent serial portable chest AP radiography. We retrospectively reviewed the plain chest radiographs taken between admission and pootburn day five, evaluating the pattern, distribution, and time onset of direct injury to the respiratory system by smoke inhalation. The lesions were also assessed for change. In 16 of 72 patients (22%), abnormal findings of direct injury to the respiratory system by smoke inhalation were revealed by the radiographs. Abnormal findings were 15 pulmonary lesions and one subglottic tracheal narrowing. Findings of pulmonary lesions were multiple small patchy consolidations (10/15), peribronchial cuffing (8/15), and perivascular fuzziness (6/15). Patterns of pulmonary lesions were mixed alveolar and interstitial lesion (n=3D9), interstitial lesion (n=3D5), and alveolar lesion (n=3D1). No interlobular septal thickening was observed. Pulmonary edema was distributed predominantly in the upper lung zone and perihilar region, with asymmetricity. Its time of onset was within 24 hours in 13 cases, 24-48 hours in two cases, and 48-72 hours in one. Five of 16 patients progressed to ARDS. Chest radiographs showed that pulmonary lesions caused by inhalation injury were due to pulmonary edema, which the pattern of which was commonly mixed alveolar and interstitial. (author)

  10. Radiographic Test

    Energy Technology Data Exchange (ETDEWEB)

    Lee, H.J; Yang, S.H. [Korea Electric Power Research Institute, Taejon (Korea)

    2002-07-01

    This report contains theory, procedure technique and interpretation of radiographic examination and written for whom preparing radiographic test Level II. To determine this baseline of technical competence in the examination, the individual must demonstrate a knowledge of radiography physics, radiation safety, technique development, radiation detection and measurement, facility design, and the characteristics of radiation-producing devices and their principles of operation. (author) 98 figs., 23 tabs.

  11. Radiographic positioning

    International Nuclear Information System (INIS)

    Eisenberg, R.L.; Dennis, C.A.; May, C.

    1989-01-01

    This book concentrates on the routine radiographic examinations commonly performed. It details the wide variety of examinations possible and their place in initial learning and in the radiology department as references for those occasions when an unusual examination is requested. This book provides information ranging from basic terminology to skeletal positioning to special procedures. Positions are discussed and supplemented with a picture of a patient, the resulting radiograph, and a labeled diagram. Immobilization and proper shielding of the patient are also shown

  12. APS Science 2006

    International Nuclear Information System (INIS)

    Gibson, J.M.; Fenner, R.B.; Long, G.; Borland, M.; Decker, G.

    2007-01-01

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R and D. The ERL(at)APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged

  13. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  14. Renal involvement in the antiphospholipid syndrome (APS)-APS nephropathy.

    Science.gov (United States)

    Tektonidou, Maria G

    2009-06-01

    Although the kidney represents a major target organ in antiphospholipid syndrome (APS), renal involvement in APS was poorly recognized until recently. The most well-recognized renal manifestations of APS are the renal artery thrombosis/stenosis, renal infarction, hypertension, renal vein thrombosis, end-stage renal disease, increased allograft vascular thrombosis, some types of glomerular disease, and a small-vessel vaso-occlusive nephropathy, recently defined as APS nephropathy. APS nephropathy was first described in primary APS patients, characterized by acute thrombotic lesions in glomeruli and/or arterioles (thrombotic microangiopathy) and chronic vascular lesions such as fibrous intimal hyperplasia of arterioles and interlobular arteries, organized thrombi with or without recanalization, and fibrous arterial and arteriolar occlusions or focal cortical atrophy. APS nephropathy was also detected in further studies including patients with systemic lupus erythematosus (SLE)-related APS and SLE/non-APS patients with positive antiphospholipid antibodies, independently of lupus nephritis. The same histologic lesions, especially thrombotic mictroangiopathy, were also observed in patients with catastrophic APS. The most frequent clinical and laboratory characteristics of APS nephropathy in all the above groups of patients are hypertension (often severe), proteinuria (ranging from mild to nephrotic range), hematuria, and acute or chronic renal insufficiency.

  15. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  16. AMENABILITY OF ap (S)

    OpenAIRE

    A.M. Aminpour; Mehrdad Seilani

    2013-01-01

    In this paper, we present an important new theorem for amenability of ap(S). The set of all almost periodic functions on S is denoted by ap(S). We develop the fundamental theory of almost periodic function on a general semitopological semigroup. The principal result is that ap(S) is amenable if and only if ap(S) = Sap(S) ⊕ F0 [Theorem 3.1]. Mathematical society classification:2010 MSC. 18340

  17. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  18. APS power supply controls

    International Nuclear Information System (INIS)

    Saunders, C.W.; Despe, O.D.

    1994-01-01

    The purpose of this document is to provide comprehensive coverage of the APS power supply control design. This includes application software, embedded controller software, networks, and hardware. The basic components will be introduced first, followed by the requirements driving the overall design. Subsequent sections will address each component of the design one by one. Latter sections will address specific applications

  19. The one-leg standing radiograph

    OpenAIRE

    Pinsornsak, P.; Naratrikun, K.; Kanitnate, S.; Sangkomkamhang, T.

    2016-01-01

    Objectives The purpose of this study was to compare the joint space width between one-leg and both-legs standing radiographs in order to diagnose a primary osteoarthritis of the knee. Methods Digital radiographs of 100 medial osteoarthritic knees in 50 patients were performed. The patients had undergone one-leg standing anteroposterior (AP) views by standing on the affected leg while a both-legs standing AP view was undertaken while standing on both legs. The severity of the osteoarthritis wa...

  20. Oblique lumbar spine radiographs: importance in young patients

    Energy Technology Data Exchange (ETDEWEB)

    Libson, E.; Bloom, R.A.; Dinari, G.; Robin, G.C.

    1984-04-01

    Spondylolysis is a direct precursor of spondylolisthesis and can lead to crippling back pain. Of 1,743 patients surveyed, including 936 who were asymptomatic and 807 with back pain, 165 (including 91 who were asymptomatic and 74 with back pain) had spondylolysis, which was seen only on oblique lumbar views in 20% of cases. Because of the high false-negative rate of AP and lateral views, oblique views are essential in children and young adults. As spondylolysis is rare above L3, radiographs can be limited to L3-S1. Significantly less spondylolysis was seen in persons older than 30 with back pain usually caused by disk degeneration.

  1. Oblique lumbar spine radiographs: importance in young patients

    International Nuclear Information System (INIS)

    Libson, E.; Bloom, R.A.; Dinari, G.; Robin, G.C.

    1984-01-01

    Spondylolysis is a direct precursor of spondylolisthesis and can lead to crippling back pain. Of 1,743 patients surveyed, including 936 who were asymptomatic and 807 with back pain, 165 (including 91 who were asymptomatic and 74 with back pain) had spondylolysis, which was seen only on oblique lumbar views in 20% of cases. Because of the high false-negative rate of AP and lateral views, oblique views are essential in children and young adults. As spondylolysis is rare above L3, radiographs can be limited to L3-S1. Significantly less spondylolysis was seen in persons older than 30 with back pain usually caused by disk degeneration

  2. Radiographers and trainee radiologists reporting accident radiographs

    DEFF Research Database (Denmark)

    Buskov, L; Abild, A; Christensen, A

    2013-01-01

    To compare the diagnostic accuracy and clinical validity of reporting radiographers with that of trainee radiologists whom they have recently joined in reporting emergency room radiographs at Bispebjerg University Hospital.......To compare the diagnostic accuracy and clinical validity of reporting radiographers with that of trainee radiologists whom they have recently joined in reporting emergency room radiographs at Bispebjerg University Hospital....

  3. Interpretation of panoramic radiographs.

    Science.gov (United States)

    Perschbacher, Susanne

    2012-03-01

    Panoramic radiography has become a commonly used imaging modality in dental practice and can be a valuable diagnostic tool in the dentist's armamentarium. However, the panoramic image is a complex projection of the jaws with multiple superimpositions and distortions which may be exacerbated by technical errors in image acquisition. Furthermore, the panoramic radiograph depicts numerous anatomic structures outside of the jaws which may create additional interpretation challenges. Successful interpretation of panoramic radiographs begins with an understanding of the normal anatomy of the head and neck and how it is depicted in this image type. This article will describe how osseous structures, soft tissues, air spaces and ghost shadows contribute to the final panoramic image. A systematic and repeated approach to examining panoramic radiographs, which is recommended to ensure that critical findings are not overlooked, is also outlined. Examples of challenging interpretations, including variations of anatomy, artefacts and disease, are presented to illustrate these concepts. © 2012 Australian Dental Association.

  4. Radiographic element

    International Nuclear Information System (INIS)

    Abbott, T.I.; Jones, C.G.

    1983-01-01

    Radiographic elements are disclosed having first and second silver halide emulsion layers comprised of a dispersing medium and radiation-sensitive silver halide grains, and a support interposed between said silver halide emulsion layers capable of transmitting radiation to which said second silver halide emulsion layer is responsive. These elements are characterized in that at least said first silver halide emulsion layer contains tabular silver halide grains and spectral sensitizing dye adsorbed to the surface of the grains. Crossover can be improved in relation to the imaging characteristics. (author)

  5. Computed tomography for radiographers

    International Nuclear Information System (INIS)

    Brooker, M.J.

    1986-01-01

    This book is directed towards giving radiographers an introduction to and basic knowledge of computerized tomography. The technical section discusses gantries and x-ray production, computer and disc drive image display, storage, artefacts quality assurance and design of departments. The clinical section includes patient preparation, radiotherapy planning, and interpretation of images from various areas of the anatomy. (U.K.)

  6. Radiographic tales

    DEFF Research Database (Denmark)

    Mussmann, Bo Redder

    Purpose Until now a large number of scientific studies have focused on technological aspects of radiography. This study is a step in another direction which examines the relationship between man and technology within radiography instead of considering man and technology as separate entities. Meth...... of their narrative alertness. Errors and failure to keep the time schedule can, however, lead the radiographers to a change of perspective that makes them displace man from the scene of radiography by playing on the premises of technology........ Methods The study is designed as an observational study with a narrative approach. The participant observations took place in a Danish radiological department and involved 20 examinations followed up by three semi-structured interviews. Conclusions Through emergent narratives radiographers construct...... and symptoms. The plot is organized in a relatively concrete and fairly limited space of possibilities, i.e. the number of different diagnoses that can be made. In opposition to the diagnostic plot stands the lifestory as a masterplot. In the lifestory the examination is plotted as a significant experience...

  7. Radiographer interpretation of trauma radiographs: Issues for radiography education providers

    International Nuclear Information System (INIS)

    Hardy, Maryann; Snaith, Beverly

    2009-01-01

    Background: The role of radiographers with respect to image interpretation within clinical practice is well recognised. It is the expectation of the professional, regulatory and academic bodies that upon qualification, radiographers will possess image interpretation skills. Additionally, The College of Radiographers has asserted that its aspiration is for all radiographers to be able to provide an immediate written interpretation on skeletal trauma radiographs by 2010. This paper explores the readiness of radiography education programmes in the UK to deliver this expectation. Method: A postal questionnaire was distributed to 25 Higher Education Institutions in the UK (including Northern Ireland) that provided pre-registration radiography education as identified from the Society and College of Radiographers register. Information was sought relating to the type of image interpretation education delivered at pre- and post-registration levels; the anatomical range of image interpretation education; and education delivery styles. Results: A total of 19 responses (n = 19/25; 76.0%) were received. Image interpretation education was included as part of all radiographer pre-registration programmes and offered at post-registration level at 12 academic centres (n = 12/19; 63.2%). The anatomical areas and educational delivery methods varied across institutions. Conclusion: Radiography education providers have embraced the need for image interpretation education within both pre- and post-registration radiography programmes. As a result, UK education programmes are able to meet the 2010 College of Radiographers aspiration.

  8. A systematic review of radiographic definitions of foot osteoarthritis in population-based studies.

    Science.gov (United States)

    Trivedi, B; Marshall, M; Belcher, J; Roddy, E

    2010-08-01

    To identify the methods used in population-based epidemiological studies to diagnose radiographic foot osteoarthritis (OA) and to estimate the population prevalence of radiographic foot OA. Electronic databases searched included Medline, Embase, CINAHL and Ageline (inception to May 2009). The search strategy combined search terms for radiography, OA, foot, and specific foot joints. Predetermined selection criteria were applied. Data extracted from each paper included: sample population, radiographic views taken, foot joints examined, scoring system used, definition of OA applied, reliability of radiographic scoring and prevalence of radiographic OA in the foot. Titles and abstracts of 1035 papers were reviewed and full-texts of 21 papers were obtained. Fifteen papers met inclusion criteria and a further 12 papers were included after screening references. Radiographic views were frequently not specified (NS) but a combination of antero-posterior (AP) and lateral (Lat) views was most commonly reported. The first metatarsophalangeal (MTP) joint was the most commonly examined joint (n=20, 74%). Nineteen studies (70%) used the Kellgren and Lawrence (K&L) grading system, 95% of which defined OA as K&L grade> or =2. Estimates of the prevalence of radiographic first MTP joint OA (defined as K&L> or =2) in middle-aged to older adults ranged from 6.3 to 39%. Significant statistical heterogeneity prevented pooling of prevalence estimates. There are comparatively few studies examining radiographic foot OA. Existing studies mainly focus on the first MTP joint and use the K&L grading system. Future studies are needed to quantify the prevalence of radiographic OA at the different joint complexes within the foot. Copyright 2010 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  9. Radiographic apparatus

    International Nuclear Information System (INIS)

    Lapidus, S.N.

    1979-01-01

    Raytheon Company, U.S.A. have patented an on-line electronic system of normalising the responses from the photomultiplier tubes used in conjunction with a scintillator in an X-ray radiographic camera. A problem with present cameras is that the individual photomultipliers have different intensity responses which also change in time with respect to each other. The individual responses of each photomultiplier tube are measured with a uniform sheet of radioactive material in front of the camera. The associated electronic equipment then calculates scaling factors which give all photomultiplier tubes an identical response and then places these factors in an addressable store. The store is then addressed in an on-line mode to produce a visual display of the transmitted X-rays. (U.K.)

  10. Chesneys' radiographic imaging. 5. ed.

    International Nuclear Information System (INIS)

    Ball, J.; Price, T.

    1989-01-01

    This new edition of Chesney and Chesney: Radiographic Imaging has been completely written by two new authors. The book reflects the change in emphasis in radiology from photographic processes towards electronic imaging methods. There is new material on image intensifiers and television imaging, digital imaging and digital subtractions. Analyses of the various characteristics of, and defects in, images on radiographs, xeroradiographs and the television screen are included. The methods, equipment and materials used to record the cathode ray tube image are described and there is new material on the principles of alternative diagnostic imaging techniques such as ultrasound, computed tomography and radionuclide imaging which provide cathode ray tube images. The book is primarily for student radiographers studying for the Diploma of the College of Radiographers, but radiographers studying for postdiplomate qualifications such as the Higher Diploma (HDCR) will also find the book helpful. (author)

  11. Ossificação da sutura palatina mediana após o procedimento de expansão rápida da maxila: estudo radiográfico Midpalatal suture ossification post rapid palatal expansion: a radiographic study

    Directory of Open Access Journals (Sweden)

    Omar Gabriel da Silva Filho

    2008-04-01

    Full Text Available OBJETIVO: o presente trabalho tem como objetivo acompanhar radiograficamente a evolução da ossificação da sutura palatina mediana em pacientes submetidos à expansão rápida da maxila, bem como comprovar a validade de se avaliar a neoformação óssea através deste exame complementar de diagnóstico. METODOLOGIA: a amostra constou de 38 pacientes no estágio de dentadura mista que se submeteram ao protocolo de expansão rápida da maxila, sendo 2/4 de volta pela manhã e 2/4 de volta à noite, totalizando 1 volta completa por dia, compreendendo um período de 7 dias. RESULTADOS: radiografias oclusais de maxila tomadas no pós-tratamento evidenciaram uma variação individual quanto ao período necessário para a completa neoformação óssea da sutura palatina mediana. A imagem radiográfica apresentou-se como um método confiável para a determinação da época correta de remoção do aparelho expansor. Tendo em vista a estabilidade pós-tratamento a longo prazo, o aparelho expansor deve ser removido somente após a completa ossificação da sutura. CONCLUSÕES: os resultados revelaram que são necessários mais de três meses para que o processo de ossificação e reorganização sutural se processe após o procedimento de expansão rápida da maxila.OBJECTIVE: the current study aims at following up radiographically the evolution of the midpalatal suture during the expansion procedure since the opening of the suture until bone formation. METHODS: the sample comprised 38 patients in the mixed dentition stage submitted to the rapid palatal expansion protocol of the Hospital for Rehabilitation of Craniofacial Anomalies. RESULTS: it was observed an individual variation on the period of bone ossification of the midpalatal suture, which justifies the radiographic follow-up as determinant for the appliance removal. Due to long-term post-treatment stability, the expander should be removed after the new suture is completely formed. CONCLUSIONS

  12. APS Science 2007

    International Nuclear Information System (INIS)

    2008-01-01

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience

  13. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  14. Osteology for radiographers

    Energy Technology Data Exchange (ETDEWEB)

    Shillingford, C.

    1985-01-01

    Radiographers need a detailed knowledge of the skeleton and it is not easy to find the correct level of information in the textbooks available to date. This book aims to fill this void. Descriptions of individual bones are logical and easy to follow, and common examples of pathology are included for each bone. Self-assessment questions are given at the end of each paper to enable students to assess their acquired knowledge and to facilitate private study.

  15. Variability interexaminer of chronic apical periodontitis diagnostics in panoramic radiographs

    International Nuclear Information System (INIS)

    Montero Aguilar, Mauricio; Zeledon Mayorga, Rodolfo; Ramirez Mora, Tatiana; Monestel Umana, Silvia

    2009-01-01

    The accuracy of radiological diagnosis of Apical Periodontitis (AP) is reported between examiners with differents levels of clinical experience using panoramic radiographs. 1032 teeth in 41 panoramic radiographs have been diagnosed. The evaluation of the x-rays and radiological diagnosis is performed by three independent dentists for AP to each tooth. The teeth have presented without radiological signs of AP in 96.6%. The number of teeth classified with an uncertain diagnosis of AP at the has been inversely proportional to the number of years of experience of the examiner. The examiner A has been used as a reference and compared the diagnoses of other examiners.The percentage agreement for all teeth was 95% for examiner B and 94% for examiner C. Kappa for all has been of 0.44 for examiner B and 0.43 for examiner C. The different categories were analyzed separately, the inferior teeth and the anterior teeth have obtained the best results. The level of clinical experience of the examiner has been indifferent in the diagnosis of AP in panoramic radiographs; however, it is important experience in the number of radiographs extras that will be needed to give a radiological diagnosis definitive. The panoramic radiographs were reliable diagnostic tools for AP. (author) [es

  16. Are radiographs needed when MR imaging is performed for non-acute knee symptoms in patients younger than 45 years of age?

    Energy Technology Data Exchange (ETDEWEB)

    Braak, Bert P.M. ter; Vincken, Patrice W.J.; Erkel, Arian R. van; Bloem, Johan L. [Leiden University Medical Center, Department of Radiology, P.O. Box 9600, Leiden (Netherlands); Bloem, Rolf M. [Leiden University Medical Center, Department of Orthopaedic Surgery, Leiden (Netherlands); Napoleon, L.J.; Coene, M.N. [HAGA Hospital, Department of Orthopaedic Surgery, The Hague (Netherlands); Luijt, Peter A. van [Leiden University Medical Center, Department of Traumatology, Leiden (Netherlands); Lange, Sam de [Medical Center Haaglanden, Department of Orthopaedic Surgery, The Hague (Netherlands); Department of Orthopaedic Surgery, Delft (Netherlands)

    2007-12-15

    The objective was to determine the value of radiographs in young adults with non-acute knee symptoms who are scheduled for magnetic resonance imaging (MRI). Nine hundred and sixty-one consecutive patients aged between 16 and 45 years with knee symptoms of at least 4 weeks' duration were prospectively included in three participating hospitals. After applying exclusion criteria, 798 patients remained. Exclusion criteria were previous knee surgery (including arthroscopy) or MRI, history of rheumatoid arthritis, clinical diagnosis of retropatellar chondromalacia, contra-indication for MRI and recent trauma. We identified two groups: group A with no history of trauma (n = 332), and group B with an old (>4 weeks) history of trauma (n = 466). Patients had a standardized history taken, and underwent a physical exam, antero-posterior (AP) and lateral radiographs and MRI. We evaluated the radiographs and MRI for osseous lesions, articular surface lesions, fractures, osteoarthritis, loose bodies, bone marrow edema and incidental findings. Subsequently, patients with osseous abnormalities (Kellgren grade 1 and 2 excluded) on radiographs and a matched control group was evaluated again using MRI without radiographs. Median duration of symptoms was 20 weeks. In group A, radiographs showed 36 osseous abnormalities in 332 patients (10.8%). Only 13 of these, all Kellgren grade 1 osteoarthritis, were not confirmed on MRI. MRI showed 72 (21.7%) additional abnormalities not confirmed on radiographs. In group B, radiographs showed 40 osseous abnormalities (8.6%) in 466 patients. Only 15 of these, all Kellgren grade 1 osteoarthritis, were not confirmed on MRI. MRI showed 194 (41.6%) additional abnormalities not confirmed on radiographs. The second evaluation of MRI without radiographs in 34 patients was identical to the first MRI evaluation. Common lesions were significantly more often diagnosed with MRI than with radiographs. Radiographs should not be obtained routinely when MRI is

  17. Radiographic findings in immunodeficiency

    International Nuclear Information System (INIS)

    Obregon, R.; Lynch, D.A.; Cink, T.M.; Newell, J.D.; Kirkpatrick, C.

    1991-01-01

    This paper reviews the chest radiographs and high-resolution CT (HRCT) scans in patients with immunodeficiency disorders and define the role of HRCT. Thirty-three cases were retrospectively graded according to the consensus of two radiologists. Patients with HIV seropositivity and asthma were excluded. HRCT was performed in 12 cases with standard techniques. Diagnoses included common variable hypogammaglobulinemia (n = 19), X-linked agammaglobulinemia (n = 4), chronic mucocutaneous candidiasis (n = 4), and selective immunoglobulin g deficiencies (n = 2). Chest radiographs showed bronchiectasis in 11 of 33 cases with a predominant lower lobe distribution (82%). Nodules were present in six cases and mucus plugs in four cases. HRCT showed bronchiectasis in nine of 12 cases; in five of these nine cases, bronchiectasis was not apparent on chest radiographs. Other HRCT findings included segmental air trapping (four of 12), mucus plugs (three of 12), hazy consolidation (four of 12), nodules (five of 12), and bronchiolectasis (two of 12). Therapy was altered in seven of 12 cases in which HRCT was performed. Most pertinent to clinical management were the presence of a thymoma (n = 1) and severe focal of diffuse bronchiectasis

  18. Large Format Radiographic Imaging

    International Nuclear Information System (INIS)

    Rohrer, J. S.; Stewart, Lacey; Wilke, M. D.; King, N. S.; Baker A, S.; Lewis, Wilfred

    1999-01-01

    Radiographic imaging continues to be a key diagnostic in many areas at Los Alamos National Laboratory (LANL). Radiographic recording systems have taken on many form, from high repetition-rate, gated systems to film recording and storage phosphors. Some systems are designed for synchronization to an accelerator while others may be single shot or may record a frame sequence in a dynamic radiography experiment. While film recording remains a reliable standby in the radiographic community, there is growing interest in investigating electronic recording for many applications. The advantages of real time access to remote data acquisition are highly attractive. Cooled CCD camera systems are capable of providing greater sensitivity with improved signal-to-noise ratio. This paper begins with a review of performance characteristics of the Bechtel Nevada large format imaging system, a gated system capable of viewing scintillators up to 300 mm in diameter. We then examine configuration alternatives in lens coupled and fiber optically coupled electro-optical recording systems. Areas of investigation include tradeoffs between fiber optic and lens coupling, methods of image magnification, and spectral matching from scintillator to CCD camera. Key performance features discussed include field of view, resolution, sensitivity, dynamic range, and system noise characteristics

  19. Molecular evolution of the AP2 subfamily.

    Science.gov (United States)

    Shigyo, Mikao; Hasebe, Mitsuyasu; Ito, Motomi

    2006-02-01

    The AP2 (APETALA2)/EREBP (Ethylene Responsive Element Binding Protein) multigene family includes developmentally and physiologically important transcription factors. AP2/EREBP genes are divided into two subfamilies: AP2 genes with two AP2 domains and EREBP genes with a single AP2/ERF (Ethylene Responsive Element Binding Factor) domain. Based on previous phylogenetic analyses, AP2 genes can be divided into two clades, AP2 and ANT groups. To clarify the molecular evolution of the AP2 subfamily, we isolated and sequenced genes with two AP2 domains from three gymnosperms, Cycas revoluta, Ginkgo biloba, and Gnetum parvifolium,as well as from the moss Physcomitrella patens. Expressions of AP2-like genes, including AP2, in Arabidopsis thaliana are regulated by the microRNA miR172. We found that the target site of miR172 is significantly conserved in gymnosperm AP2 homologs, suggesting that regulatory mechanisms of gene expression using microRNA have been conserved over the three hundred million years since the divergence of gymnosperm and flowering plant lineages. We inferred a phylogenetic relationship of these genes with the green alga Chlamydomonas reinhardtii and seed-plant genes available in public DNA databases. The phylogenetic tree showed that the AP2 subfamily diverged into the AP2 and ANT groups before the last common ancestor of land plants and after C. reinhardtii diverged from the land-plant lineage. The tree also indicated that each AP2 and ANT group further diverged into several clades through gene duplications prior to the divergence of gymnosperms and angiosperms.

  20. Sensitivity of bedside ultrasound and supine anteroposterior chest radiographs for the identification of pneumothorax after blunt trauma.

    Science.gov (United States)

    Wilkerson, R Gentry; Stone, Michael B

    2010-01-01

    Supine anteroposterior (AP) chest radiographs in patients with blunt trauma have poor sensitivity for the identification of pneumothorax. Ultrasound (US) has been proposed as an alternative screening test for pneumothorax in this population. The authors conducted an evidence-based review of the medical literature to compare sensitivity of bedside US and AP chest radiographs in identifying pneumothorax after blunt trauma. MEDLINE and EMBASE databases were searched for trials from 1965 through June 2009 using a search strategy derived from the following PICO formulation of our clinical question: patients included adult (18 + years) emergency department (ED) patients in whom pneumothorax was suspected after blunt trauma. The intervention was thoracic ultrasonography for the detection of pneumothorax. The comparator was the supine AP chest radiograph during the initial evaluation of the patient. The outcome was the diagnostic performance of US in identifying the presence of pneumothorax in the study population. The criterion standard for the presence or absence of pneumothorax was computed tomography (CT) of the chest or a rush of air during thoracostomy tube placement (in unstable patients). Prospective, observational trials of emergency physician (EP)-performed thoracic US were included. Trials in which the exams were performed by radiologists or surgeons, or trials that investigated patients suffering penetrating trauma or with spontaneous or iatrogenic pneumothoraces, were excluded. The methodologic quality of the studies was assessed. Qualitative methods were used to summarize the study results. Data analysis consisted of test performance (sensitivity and specificity, with 95% confidence intervals [CIs]) of thoracic US and supine AP chest radiography. Four prospective observational studies were identified, with a total of 606 subjects who met the inclusion and exclusion criteria. The sensitivity and specificity of US for the detection of pneumothorax ranged from

  1. 10 CFR 34.46 - Supervision of radiographers' assistants.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Supervision of radiographers' assistants. 34.46 Section 34... REQUIREMENTS FOR INDUSTRIAL RADIOGRAPHIC OPERATIONS Radiation Safety Requirements § 34.46 Supervision of... personal supervision of a radiographer. The personal supervision must include: (a) The radiographer's...

  2. Análise radiográfica computadorizada da reabsorção radicular apical após a utilização de duas mecânicas ortodônticas Computer-assisted radiographic evaluation of apical root resorption following orthodontic treatment with two different fixed appliance techniques

    Directory of Open Access Journals (Sweden)

    Eduardo César Almada Santos

    2007-02-01

    Full Text Available OBJETIVO: a reabsorção radicular apical é uma condição comumente observada durante e após o tratamento ortodôntico e fatores como tipo de aparelhagem ortodôntica utilizada, magnitude das forças aplicadas e duração do tratamento podem estar relacionados ao processo de arredondamento do ápice radicular. Buscou-se avaliar, por meio de imagens radiográficas computadorizadas, a quantidade de reabsorção no ápice radicular, quando da utilização de duas diferentes técnicas de mecânica ortodôntica fixa: Edgewise com acessórios padrão e Edgewise com acessórios totalmente programados. METODOLOGIA: a amostra constituiu-se de 20 pacientes tratados pelo mesmo profissional na Clínica de Ortodontia da Faculdade de Odontologia de Araçatuba - UNESP. Os pacientes foram divididos em dois grupos: grupo 1 (Tratados com Edgewise com acessórios padrão e fios de aço e grupo 2 (Tratados com Edgewise com acessórios totalmente programados e fios de níquel-titânio. A avaliação radiográfica digital foi realizada por um único operador por meio de exposições radiográficas digitais feitas no início do tratamento ortodôntico, após retração de caninos e final de tratamento, utilizando o sistema de escores proposto por Levander e Malmgren (1988. RESULTADOS E CONCLUSÕES: a análise dos escores permitiu concluir que o tratamento ortodôntico empregando a técnica Edgewise com acessórios totalmente programados e fios de níquel-titânio apresentou menores graus de reabsorção radicular apical, em comparação à técnica Edgewise com acessórios padrão e fios de aço. Observou-se que, independentemente da técnica empregada, o tratamento ortodôntico como um todo apresentou um grau moderado de reabsorção radicular apical.AIM: external apical root resorption is frequently observed during and after orthodontic treatment and can be related to factors such as mechanical factors, magnitude of forces and treatment time with fixed appliances

  3. Peritoneal tuberculosis: radiographic diagnosis

    Directory of Open Access Journals (Sweden)

    Carolina Ospina-Moreno

    2014-12-01

    Full Text Available Peritoneal tuberculosis (TB is an extrapulmonary form of presentation of tuberculosis. HIV infection is a primary risk factor for this condition. Diagnosis requires microbiological or histopathological confirmation in addition to supporting radiological imaging studies. Abdominal ultrasonography and CT are useful to obtain a radiographic diagnosis, with typical findings including diffuse peritoneal thickening, presence of ascites in varying volumes, adenopathies, and caseating nodes. We report 2 cases of patients with ascites and nodular peritoneal thickening on diagnostic images, as well as high CA-125 levels in laboratory tests. In both patients, a diagnosis of peritoneal tuberculosis was reached following a US-guided peritoneal biopsy.

  4. Advanced Photon Source (APS)

    Data.gov (United States)

    Federal Laboratory Consortium — The Advanced Photon Source (APS) at the U.S. Department of Energy's Argonne National Laboratoryprovides this nation's (in fact, this hemisphere's) brightest storage...

  5. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  6. [Apheresis in antiphospholipid syndrome (APS)].

    Science.gov (United States)

    De Silvestro, Giustina; Tison, Tiziana; Marson, Piero

    2012-01-01

    Antiphospholipid syndrome (APS) is a rare clinical disorder characterized by thromboembolic manifestations and/or obstetric complications. Along with the clinical symptoms and signs, serum antiphospholipid antibodies have to be detected. APS can be primary, i.e., without any concomitant disorders, or secondary to other autoimmune diseases, particularly systemic lupus erythematosus. Criteria for the diagnosis of APS have been clearly established. Hyperacute APS (or catastrophic antiphospholipid syndrome), often with a poor prognosis, must meet four criteria: involvement of three or more organs, rapid evolution of clinical manifestations, microangiopathic occlusion of small blood vessels at biopsy, and presence of antiphospholipid antibodies. The rationale for apheresis treatment is the removal of pathogenetic antibodies involved in the development of tissue damage. Our experience includes 23 patients, in particular 15 women treated for 19 pregnancies. According to the National Guidelines Program, the effectiveness of apheresis in catastrophic syndrome has a level of evidence of V/VI, with a strength of recommendation A; in highrisk pregnancy it has a level of evidence of V with a strength of recommendation B. It will be necessary to better define the prognosis of various categories of pregnant patients with APS, as well as useful laboratory parameters to monitor its clinical course and anticipate any complications of pregnancy.

  7. Quality of radiograph

    International Nuclear Information System (INIS)

    Abdul Nassir Ibrahim; Azali Muhammad; Ab. Razak Hamzah; Abd. Aziz Mohamed; Mohamad Pauzi Ismail

    2008-01-01

    This chapter discussed on how to get a good radiograph. There are several factors that can make good radiograph such as density of radiograph, the contrast of radiograph, definition of radiograph, the present of artifact and backscattering. All of this factor will discuss detailed on each unit of chapter with some figure, picture to make the reader understand more when read this book. And at the end, the reader will introduce with penetrameter, one of device to determine the level of quality of the radiograph. There are two type of penetrameter like wire type or holes type. This standard must be followed by all the radiographer around the world to produce the good result that is standard and more reliable.

  8. Reference Neutron Radiographs of Nuclear Reactor Fuel

    DEFF Research Database (Denmark)

    Domanus, Joseph Czeslaw

    1986-01-01

    Reference neutron radiographs of nuclear reactor fuel were produced by the Euraton Neutron Radiography Working Group and published in 1984 by the Reidel Publishing Company. In this collection a classification is given of the various neutron radiographic findings, that can occur in different parts...... of pelletized, annular and vibro-conpacted nuclear fuel pins. Those parts of the pins are shown where changes of appearance differ from those for the parts as fabricated. Also radiographs of those as fabricated parts are included. The collection contains 158 neutron radiographs, reproduced on photographic paper...... (twice enlarged) and on duplicating film (original size)....

  9. Alterações radiográficas do tálus no pé torto congênito após liberação cirúrgica pela técnica de McKay Radiographic abnormalities of the talus in patients with clubfoot after surgical release using the McKay technique

    Directory of Open Access Journals (Sweden)

    José Antonio Pinto

    2011-01-01

    Full Text Available OBJETIVO: Analisar as alterações morfológicas do tálus após o tratamento cirúrgico do pé torto congênito pela técnica de McKay. MÉTODO: Foram analisadas, retrospectivamente, radiografias em perfil com carga dos pés de 14 pacientes com pé torto congênito unilateral submetidos ao tratamento pela técnica de McKay por dupla incisão. Todos os pacientes foram operados pelo mesmo cirurgião, com média de 6,53 anos entre a cirurgia e a radiografia. Comparamos as características do tálus dos pés operados com os parâmetros radiográficos dos pés contralaterais. Avaliamos a presença de deformidade do dômus e da cabeça do tálus (avaliação da esfericidade; a altura e o comprimento do tálus; a presença e grau de subluxação do navicular; a alteração do ângulo de Gissane; e o padrão do trabeculado ósseo. RESULTADOS: Alterações da cabeça do tálus ocorreram em 92,8% dos casos; do dômus em 92,8%; e do trabeculado em 100%. A relação entre o comprimento do tálus do pé operado sobre o contralateral variou de 0,61 a 0,88 (média de 0,79; DP = 0,09, e da altura de 0,57 a 0,98 (média de 0,82; DP = 0,12. O ângulo de Gissane aumentou em todos os pés operados, e todos apresentaram subluxação do navicular, com índice variando de 6,43 a 59,75% (média de 26,34%; DP = 16,66%. CONCLUSÃO: Alterações talares ocorreram em 100% dos pés tratados pela técnica de McKay. Estabelecer parâmetros radiográficos para descrever e quantificar essas deformidades mostrou-se viável, através de técnicas simples e de fácil execução.OBJECTIVE: To analyze morphological abnormalities of the talus in patients with clubfoot after surgical treatment using the McKay technique. METHOD: Lateral standing-position radiographs of the feet of 14 patients with unilateral clubfoot who underwent treatment by means of the double-incision McKay technique were retrospectively analyzed. All the patients were operated by the same surgeon, with an average

  10. Total elbow arthroplasty: a radiographic outcome study

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Xue Susan [University of Washington, Department of Radiology, Box 357115, Seattle, WA (United States); Petscavage-Thomas, Jonelle M. [Penn State Hershey Medical Center, Department of Radiology, Hershey, PA (United States); Ha, Alice S. [University of Washington, Department of Radiology, Box 354755, Seattle, WA (United States)

    2016-06-15

    Total elbow arthroplasty (TEA) is becoming a popular alternative to arthrodesis for patients with end-stage elbow arthrosis and comminuted distal humeral fractures. Prior outcome studies have primarily focused on surgical findings. Our purpose is to determine the radiographic outcome of TEA and to correlate with clinical symptoms such as pain. This is an IRB-approved retrospective review from 2005 to 2015 of all patients with semiconstrained TEA. All available elbow radiographs and clinical data were reviewed. Data analysis included descriptive statistics and Kaplan-Meier survival curves for radiographic and clinical survival. A total of 104 total elbow arthroplasties in 102 patients were reviewed; 75 % were in women and the mean patient age was 63.1 years. Mean radiographic follow-up was 826 days with average of four radiographs per patient. Seventy TEAs (67 %) developed radiographic complications, including heterotopic ossification (48 %), perihardware lucency (27 %), periprosthetic fracture (23 %), hardware subluxation/dislocation (7 %), polyethylene wear (3 %), and hardware fracture/dislodgement (3 %); 56 patients (55 %) developed symptoms of elbow pain or instability and 30 patients (30 %) underwent at least one reoperation. In patients with radiographic complications, 66 % developed elbow pain, compared to 19 % of patients with no radiologic complications (p = 0.001). Of the patients with radiographic complications, 39 % had at least one additional surgery compared to 0 % of patients without radiographic complications (p = 0.056). Radiographic complications are common in patients after total elbow arthroplasty. There is a strong positive association between post-operative radiographic findings and clinical outcome. Knowledge of common postoperative radiographic findings is important for the practicing radiologist. (orig.)

  11. Radiographer commenting of trauma radiographs: a survey of the benefits, barriers and enablers to participation in an Australian healthcare setting

    International Nuclear Information System (INIS)

    Neep, Michael J.; Steffens, Tom; Owen, Rebecca; McPhail, Steven M.

    2014-01-01

    Radiographer abnormality detection systems that highlight abnormalities on trauma radiographs ('red dot' system) have been operating for more than 30 years. Recently, a number of pitfalls have been identified. These limitations initiated the evolution of a radiographer commenting system, whereby a radiographer provides a brief description of abnormalities identified in emergency healthcare settings. This study investigated radiographers' participation in abnormality detection systems, their perceptions of benefits, barriers and enablers to radiographer commenting, and perceptions of potential radiographer image interpretation services for emergency settings. A cross-sectional survey was implemented. Participants included radiographers from four metropolitan hospitals in Queensland, Australia. Conventional descriptive statistics, histograms and thematic analysis were undertaken. Seventy-three surveys were completed and included in the analysis (68% response rate); 30 (41%) of respondents reported participating in abnormality detection in 20% or less of examinations, and 26(36%) reported participating in 80% or more of examinations. Five overarching perceived benefits of radiographer commenting were identified: assisting multidisciplinary teams, patient care, radiographer ability, professional benefits and quality of imaging. Frequently reported perceived barriers included 'difficulty accessing image interpretation education', 'lack of time' and 'low confidence in interpreting radiographs'. Perceived enablers included 'access to image interpretation education' and 'support from radiologist colleagues'. A range of factors are likely to contribute to the successful implementation of radiographer commenting in addition to abnormality detection in emergency settings. Effective image interpretation education amenable to completion by radiographers would likely prove valuable in preparing radiographers for participation in abnormality detection and commenting systems in

  12. Attitudes of radiographers to radiographer-led discharge: A survey

    International Nuclear Information System (INIS)

    Lumsden, Laura; Cosson, Philip

    2015-01-01

    Background: The traditional role of the Diagnostic Radiographer in image acquisition has gradually been extended through skill-mix, particularly to include abnormality detection. Aims: This research focused on the attitudes of Radiographers to Radiographer-led Discharge (RLD), where Radiographers discharge patients with minor injuries and perform tasks previously undertaken by Accident and Emergency staff. The effects of job role, hospital type, experience and whether RLD was used in the participant's trust were examined. Method: A multiple-indicator online questionnaire assessed attitudes to RLD. Snowball sampling was used with advertisement via emails, posters and cards, containing Quick Response (QR) codes. Statement responses were coded, with reverse coding for negative statements and total scores were calculated. A higher score represented a more positive attitude. Results: 101 questionnaires were completed (an estimated 30% response rate) and the mean total score was 84/115. 95% of participants supported radiographer involvement in abnormality detection, with 46.5% selecting RLD as the preferred system for minor injuries patients vs 48.5% preferring commenting alone. Discussion: Participants were positive about extending their role through RLD and felt confident in their image interpretation abilities, though expressed concern for the legal consequences of the role and adequate pay. Generalization of the results is limited due to the possible low response rate. Conclusion: Overall, participants demonstrated positive attitudes towards RLD but they also indicate the need for appropriate payment for any additional responsibility. These findings are promising for successful implementation of RLD, though larger-scale research including radiologists, business managers, A and E staff and patients would be beneficial. - Highlights: • 101 questionnaires were completed (an estimated 30% response rate). • 95% of participants supported radiographer involvement

  13. Análise histológica, radiográfica e do perfil de imunoglobulinas após implantação de enxerto de osso esponjoso bovino desmineralizado em bloco em músculo de ratos Histologic, radiographic and imunoglobuline profile analysis after implantation blocks of demineralized bovine cancellous bone graft in muscle of rats

    Directory of Open Access Journals (Sweden)

    Jefferson Tomio Sanada

    2003-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a biocompatibilidade de blocos de enxerto de osso bovino esponjoso acelular e desmineralizado (Gen-Ox®, Baumer S.A.. Um bloco cilíndrico (5x12mm de material de enxerto foi implantado em músculo abdutor da coxa de 30 ratos, sendo os animais sacrificados 3, 7, 14, 21 e 28 dias (n=6 após as cirurgias. Após a tomada das radiografias, as peças foram removidas para o processamento histológico. A análise histológica mostrou que nos períodos de 3 e 7 dias foi evidenciado um processo inflamatório agudo, caracterizado pela presença de neutrófilos, reabsorção do coágulo sanguíneo e angiogênese. Entre 14 e 21 dias, verificou-se a reabsorção da matriz implantada por células mononucleadas, raras células gigantes e sua substituição por tecido conjuntivo fibroso rico em vasos e células. Aos 28 dias, na maioria dos casos, observou-se apenas pequenos fragmentos de matriz implantada envolto por tecido conjuntivo característico da região. Radiograficamente, não se notou evidências de mineralização. Com base nos resultados obtidos concluímos que o enxerto de matriz de osso esponjoso bovino desmineralizado em bloco é biocompatível quando implantado em tecido conjuntivo intramuscular de ratos, sendo absorvido e substituído por tecido conjuntivo característico da região, sem qualquer indício de ocorrência de osteogênese ectópica.The aim of this study was to evaluate the biocompatibility of blacks of organic bovine cancellous bone graft material (Gen-OxTM, Baumer in ectopic sites. A cylinder of black of graft material measuring 5mm in diameter and 12mm in length was implanted in abdutor muscle of 30 Wistar rats. After 3, 7, 14, 21e 28 days, (6 animals/period were killed, radiographies were taken and the tissues and blood were collected to histological and imunoglobuline G and M profile analysis, respectively. The analysis of the sections revelead an acute inflammatory process at 3 and 7 days

  14. Chest Radiographic Findings in Newly Diagnosed Pulmonary ...

    African Journals Online (AJOL)

    Five hundred newly diagnosed cases of Pulmonary Tuberculosis were treated with directly observed short-course treatment and 100 of them had chest radiographic examination done. The various chest radiographic patterns in the 100 subjects were studied and included: Fluffy exudative changes 80(80%), fibrosis 70(70%) ...

  15. Antiphospholipid syndrome (APS) nephropathy in catastrophic, primary, and systemic lupus erythematosus-related APS.

    Science.gov (United States)

    Tektonidou, Maria G; Sotsiou, Flora; Moutsopoulos, Haralampos M

    2008-10-01

    Renal involvement in antiphospholipid syndrome (APS) has been poorly recognized. A renal small-vessel vasculopathy, defined as APS nephropathy, has recently been observed in small series of patients with primary APS (PAPS) and systemic lupus erythematosus (SLE)-APS. We examined the renal histologic, clinical, and laboratory characteristics of different groups of patients with APS including catastrophic APS (CAPS). Our study included all CAPS (n=6), PAPS (n=8), and SLE-APS (n=23) patients with biopsy-proven renal involvement who were referred to our departments. The kidney biopsy specimens were retrospectively examined by the same renal pathologist. APS nephropathy was diagnosed as previously described. Demographic, clinical, and laboratory data were recorded. All patients with CAPS had acute and chronic renal vascular lesions compatible with diagnosis of APS nephropathy. Thrombotic microangiopathy (TMA), the acute lesion, was observed in all CAPS patients. Fibrous intimal hyperplasia of interlobular arteries (FIH) and focal cortical atrophy (FCA) were the most common chronic vascular lesions, occurring in 4 of 6 (66.7%) and 3 of 6 (50%) patients with CAPS, respectively. TMA was detected in 3 of 8 (37.5%) patients with PAPS and in 8 of 23 (35%) patients with SLE-APS, while FIH and FCA were found with similar frequencies in all 3 groups. Hypertension, proteinuria, hematuria, and renal insufficiency were the most common renal manifestations of all APS groups. Acute and chronic APS nephropathy lesions were detected in all 3 APS groups. Acute lesions were more prominent in CAPS, while chronic lesions were found with similar frequencies in all groups. Hypertension, proteinuria, hematuria, and renal insufficiency were the most common renal manifestations of all APS groups.

  16. Radiographic findings of Proteus Syndrome

    Directory of Open Access Journals (Sweden)

    Nishant Mukesh Gandhi, MD

    2014-01-01

    Full Text Available The extremely rare Proteus Syndrome is a hamartomatous congenital syndrome with substantial variability between clinical patient presentations. The diagnostic criteria consist of a multitude of clinical findings including hemihypertrophy, macrodactyly, epidermal nevi, subcutaneous hamartomatous tumors, and bony abnormalities. These clinical findings correlate with striking radiographic findings.

  17. Radiographic findings of Proteus Syndrome

    Science.gov (United States)

    Gandhi, Nishant Mukesh; Davalos, Eric A.; Varma, Rajeev K.

    2015-01-01

    The extremely rare Proteus Syndrome is a hamartomatous congenital syndrome with substantial variability between clinical patient presentations. The diagnostic criteria consist of a multitude of clinical findings including hemihypertrophy, macrodactyly, epidermal nevi, subcutaneous hamartomatous tumors, and bony abnormalities. These clinical findings correlate with striking radiographic findings. PMID:27186241

  18. Fast radiographic systems

    International Nuclear Information System (INIS)

    Domanus, J.C.

    1984-08-01

    Industrial radiography can be performed with shorter exposure times, when instead of X-ray film with lead intensifying screens the radiographic paper with fluorescent screen is used. With paper radiography one can obtain lower material, equipment, and labor costs, shorter exposure and processing times, and easier radiation protection. The speed of the radiographic inspection can also be increased by the use of fluorometallic intensifying screens together with a special brand of X-ray film. Before accepting either of the two fast radiographic systems one must be sure that they can produce radiographs of adequate image quality. Therefore an investigation was performed on that subject using ISO wire IQI's and ASTM penetrameters. The radiographic image quality was tested for aluminium and steel up to 30 mm thick using various brands of radiographic paper and X-ray film with fluorometallic screens and comparing them with fast X-ray films with lead screens. Both systems give satisfactory results. (author)

  19. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  20. Radiographic constant exposure technique

    DEFF Research Database (Denmark)

    Domanus, Joseph Czeslaw

    1985-01-01

    The constant exposure technique has been applied to assess various industrial radiographic systems. Different X-ray films and radiographic papers of two producers were compared. Special attention was given to fast film and paper used with fluorometallic screens. Radiographic image quality was tes...... was tested by the use of ISO wire IQI's and ASTM penetrameters used on Al and Fe test plates. Relative speed and reduction of kilovoltage obtained with the constant exposure technique were calculated. The advantages of fast radiographic systems are pointed out...

  1. Radiographic constant exposure technique

    DEFF Research Database (Denmark)

    Domanus, Joseph Czeslaw

    1985-01-01

    The constant exposure technique has been applied to assess various industrial radiographic systems. Different X-ray films and radiographic papers of two producers were compared. Special attention was given to fast film and paper used with fluorometallic screens. Radiographic image quality...... was tested by the use of ISO wire IQI's and ASTM penetrameters used on Al and Fe test plates. Relative speed and reduction of kilovoltage obtained with the constant exposure technique were calculated. The advantages of fast radiographic systems are pointed out...

  2. Visual simulation of radiographs

    International Nuclear Information System (INIS)

    Laguna, G.

    1985-01-01

    A method for computer simulation of radiographs has been added to the LLNL version of the solid modeler TIPS-1 (Technical Information Processing System-1). This new tool will enable an engineer to compare an actual radiograph of a solid to its computer-generated counterpart. The appearance of discrepancies between the two can be an indication of flaws in the solid object. Simulated radiographs can also be used to preview the placement of x-ray sources to focus on areas of concern before actual radiographs are made

  3. Alterações radiográficas do tálus no pé torto congênito após liberação cirúrgica pela técnica de McKay Radiographic changes of the talus in congenital clubfoot after surgical release using the mckay procedure

    Directory of Open Access Journals (Sweden)

    José Antonio Pinto

    2010-12-01

    Full Text Available OBJETIVO: Analisar as alterações morfológicas do tálus após o tratamento cirúrgico do pé torto congênito pela técnica de McKay. MÉTODOS: Foram analisadas, retrospectivamente, radiografias em perfil com carga dos pés de 14 pacientes com pé torto congênito unilateral submetidos ao tratamento pela técnica de McKay por dupla incisão. Todos os pacientes foram operados pelo mesmo cirurgião, com média de 6,53 anos entre a cirurgia e a radiografia. Comparamos as características do tálus dos pés operados com os parâmetros radiográficos dos pés contralaterais. Avaliamos a presença de deformidade do dômus e da cabeça do tálus (avaliação da esfericidade, a altura e o comprimento do tálus, a presença e grau de subluxação do navicular, a alteração do ângulo de Gissane e o padrão do trabeculado ósseo. RESULTADOS: Alterações da cabeça do tálus ocorreram em 92,8% dos casos; do dômus, em 92,8%; e do trabeculado, em 100%. A relação entre o comprimento do tálus do pé operado sobre o contralateral variou de 0,61 a 0,88 (média de 0,79; DP = 0,09, e da altura de 0,57 a 0,98 (média de 0,82; DP = 0,12. O ângulo de Gissane aumentou em todos os pés operados, e todos apresentaram subluxação do navicular, com índice variando de 6,43 a 59,75% (média de 26,34%; DP = 16,66%. CONCLUSÕES: Alterações talares ocorreram em 100% dos pés tratados pela técnica de McKay. Estabelecer parâmetros radiográficos para descrever e quantificar essas deformidades mostrou-se viável através de técnicas simples e de fácil execução.OBJECTIVE: To analyze the morphologic changes of the talus after surgical treatment of congenital clubfoot using the McKay procedure. METHODS: We retrospectively analyzed lateral standing radiographs of the feet in 14 patients with unilateral clubfoot treated by the McKay procedure. All patients were operated on by the same surgeon, with an average of 6.53 years between surgery and the radiograph. We

  4. A radiographic examination system

    International Nuclear Information System (INIS)

    Cable, A.P.; Cable, W.S.

    1983-01-01

    A system for performing radiographic examination, particularly of large items such as international container units is disclosed. The system is formed as an installation comprising housings for respective linear accelerators transmitting a beam of radiation across the path of a conveyor along which the units can be displaced continuously or incrementally. On either end of the installation are container handling areas including roller conveyors with drag chains and transverse manipulators, and the whole installation is secured within automatically operated doors which seal the high energy region when a container on the conveyor is being subjected to examination. The radiation transmitted through a container is detected in a detector system incorporating a fluoroscopic screen light output from which is detected in a camera system such as a television camera, and transmitted as coded pulsed signals by a coding transfer unit to display screens where an image of the transmitted information can be displayed and/or recorded for further use. (author)

  5. Autoantibody profiling in APS.

    Science.gov (United States)

    Roggenbuck, D; Somma, V; Schierack, P; Borghi, M O; Meroni, P L

    2014-10-01

    The international consensus for the classification of antiphospholipid syndrome (APS) requires clinical and laboratory criteria to be considered at an equal level for diagnosing APS. Thus, detection of antiphospholipid antibodies (aPL) being a hallmark of APS has been the object of intensive investigation over the past 40 years. However, appropriate detection of aPL still remains a laboratory challenge due to their heterogeneity comprising autoantibodies reactive to different phospholipid-binding plasma proteins, such as beta-2 glycoprotein I (β2GPI) and prothrombin. The relevance of aPL interacting with phospholipids other than cardiolipin (CL, diphosphatidylglycerol), such as phosphatidylserine (PS), remains elusive with regard to the diagnosis of APS. Recently, the concept of aPL profiling has been introduced to assess the risk of thrombotic complications in patients with APS. New assay techniques, apart from enzyme-linked immunosorbent assays (ELISAs) recommended by the international consensus for the classification of APS, have been proposed for multiplexing of aPL testing. Line immunoassays (LIAs) employing a novel hydrophobic solid phase for the simultaneous detection of different aPL seem to be an intriguing alternative. We evaluated a novel multiplex LIA employing a hydrophobic membrane coated with different phospholipid (PL)-binding proteins or PLs. The performance characteristics of this new multiplexing assay technique demonstrated its usefulness for aPL profiling. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  6. Radiographers and trainee radiologists reporting accident radiographs: A comparative plain film-reading performance study

    International Nuclear Information System (INIS)

    Buskov, L.; Abild, A.; Christensen, A.; Holm, O.; Hansen, C.; Christensen, H.

    2013-01-01

    Aim: To compare the diagnostic accuracy and clinical validity of reporting radiographers with that of trainee radiologists whom they have recently joined in reporting emergency room radiographs at Bispebjerg University Hospital. Materials and methods: Plain radiographs of the appendicular skeleton from 1000 consecutive emergency room patients were included in the study: 500 primarily reported by radiographers and 500 by trainee radiologists. The final reporting was subsequently undertaken by a consultant radiologist in consensus with an orthopaedic surgeon. Two observers classified reports as either true positive/negative or false positive/negative based on the final report, which was considered the reference standard. To evaluate the severity of incorrect primary reports, errors were graded into three categories concerning clinical impact and erroneous reports graded as the most severe category were subsequently analysed. Mann–Whitney and Chi-squared tests were used to compare differences and associations between radiographers versus trainee radiologists regarding film reporting. Results: The sensitivity for correct diagnosis was 99% for reporting radiographers and 94% for trainee radiologists. The specificity was found to be 97% for reporting radiographers and 99% for trainee radiologists. Radiographers missed significantly fewer fractures (n = 2) than trainee radiologists (n = 14; p = 0.006) but had a higher, but not significant, degree of overcalling. No significant difference was found between groups regarding clinical impact of incorrect reporting. Conclusion: Trained radiographers report accident radiographs of the extremities with high accuracy and constitute a qualified resource to help meet increasing workload and demands in quality standards.

  7. Legalities of the radiograph

    International Nuclear Information System (INIS)

    Bundy, A.L.

    1988-01-01

    The radiograph itself plays a major role in medical malpractice cases. Also, many questions arise concerning the rights to and storage of x-ray films. These issues are addressed in this chapter. To keep the terminology simple, the word radiograph represents all imaging documentation on hard copy film (x-rays, nuclear medicine, computer-assisted studies, ultrasound, and magnetic resonance imaging)

  8. Incisuroplastia troclear e estabilização articular após transecção do ligamento cruzado cranial: Estudo clínico e radiográfico em cães Intercondylar notchplasty and fascial strip repair following transection of the cranial cruciate ligament: Clinical and radiographic aspects in the dog

    Directory of Open Access Journals (Sweden)

    André Luis Selmi

    2007-10-01

    Full Text Available Avaliaram-se as alterações clínicas e radiográficas em nove cães adultos, após a transecção do ligamento cruzado cranial (LCCr seguida da substituição ligamentar por retalho de fáscia lata, associada ou não à incisuroplastia troclear (ITR. O joelho direito (GI foi submetido à ITR e posterior estabilização articular, e o esquerdo somente à substituição ligamentar (GC. Os animais foram avaliados nos períodos pré-operatório, pós-operatório (po imediato e aos 30, 90 e 180 dias de po, período coincidente com o momento de eutanásia de subgrupos de três cães. A instabilidade articular e o grau de claudicação diminuíram significativamente durante o período de avaliação, apesar da instabilidade persistir durante a flexão articular. Observou-se decréscimo significativo do perímetro muscular da coxa aos 30 e 90 dias p.o. em ambos os grupos. Não foram evidenciadas alterações nos graus de extensão e flexão articulares, na rotação interna da tíbia, na amplitude de movimento articular ou de doença articular degenerativa (DAD durante o período de avaliação em ambos os grupos. Conclui-se que a ITR, associada à técnica de estabilização articular, não produz alterações em nenhuma das variáveis estudadas em cães, quando comparada à estabilização intra-articular, isoladamente.Clinical and radiographic changes associated with intercondylar notchplasty (IN after transection of the cranial cruciate ligament (CCL followed by a fascial strip reconstruction were studied in nine adult dogs. The right stifle was submitted to IN followed by fascial strip reconstruction of the CCL (GI while in the left IN was not performed (GC. Dogs were evaluated the day prior to surgery, on the immediate postoperative day and at 30, 90 and 180 days after surgery, time at which a subgroup of three dogs were euthanatized. Instability and lameness significantly decreased throughout the evaluation period, although instability was

  9. APS SCIENCE 2016

    Energy Technology Data Exchange (ETDEWEB)

    Fenner, Richard B. [Argonne National Lab. (ANL), Argonne, IL (United States). Advanced Photon Source (APS)

    2017-05-01

    The Advanced Photon Source (APS) occupies an 80-acre site on the Argonne national laboratory campus, about 25 miles from downtown chicago, illinois. it shares the site with the center for nanoscale materials and the Advanced Protein characterization facility. for directions to Argonne, see http://www.anl.gov/directions-and-visitor-information. The APS, a national synchrotron radiation research facility operated by Argonne for the u.S. department of energy (doe) office of Science, provides this nation’s brightest high-energy x-ray beams for science. research by APS users extends from the center of the earth to outer space, from new information on combustion engines and microcircuits to new drugs and nanotechnologies whose scale is measured in billionths of a meter. The APS helps researchers illuminate answers to the challenges of our high-tech world, from developing new forms of energy, to sustaining our nation’s technological and economic competitiveness, to pushing back against the ravages of disease. research at the APS promises to have far-reaching

  10. Detection of radiographically occult-ankle fractures. Positive predictive value of post-traumatic soft-tissue swelling

    International Nuclear Information System (INIS)

    Kumar, M.; Caruana, E.

    2000-01-01

    The objective of this study was to assess the value of soft-tissue swelling on plain radiographs as a predictor of radiographically occult fracture, after acute ankle injury (trauma). Patients with acute ankle trauma and plain radiographic evidence of soft-tissue swelling were included in this study. Patients were excluded if ankle trauma was sustained more than 48 hours previously or if fracture was visible on plain radiographs. All subjects (n=25) underwent computed tomography (CT) of the ankle in sagittal and coronal planes. Size of soft-tissue swelling was measured from initial Antero-posterior (AP) radiographs. The subjects in the study were placed into two groups according to whether a fracture was identified on CT or not. The results identified that those subjects without a fracture demonstrated by CT, had a soft-tissue swelling of less than 12.6 mm, while those with over 17.1mm swelling, showed a fracture on CT. Twelve patients (48 per cent) had radiographically occult fractures identified with CT. Fracture sites included: Talus/Talar Dome (n=9), posterior or lateral malleolos (n=2), distal tibia/fibula (n=1). CT detected significant soft-tissue injuries in six patients (24 per cent), composed of damaged anterior talo-fibular ligament (n=4), torn flexor tendons (n=1), and damaged fibular calcaneal ligament (n=1). One patient also showed gas in the talar dome. This study concludes that presence of a large soft-tissue swelling on plain radiographs after acute ankle trauma suggests an underlying fracture. A soft-tissue swelling of >15 mm is a reasonable threshold to prompt further imaging. Helical computed tomography provides good visualisation of subtle bone injuries and may detect clinically important soft-tissue injuries. While the study has a small sample, there is clear evidence that there is a trend worth investigating. Future research will seek to investigate a larger sample. Copyright (1999) Australian Institute of Radiography

  11. Radiographic indices for lumbar developmental spinal stenosis.

    Science.gov (United States)

    Cheung, Jason Pui Yin; Ng, Karen Ka Man; Cheung, Prudence Wing Hang; Samartzis, Dino; Cheung, Kenneth Man Chee

    2017-01-01

    Patients with developmental spinal stenosis (DSS) are susceptible to developing symptomatic stenosis due to pre-existing narrowed spinal canals. DSS has been previously defined by MRI via the axial anteroposterior (AP) bony spinal canal diameter. However, MRI is hardly a cost-efficient tool for screening patients. X-rays are superior due to its availability and cost, but currently, there is no definition of DSS based on plain radiographs. Thus, the aim of this study is to develop radiographic indices for diagnosing DSS. This was a prospective cohort of 148 subjects consisting of patients undergoing surgery for lumbar spinal stenosis (patient group) and asymptomatic subjects recruited openly from the general population (control group). Ethics approval was obtained from the local institutional review board. All subjects underwent MRI for diagnosing DSS and radiographs for measuring parameters used for creating the indices. All measurements were performed by two independent investigators, blinded to patient details. Intra- and interobserver reliability analyses were conducted, and only parameters with near perfect intraclass correlation underwent receiver operating characteristic (ROC) analysis to determine the cutoff values for diagnosing DSS using radiographs. Imaging parameters from a total of 66 subjects from the patient group and 82 asymptomatic subjects in the control group were used for analysis. ROC analysis suggested sagittal vertebral body width to pedicle width ratio (SBW:PW) as having the strongest sensitivity and specificity for diagnosing DSS. Cutoff indices for SBW:PW were level-specific: L1 (2.0), L2 (2.0), L3 (2.2), L4 (2.2), L5 (2.5), and S1 (2.8). This is the first study to define DSS on plain radiographs based on comparisons between a clinically relevant patient group and a control group. Individuals with DSS can be identified by a simple radiograph using a screening tool allowing for better cost-saving means for clinical diagnosis or research

  12. Radiographic indices for lumbar developmental spinal stenosis

    Directory of Open Access Journals (Sweden)

    Jason Pui Yin Cheung

    2017-02-01

    Full Text Available Abstract Background Patients with developmental spinal stenosis (DSS are susceptible to developing symptomatic stenosis due to pre-existing narrowed spinal canals. DSS has been previously defined by MRI via the axial anteroposterior (AP bony spinal canal diameter. However, MRI is hardly a cost-efficient tool for screening patients. X-rays are superior due to its availability and cost, but currently, there is no definition of DSS based on plain radiographs. Thus, the aim of this study is to develop radiographic indices for diagnosing DSS. Methods This was a prospective cohort of 148 subjects consisting of patients undergoing surgery for lumbar spinal stenosis (patient group and asymptomatic subjects recruited openly from the general population (control group. Ethics approval was obtained from the local institutional review board. All subjects underwent MRI for diagnosing DSS and radiographs for measuring parameters used for creating the indices. All measurements were performed by two independent investigators, blinded to patient details. Intra- and interobserver reliability analyses were conducted, and only parameters with near perfect intraclass correlation underwent receiver operating characteristic (ROC analysis to determine the cutoff values for diagnosing DSS using radiographs. Results Imaging parameters from a total of 66 subjects from the patient group and 82 asymptomatic subjects in the control group were used for analysis. ROC analysis suggested sagittal vertebral body width to pedicle width ratio (SBW:PW as having the strongest sensitivity and specificity for diagnosing DSS. Cutoff indices for SBW:PW were level-specific: L1 (2.0, L2 (2.0, L3 (2.2, L4 (2.2, L5 (2.5, and S1 (2.8. Conclusions This is the first study to define DSS on plain radiographs based on comparisons between a clinically relevant patient group and a control group. Individuals with DSS can be identified by a simple radiograph using a screening tool allowing for better

  13. Radiation doses of commonly used dental radiographic surveys.

    Science.gov (United States)

    Freeman, J P; Brand, J W

    1994-03-01

    The purpose of this study was to evaluate and to compare the radiation dose associated with commonly used dental radiographic surveys including the following: (1) 20 film full-mouth survey, (2) bite-wing radiographs, (3) panoramic survey supplemented with bite-wing radiographs and (4) a common orthodontic radiographic survey (a lateral cephlometric radiograph supplemented with a panoramic radiograph). The effects of collimation and faster radiographic film speeds on dose were also investigated. The effective doses to selected anatomic sites were calculated from measured absorbed doses with the use of an improved, tissue-equivalent phantom fitted with lithium fluoride thermoluminescent dosimeters. It was demonstrated that converting from round to rectangular collimation reduced the radiation exposure by a factor of four. A panoramic survey supplemented with bite-wing radiographs uses approximately one third of the radiation exposure needed to expose a full-mouth survey made with E-speed film and rectangular collimation.

  14. Small Molecule Inhibitors Targeting Activator Protein 1 (AP-1)

    Science.gov (United States)

    2015-01-01

    Activator protein 1 (AP-1) is a pivotal transcription factor that regulates a wide range of cellular processes including proliferation, apoptosis, differentiation, survival, cell migration, and transformation. Accumulating evidence supports that AP-1 plays an important role in several severe disorders including cancer, fibrosis, and organ injury, as well as inflammatory disorders such as asthma, psoriasis, and rheumatoid arthritis. AP-1 has emerged as an actively pursued drug discovery target over the past decade. Excitingly, a selective AP-1 inhibitor T-5224 (51) has been investigated in phase II human clinical trials. Nevertheless, no effective AP-1 inhibitors have yet been approved for clinical use. Despite significant advances achieved in understanding AP-1 biology and function, as well as the identification of small molecules modulating AP-1 associated signaling pathways, medicinal chemistry efforts remain an urgent need to yield selective and efficacious AP-1 inhibitors as a viable therapeutic strategy for human diseases. PMID:24831826

  15. Radiographers and radiologists reporting plain radiograph requests from accident and emergency and general practice

    International Nuclear Information System (INIS)

    Brealey, S.D.; King, D.G.; Hahn, S.; Crowe, M.; Williams, P.; Rutter, P.; Crane, S.

    2005-01-01

    AIM: To assess selectively trained radiographers and consultant radiologists reporting plain radiographs for the Accident and Emergency Department (A and E) and general practitioners (GPs) within a typical hospital setting. METHODS: Two radiographers, a group of eight consultant radiologists, and a reference standard radiologist independently reported under controlled conditions a retrospectively selected, random, stratified sample of 400 A and E and 400 GP plain radiographs. An independent consultant radiologist judged whether the radiographer and radiologist reports agreed with the reference standard report. Clinicians then assessed whether radiographer and radiologist incorrect reports affected confidence in their diagnosis and treatment plans, and patient outcome. RESULTS: For A and E and GP plain radiographs, respectively, there was a 1% (95% confidence interval (CI) -2 to 5) and 4% (95% CI -1 to 8) difference in reporting accuracy between the two professional groups. For both A and E and GP cases there was an 8% difference in the clinicians' confidence in their diagnosis based on radiographer or radiologist incorrect reports. For A and E and GP cases, respectively, there was a 2% and 8% difference in the clinicians' confidence in their management plans based on radiographer or radiologist incorrect reports. For A and E and GP cases, respectively, there was a 1% and 11% difference in effect on patient outcome of radiographer or radiologist incorrect reports. CONCLUSION: There is the potential to extend the reporting role of selectively trained radiographers to include plain radiographs for all A and E and GP patients. Further research conducted during clinical practice at a number of sites is recommended

  16. Radiographic Measurements Associated With the Natural Progression of the Hallux Valgus During at Least 2 Years of Follow-up.

    Science.gov (United States)

    Lee, Seung Yeol; Chung, Chin Youb; Park, Moon Seok; Sung, Ki Hyuk; Ahmed, Sonya; Koo, Seungbum; Kang, Dong-Wan; Lee, Kyoung Min

    2018-04-01

    This study aimed to investigate the radiographic measurements associated with the progression of hallux valgus during at least 2 years of follow-up. Seventy adult patients with hallux valgus who were followed for at least 2 years and underwent weightbearing foot radiography were included. Radiographic measurements included the hallux valgus angle (HVA), hallux interphalangeal angle, intermetatarsal angle (IMA), metatarsus adductus angle, distal metatarsal articular angle (DMAA), tibial sesamoid position, anteroposterior (AP) talo-first metatarsal angle, and lateral talo-first metatarsal angle. Patients were divided into progressive and nonprogressive groups. Binary logistic regression analysis was performed to identify factors that significantly affected the progression of hallux valgus deformity. The correlation between change in HVA and changes in other radiographic indices during follow-up was analyzed. The DMAA ( P = .027) and AP talo-first metatarsal angle ( P = .034) at initial presentation were found to be significant factors affecting the progression of hallux valgus deformity. Change in the HVA during follow-up was significantly correlated with changes in the IMA ( r = 0.423; P = .001) and DMAA ( r = 0.541; P < .001). The change in the HVA was found to be significantly correlated with changes in the IMA and DMAA. A future study is required to elucidate whether this correlation can be explained by the progressive instability of the first tarsometatarsal joint. We believe special attention needs to be paid to patients with pes planus and increased DMAA. Level III, comparative study.

  17. Occupational health and the radiographer

    International Nuclear Information System (INIS)

    Stronach, T.

    1990-01-01

    This paper identifies some of the occupational health hazards faced by radiographers in the hospital environment. There has been very little work done in this area in the past, and as the subject is so large this paper can do little other than raise some of the issues . The hazards addressed include: radiation, ergonomics, chemical, environmental, biological, occupational injury and accident, stress. 14 refs., 2 figs

  18. A novel homozygous AP4B1 mutation in two brothers with AP-4 deficiency syndrome and ocular anomalies.

    Science.gov (United States)

    Accogli, Andrea; Hamdan, Fadi F; Poulin, Chantal; Nassif, Christina; Rouleau, Guy A; Michaud, Jacques L; Srour, Myriam

    2018-04-01

    Adaptor protein complex-4 (AP-4) is a heterotetrameric protein complex which plays a key role in vesicle trafficking in neurons. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been recently associated with an autosomal recessive phenotype, consisting of spastic tetraplegia, and intellectual disability (ID). The overlapping clinical picture among individuals carrying mutations in any of these genes has prompted the terms "AP-4 deficiency syndrome" for this clinically recognizable phenotype. Using whole-exome sequencing, we identified a novel homozygous mutation (c.991C>T, p.Q331*, NM_006594.4) in AP4B1 in two siblings from a consanguineous Pakistani couple, who presented with severe ID, progressive spastic tetraplegia, epilepsy, and microcephaly. Sanger sequencing confirmed the mutation was homozygous in the siblings and heterozygous in the parents. Similar to previously reported individuals with AP4B1 mutations, brain MRI revealed ventriculomegaly and white matter loss. Interestingly, in addition to the typical facial gestalt reported in other AP-4 deficiency cases, the older brother presented with congenital left Horner syndrome, bilateral optic nerve atrophy and cataract, which have not been previously reported in this condition. In summary, we report a novel AP4B1 homozygous mutation in two siblings and review the phenotype of AP-4 deficiency, speculating on a possible role of AP-4 complex in eye development. © 2018 Wiley Periodicals, Inc.

  19. Radiographic scanner apparatus

    International Nuclear Information System (INIS)

    Wake, R.H.

    1980-01-01

    The preferred embodiment of this invention includes a hardware system, or processing means, which operates faster than software. Moreover the computer needed is less expensive and smaller. Radiographic scanner apparatus is described for measuring the intensity of radiation after passage through a planar region and for reconstructing a representation of the attenuation of radiation by the medium. There is a source which can be rotated, and detectors, the output from which forms a data line. The detectors are disposed opposite the planar region from the source to produce a succession of data lines corresponding to the succession of angular orientations of the source. There is a convolver means for convolving each of these data lines, with a filter function, and a means of processing the convolved data lines to create the representation of the radiation attenuation in the planar region. There is also apparatus to generate a succession of data lines indicating radiation attenuation along a determinable path with convolver means. (U.K.)

  20. Fisioterapia após substituição artroscópica do ligamento cruzado cranial em cães: I - avaliação clínica, radiográfica e ultrassonográfica Physiotherapy after arthroscopic repair of the cranial cruciate ligament in dogs: I - clinical, radiographic, and ultrasonographic evaluation

    Directory of Open Access Journals (Sweden)

    L.A.L. Muzzi

    2009-08-01

    Full Text Available Foram avaliadas a aplicabilidade da cirurgia artroscópica na substituição do ligamento cruzado cranial (LCC e o efeito da fisioterapia pós-operatória, por meio de exames clínicos, radiográficos e ultrassonográficos, em 16 cães sem raça definida, machos, com pesos entre 19,2 e 26,3kg, submetidos à ruptura experimental do LCC e subsequente substituição deste ligamento pelo enxerto autógeno da fascia lata. Os animais foram distribuídos em dois grupos de oito cada: no grupo I os cães foram submetidos ao programa de fisioterapia pós-operatória e no grupo II à imobilização temporária do membro. Por meio dos exames citados, não foram verificadas diferenças significativas entre os dois grupos, e ambos demonstraram sinais de processo articular degenerativo. A função do membro foi avaliada com auxílio da plataforma de força, e os animais do grupo I apresentaram melhor apoio do membro operado durante o período de reabilitação. Conclui-se que a cirurgia artroscópica é uma técnica eficaz para substituição do LCC em cães, apesar de não impedir o desenvolvimento da doença articular degenerativa, e que a fisioterapia permite recuperação mais rápida no apoio do membro durante o período de reabilitação.The reconstruction of experimentally ruptured cranial cruciate ligament (CCL under arthroscopic guidance and the effects of an early postoperative rehabilitation program by clinical, radiographic, and ultrasonographic exams were evaluated. Sixteen male mongrel dogs weighing from 19.2 to 26.3kg had the CCL experimentally ruptured and the stifle joint was stabilized by the use of an intracapsular arthroscopical technique with fascia lata as an autogenous graft. Eight dogs were included in a postoperative physiotherapy group and the other eight in a temporary immobilization group. From serial clinical, radiographic, and ultrasonographic examinations, no differences between groups were observed, although all dogs had showed

  1. Conventional versus virtual radiographs of the injured pelvis and acetabulum

    Energy Technology Data Exchange (ETDEWEB)

    Bishop, Julius A.; Rao, Allison J.; Pouliot, Michael A.; Bellino, Michael [Stanford University School of Medicine, Department of Orthopaedic Surgery, Stanford, CA (United States); Beaulieu, Christopher [Stanford University School of Medicine, Department of Radiology, Stanford, CA (United States)

    2015-09-15

    Evaluation of the fractured pelvis or acetabulum requires both standard radiographic evaluation as well as computed tomography (CT) imaging. The standard anterior-posterior (AP), Judet, and inlet and outlet views can now be simulated using data acquired during CT, decreasing patient discomfort, radiation exposure, and cost to the healthcare system. The purpose of this study is to compare the image quality of conventional radiographic views of the traumatized pelvis to virtual radiographs created from pelvic CT scans. Five patients with acetabular fractures and ten patients with pelvic ring injuries were identified using the orthopedic trauma database at our institution. These fractures were evaluated with both conventional radiographs as well as virtual radiographs generated from a CT scan. A web-based survey was created to query overall image quality and visibility of relevant anatomic structures. This survey was then administered to members of the Orthopaedic Trauma Association (OTA). Ninety-seven surgeons completed the acetabular fracture survey and 87 completed the pelvic fracture survey. Overall image quality was judged to be statistically superior for the virtual as compared to conventional images for acetabular fractures (3.15 vs. 2.98, p = 0.02), as well as pelvic ring injuries (2.21 vs. 1.45, p = 0.0001). Visibility ratings for each anatomic landmark were statistically superior with virtual images as well. Virtual radiographs of pelvic and acetabular fractures offer superior image quality, improved comfort, decreased radiation exposure, and a more cost-effective alternative to conventional radiographs. (orig.)

  2. The sensitivity of standard radiographic foot measures to misalignment.

    Science.gov (United States)

    Willauer, Patrick; Sangeorzan, Bruce J; Whittaker, Eric C; Shofer, Jane B; Ledoux, William R

    2014-12-01

    The purpose of this study was to identify the effects that X-ray source misalignment has on common measurements made from anterior-poster (AP) and medial-lateral (ML) view foot radiographs. A cadaveric foot model was used to obtain ML radiographs with ±25 degree transverse plane misalignment. From these images the calcaneal pitch angle (CPA) and lateral talometatarsal angle (LTMA) were measured. AP images were captured with up to 30 degree sagittal plane misalignment as well as ±15 degree misalignment in the transverse plane at each sagittal angle. From these images the talonavicular coverage angle (TNCA) and talometatarsal angle (TMA) were measured. On the ML images, the CPA was sensitive to transverse plane misalignment from -10 to -25 degrees and from 15 to 25 degrees (P plane misalignment. On the AP images, the TNCA and TMA were not sensitive to sagittal plane misalignment alone. However, at 0, 10, and 15 degrees sagittal misalignment the TNCA showed sensitivity to transverse plane misalignment (P foot radiographic parameters, especially the CPA when there is transverse plane misalignment and the TNCA when there is both sagittal and transverse plane misalignment. The LTMA and TMA can be measured reliably, even with significant misalignment present. If a researcher or clinician is interested in measuring the CPA or TNCA, the current best practices guidelines for obtaining ML and AP images should be closely followed. © The Author(s) 2014.

  3. Radiographic Evidence of Hip Microinstability in Elite Ballet.

    Science.gov (United States)

    Mitchell, Ronald J; Gerrie, Brayden J; McCulloch, Patrick C; Murphy, Andrew J; Varner, Kevin E; Lintner, David M; Harris, Joshua D

    2016-06-01

    To determine prevalence, magnitude, and predisposing radiographic features of hip subluxation in elite ballet dancers. A cross-sectional investigation of professional male and female ballet dancers was performed using 5 plain radiographs. A "splits" anteroposterior (AP) radiograph was performed with legs abducted parallel to the trunk in the coronal plane (splits position; grand écart facial). Hip center position (HCP) was measured on standing AP pelvis and AP pelvis splits views and the difference calculated (subluxation distance) to determine prevalence and magnitude of femoral head subluxation. Student t test compared HCP on AP pelvis and splits radiographs. Pearson correlations were used to correlate splits HCP with radiographic measures of femoroacetabular impingement and dysplasia. Analyzing 47 dancers (21 men, 26 women; 23.8 ± 5.4 years), mean HCP on standing AP pelvis was 9.39 ± 3.33 mm versus 10.8 ± 2.92 mm on splits radiograph, with mean subluxation distance of 1.41 mm (P = .035). Forty-two dancers' femoral heads translated laterally with splits positioning, and 17 dancers (36%) exhibited a "vacuum sign" (bilateral in 71% of subjects with at least 1 hip vacuum sign). There was strong positive correlation (r = 0.461, P = .001) with splits HCP and alpha angle (Dunn 45°), and moderate negative correlation (r = -0.332, P = .022) with subluxation distance and neck-shaft angle. In men, splits HCP increased as lateral center edge angle (CEA) decreased (r = -0.437, P = .047), as anterior CEA decreased (r = -0.482, P = .027), as Tönnis angle increased (r = 0.656, P = .001), and as femoral head extrusion index increased (r = 0.511, P = .018). In women, there was moderate negative correlation (r = -0.389, P = .049) with subluxation distance and neck-shaft angle. Hip subluxation occurs during splits in most professional ballet dancers, with a significantly greater magnitude of subluxation in women than men. Subluxation magnitude

  4. Early characteristic radiographic changes in mucolipidosis II

    Energy Technology Data Exchange (ETDEWEB)

    Lai, Lillian M. [Lucile Packard Children' s Hospital and Stanford University, Pediatric Radiology, Palo Alto, CA (United States); Lachman, Ralph S. [Lucile Packard Children' s Hospital and Stanford University, Pediatric Radiology, Palo Alto, CA (United States); University of California, International Skeletal Dysplasia Registry, Los Angeles, CA (United States)

    2016-11-15

    Although mucolipidosis type II has similar metabolic abnormalities to those found in all the mucopolysaccharidoses and mucolipidoses, there are distinctive diagnostic radiographic changes of mucolipidosis II in the perinatal/newborn/infant period. To describe the early characteristic radiographic changes of mucolipidosis II and to document when these changes manifest and resolve. We retrospectively reviewed radiographs and clinical records of 19 cases of mucolipidosis II from the International Skeletal Dysplasia Registry (1971-present; fetal age to 21/2 years). A radiologist with special expertise in skeletal dysplasias evaluated the radiographs. The most common abnormalities were increased vertebral body height (80%, nonspecific), talocalcaneal stippling (86%), periosteal cloaking (74%) and vertebral body rounding (50%). Unreported findings included sacrococcygeal sclerosis (54%) and vertebral body sclerosis (13%). Rickets and hyperparathyroidism-like (pseudohyperparathyroidism) changes (rarely reported) were found in 33% of cases. These changes invariably started in the newborn period and resolved by 1 year of age. The conversion from these early infantile radiographic features to dysostosis multiplex changes occurred in 41% of cases, and within the first year after birth. Several findings strongly suggest the diagnosis of mucolipidosis II, including cloaking in combination with one or more of the following radiographic criteria: talocalcaneal stippling, sacrococcygeal or generalized vertebral body sclerosis, vertebral body rounding, or rickets/hyperparathyroidism-like changes in the perinatal/newborn/infancy period. These findings are not found in the other two forms of mucolipidosis nor in any of the mucopolysaccharidoses. (orig.)

  5. Radiographic manifestations of arthritis in AIDS patients

    International Nuclear Information System (INIS)

    Rosenberg, Z.S.; Norman, A.; Solomon, G.

    1988-01-01

    The purpose of this study is to familiarize the radiologist with a newly discovered association between arthritis and acquired immunodeficiency syndrome (AIDS). The authors retrospectively reviewed the clinical and radiographic findings in 31 patients with human immunodeficiency virus (HIV) infection referred to their rheumatology clinic with musculoskeletal complaints. The patients carried a wide range of clinical diagnosis including Reiter syndrome, psoriatic arthritis, undifferentiated seronegative arthritis, isolated enthesopathies, rheumatoid arthritis and osteonecrosis. Radiographs were available in 24 of the 31 patients, and in 20 they showed radiographic features of arthritis, which included soft-tissue swelling periarticular osteoporosis, synovial effusions, sacroiliitis, periosteal reaction, joint space narrowing, marginal erosions, and osteonecrosis. Although the radiographic abnormalities were frequently mild, they were significant, given the short duration of disease in many of their patients (weeks to months) at the time radiographs were obtained. The range of radiographic findings in their series was varied and paralleled the wide range of clinical diagnoses. No findings were pathognomonic for HIV-associated arthritis. Nevertheless, HIV infection needs to be considered in any patient belonging to a recognized risk group who presents with musculoskeletal disease. This is particularly important since immunosupressive drugs used for the treatment of arthritis can be detrimental to patients with HIV infection

  6. Radiographic aspects of xeroradiography

    International Nuclear Information System (INIS)

    Rao, G.U.V.; Fatouros, P.P.

    1980-01-01

    The quality of a conventional radiographic image can be characterized in terms of five basic parameters; density, contrast, latitude, resolution and noise. Since xeroradiographic images exhibit very limited broad area contrasts, and image formation is predominantly due to edge enhancement, a straightforward description of image quality using the same five parameters is not adequate. A detailed study was made of the radiographic aspects of xeroradiography with special reference to mammography, and a summary of major findings to date with appropriate references to published papers is presented

  7. Limitations of radiographs in evaluating non-displaced osteochondral lesions of the talus

    Energy Technology Data Exchange (ETDEWEB)

    Dheer, Sachin [Department of Radiology, Kennedy Health System, Cherry Hill, NJ (United States); Khan, Mustafa [University of Toledo Medical Center, Department of Orthopedic Surgery, Toledo, OH (United States); Zoga, Adam C.; Morrison, William B. [Thomas Jefferson University Hospital, Department of Radiology, Philadelphia, PA (United States)

    2012-04-15

    To evaluate what limitations, if any, radiographs have in detecting and characterizing the morphology of non-displaced OCLTs (size, cystic change, fragmentation, and avascular necrosis [AVN]). Thirty-three OCLTs in 32 patients were reviewed in consensus by a board-certified, fellowship-trained musculoskeletal radiologist and orthopedic surgeon, on radiographs and MRI examinations performed within 15 days of one another. Location, dimensions, and characteristics of the OCLT (fragmentation, bone marrow edema, cystic change, and necrosis) were documented on the radiographs and MRI examinations. There was an average of 7.5 days (range: 1-15 days) between the MRIs and radiographs. Eighteen (55%) medial and 15 (45%) lateral OCLTs were found; none was displaced. OCLTs were categorized into three groups: Group 1 - initially diagnosed with radiographs (4/33; 12%), Group 2 - diagnosed with radiographs only after MRI correlation (20/33; 61%), and Group 3 - not identifiable on radiographs despite MRI correlation (9/33; 27%). The dimensions of all of the lesions in Groups 1 and 2 were underestimated on radiographs. Only 1 of the 4 (25%) lesions in Group 1 and 1 of the 20 (5%) lesions in Group 2 could be measured in the anteroposterior (AP) dimension (using a lateral radiograph). The most common radiographic appearance of non-displaced OCLTs was an ''ill-defined'' lucency at the talar dome (20/33; 61%). Across all three groups, fragmentation, cystic change, and AVN were radiographically apparent in 3/10 (30%), 4/19 (21%), and 1/6 (17%) cases respectively. Compared with MRI, radiographs are limited in their evaluation of the size (particularly the AP dimension) and characteristics (fragmentation, cystic change, and AVN) of non-displaced OCLTs. The most common appearance of non-displaced OCLTs is an ''ill-defined'' lucency at the talar dome. When this appearance is also considered, the estimated retrospective sensitivity of radiographs

  8. Identification and treatment of APS renal involvement.

    Science.gov (United States)

    Tektonidou, M G

    2014-10-01

    Renal involvement in antiphospholipid syndrome (APS), either primary or systemic lupus erythematosus (SLE)-related APS, includes renal artery stenosis or thrombosis, renal infarction, renal vein thrombosis and a small-vessel vaso-occlusive nephropathy defined as "antiphospholipid antibody (aPL)-associated nephropathy." aPL-associated nephropathy is characterized by acute lesions, thrombotic microangiopathy, and chronic lesions such as fibrous intimal hyperplasia, organizing thrombi with or without recanalization, fibrous occlusions of arteries or arterioles and focal cortical atrophy. Systemic hypertension, hematuria, proteinuria (ranging from mild to nephrotic level) and renal insufficiency represent the major clinical manifestations associated with aPL-associated nephropathy. Similar renal histologic and clinical characteristics have been described among all different groups of patients with positive aPL (primary APS, SLE-related APS, catastrophic APS and SLE/non-APS with positive aPL). In patients with aPL-associated nephropathy lesions in the absence of other causes associated with similar histological characteristics, aPL testing needs to be considered. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  9. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  10. Nondestructive examination - radiographic techniques

    International Nuclear Information System (INIS)

    Maier, H.J.

    1980-01-01

    First the basic principles of radiography are to be treated, especially the different radiation sources (X-ray, gamma-ray, neutrons, heat). In the second part those radiographic methods are shown, which are in common use for technical purposes, especially under the aspect of flaw recognition. (orig./RW)

  11. Matching hand radiographs

    NARCIS (Netherlands)

    Kauffman, J.A.; Slump, Cornelis H.; Bernelot Moens, H.J.

    2005-01-01

    Biometric verification and identification methods of medical images can be used to find possible inconsistencies in patient records. Such methods may also be useful for forensic research. In this work we present a method for identifying patients by their hand radiographs. We use active appearance

  12. Learner concerns of radiographers

    International Nuclear Information System (INIS)

    Popli, Pawan Kumar

    1998-01-01

    Today radiology is fastest developing branch of medical sciences. Most of the radiographers are trained in old fashion, most of training institutes lack proper equipment. It not only affects their career but radiological quality at large. For this purpose it is necessary to find out educational possibilities and needs of group. Therefore this project was taken up

  13. Radiographic analysis of shoulder anatomical arthroplasty

    Energy Technology Data Exchange (ETDEWEB)

    Merolla, Giovanni [Unit of Shoulder and Elbow Surgery, ' D. Cervesi' Hospital, L. Van Beethoven 46 Street, 47841 Cattolica (Italy)], E-mail: gmerolla@shouldertech.it; Di Pietto, Francesco; Romano, Stefania [Department of Diagnostic Imaging, ' A. Cardarelli' Hospital, Naples (Italy); Paladini, Paolo; Campi, Fabrizio; Porcellini, Giuseppe [Unit of Shoulder and Elbow Surgery, ' D. Cervesi' Hospital, L. Van Beethoven 46 Street, 47841 Cattolica (Italy)

    2008-10-15

    Arthroplasty is the standard treatment for advanced shoulder osteoarthritis. Modern prostheses designs have modular features whose size, shaft/head and body morphology can be adjusted. Total Shoulder Arthroplasty (TSA) provides better results. A complete X-ray follow-up is essential to assess the results and evaluate the survival rates of a shoulder prosthesis. Antero-posterior at 40 deg. in both internal and external rotation (true AP view) and axillary view are recommended to assess the following parameters: orientation and translation of the humeral component, offset, size and height of the humeral head, acromio-humeral distance, distribution and fixation of the cement, stress shielding and cortical resorption, radiolucent lines, subsidence and tilt, glenoid wear and 'bone stock', prostheses instability, glenoid component shift. Shoulder hemiarthroplasty can lead to glenoid wear; the true AP film at 40 deg. of internal rotation provides the best profile of gleno-humeral joint to depict glenoid erosion. Shift of the glenoid component in TSA is identified as tilting or medial migration on true AP and axillary views in the early postoperative period (1-2 months) and at minimum of 2 years. An exhaustive radiographic analysis remains essential to monitor the prosthetic implant and detect early and late complications or risk factors of prosthetic loosening.

  14. APS high heat load monochromator

    International Nuclear Information System (INIS)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  15. APS high heat load monochromator

    Energy Technology Data Exchange (ETDEWEB)

    Lee, W.K.; Mills, D.

    1993-02-01

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach.

  16. Initial image interpretation of appendicular skeletal radiographs: A comparison between nurses and radiographers

    International Nuclear Information System (INIS)

    Piper, Keith J.; Paterson, Audrey

    2009-01-01

    Purpose: To examine the effect of a short training programme on nurses and radiographers, exploring differences between their performance before and after training. Method: Twenty-two nurses and 18 radiographers interpreted 20 trauma radiographs of the appendicular skeleton before and after training. Normal and abnormal cases of a discriminatory nature were included. Total score, sensitivity and specificity values were calculated for each participant by comparison with an agreed expected answer. The area under the curve (AUC) was analysed using alternate free-response receiver operating characteristic (AFROC) methodology. Results: Significant differences were demonstrated between the total scores achieved by the two groups (pre-training: p = 0.007, post-training: p = 0.04). After training, the mean score increased significantly for both groups (p < 0.001). No significant difference was found between the radiographers mean pre-training scores and the nurses mean post-training scores (p = 0.66). Sensitivity for both groups increased following training, significantly so for the nurses (nurses: p < 0.001, radiographers: p = 0.06). Specificity reduced significantly after training for the nurses (p < 0.001), and increased for the radiographers but not significantly (p = 0.085). After training, there was no significant difference between the two groups in terms of sensitivity (p = 0.09) but specificity was significantly higher for the radiographers (p < 0.001). The radiographers achieved higher pre-training AUC values than the nurses (p = 0.04), although a difference remained after training this did not achieve statistical significance (p = 0.15). The AUC values increased significantly after training for both groups (nurses: p = 0.012, radiographers: p = 0.004) and again there was no significant difference between the radiographers pre-training performance and the nurses post-training performance (p = 0.62). Conclusion: Improvement after training was seen in both groups

  17. Shuttle APS propellant thermal conditioner study

    Science.gov (United States)

    Pearson, W. E.

    1971-01-01

    A study program was performed to allow selection of thermal conditioner assemblies for superheating O2 and H2 at supercritical pressures. The application was the auxiliary propulsion system (APS) for the space shuttle vehicle. The O2/H2 APS propellant feed system included propellant conditioners, of which the thermal conditioner assemblies were a part. Cryogens, pumped to pressures above critical, were directed to the thermal conditioner assembly included: (1) a gas generator assembly with ignition system and bipropellant valves, which burned superheated O2 and H2 at rich conditions; (2) a heat exchanger assembly for thermal conditioning of the cryogenic propellant; and (3) a dump nozzle for heat exchanger exhaust.

  18. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  19. Thrombotic risk assessment in APS: the Global APS Score (GAPSS).

    Science.gov (United States)

    Sciascia, S; Bertolaccini, M L

    2014-10-01

    Recently, we developed a risk score for antiphospholipid syndrome (APS) (Global APS Score or GAPSS). This score derived from the combination of independent risk factors for thrombosis and pregnancy loss, taking into account the antiphospholipid antibodies (aPL) profile (criteria and non-criteria aPL), the conventional cardiovascular risk factors, and the autoimmune antibodies profile. We demonstrate that risk profile in APS can be successfully assessed, suggesting that GAPSS can be a potential quantitative marker of APS-related clinical manifestations. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  20. Radiographic analysis of partial or total vertebral body resection

    International Nuclear Information System (INIS)

    Whitten, C.G.; Hammer, G.H.; El-Khoury, G.Y.; Hugus, J.; Weinstein, J.N.

    1991-01-01

    Partial and total vertebrectomies are used in the treatment of primary and metastatic neoplasms of the spine. Serial radiographic studies are crucial in the follow-up of patients with vertebrectomies. This paper presents 33 cases and illustrates radiographic examples of both successful and complicated vertebrectomies, including radiographic signs of local tumor recurrence, loosening, migration or fracture of the hardware or methylmethacrylate, bone graft failure, and progressive spinal instability

  1. Pocket atlas of radiographic anatomy

    International Nuclear Information System (INIS)

    Moeller, T.B.; Reif, E.; Stark, P.

    1993-01-01

    The 'Pocket Atlas of Radiographic Anatomy' presents 170 radiographs of the various body regions of adults, showing only the normal radiographic anatomy. Each radiograph is supplemented on the opposite page by a drawing of the particular body region. There is no commenting text, but the drawings are provided with captions in English. The atlas is a useful guide for interpreting radiographs. The pictures are arranged in chapters entitled as follows: Skeletal Imaging (skull, spine, upper extremity), lower extremity; Miscellaneous Plain Films (chest, mammogram, trachea, lung tomograms); Contrast Examinations (gastrointestinal tract, intravenous contrast examinations, arthrography, angiography); Special Examinations (myelograms, lymphangiograms, bronchograms, sialograms). (UWA). 348 figs [de

  2. Radiograph identifying means

    International Nuclear Information System (INIS)

    Sheldon, A.D.

    1983-01-01

    A flexible character-indentable plastics embossing tape is backed by and bonded to a lead strip, not more than 0.025 inches thick, to form a tape suitable for identifying radiographs. The lead strip is itself backed by a relatively thin and flimsy plastics or fabric strip which, when removed, allows the lead plastic tape to be pressure-bonded to the surface to be radiographed. A conventional tape-embossing gun is used to indent the desired characters in succession into the lead-backed tape, without necessarily severing the lead; and then the backing strip is peeled away to expose the layer of adhesive which pressure-bonds the indented tape to the object to be radiographed. X-rays incident on the embossed tape will cause the raised characters to show up dark on the subsequently-developed film, whilst the raised side areas will show up white. Each character will thus stand out on the developed film. (author)

  3. Radiographic testing of wood

    International Nuclear Information System (INIS)

    Osterloh, K.; Zscherpel, U.; Raedel, C.; Weidemann, G.; Meinel, D.; Goebbels, J.; Ewert, U.; Hasenstab, A.; Buecherl, T.

    2007-01-01

    Wood is an old and established consumption and construction material. It is still the most common material for constructing furniture, roofs, playgrounds and mine supports. In contrast to steel and concrete, wood warns of extreme loads by creaking. Its mechanical stability is more influenced by decay than by peripheral cracks. While external cracks are visible, internal decay by fungus growth is undetectable from outside. This may be a safety problem in supporting structures. The best analysis of the internal structure is provided by computed tomography, but this is also the most complex method, much more so than simple radiographic testing. However, the latter is made inaccurate by scattered radiation resulting from internal moisture. With the image processing options of digital radiographic techniques, the structural information can be separated effectively from noise. In contrast to X-ray and gamma radiography, neutron radiography provides information on the spatial distribution of moisture. In healthy wood, water is conducted in the sapwood while the hardwood is dry. Moisture in hardwood is caused by infestations, e.g. fungus growth. The contribution presents a comparative analysis of the available radiographic methods. (orig.)

  4. Westinghouse AP1000 licensing maturity

    International Nuclear Information System (INIS)

    Schulz, T.; Vijuk, R.P.

    2005-01-01

    The Westinghouse AP1000 Program is aimed at making available a nuclear power plant that is economical in the U.S deregulated electrical power industry in the near-term. The AP1000 is two-loop 1000 MWe pressurizer water reactor (PWR). It is an up rated version of the AP600. The AP1000 uses passive safety systems to provide significant and measurable improvements in plant simplification, safety, reliability, investment protection and plant costs. The AP1000 uses proven technology, which builds on over 35 years of operating PWR experience. The AP1000 received Final Design Approval by the United States Nuclear Regulatory Commission (U.S. NRC) in September 2004. The AP1000 meets the US utility requirements. The AP1000 and its sister plant the AP600 have gone through a very through and complete licensing review. This paper describes the U.S. NRC review efforts of both the AP600 and the AP1000. The detail of the review and the independent calculations, evaluations and testing is discussed. The AP600 licensing documentation was submitted in 1992. The U.S. NRC granted Final Design Approval in 1999. During the intervening 7 years, the U.S. NRC asked thousands of questions, performed independent safety analysis, audited Westinghouse calculations and analysis, and performed independent testing. The more significant areas of discussion will be described. For the AP1000 Westinghouse first engaged the U.S. NRC in pre-certification discussions to define the extent of the review required, since the design is so similar to the AP600. The AP1000 licensing documentation was submitted in March 2002. The U.S. NRC granted Final Design Approval in September 2004. During the intervening 2 1/2 years, the U.S. NRC asked hundreds of questions, performed independent safety analysis, audited Westinghouse calculations and analysis, and performed independent testing. The more significant areas of discussion will be described. The implications of this review and approval on AP1000 applications in

  5. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-12-22

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  6. Chest radiograph interpretation by medical students

    International Nuclear Information System (INIS)

    Jeffrey, D.R.; Goddard, P.R.; Callaway, M.P.; Greenwood, R.

    2003-01-01

    AIM: To assess the ability of final year medical students to interpret conventional chest radiographs. MATERIALS AND METHODS: Ten conventional chest radiographs were selected from a teaching hospital radiology department library that were good radiological examples of common conditions. All were conditions that a medical student should be expected to recognize by the end of their training. One normal radiograph was included. The radiographs were shown to 52 final year medical students who were asked to describe their findings. RESULTS: The median score achieved was 12.5 out of 20 (range 6-18). There was no difference between the median scores of male and female students (12.5 and 12.3, respectively, p=0.82) but male students were more likely to be certain of their answers than female students (median certainty scores 23.0 and 14.0, respectively). The overall degree of certainty was low. On no radiograph were more than 25% of students definite about their answer. Students had received little formal radiology teaching (2-42 h, median 21) and few expressed an interest in radiology as a career. Only two (3.8%) students thought they were good at interpreting chest radiographs, 17 (32.7%) thought they were bad or awful. CONCLUSION: Medical students reaching the end of their training do not perform well at interpreting simple chest radiographs. They lack confidence and have received little formal radiological tuition. Perhaps as a result, few are interested in radiology as a career, which is a matter for concern in view of the current shortage of radiologists in the UK

  7. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  8. Radiographic interpretation of the appendicular skeleton: A comparison between casualty officers, nurse practitioners and radiographers

    International Nuclear Information System (INIS)

    Coleman, Liz; Piper, Keith

    2009-01-01

    Aim: To assess how accurately and confidently casualty officers, nurse practitioners and radiographers, practicing within the emergency department (ED), recognize and describe radiographic trauma within an image test bank of 20 appendicular radiographs. Method: The participants consisted of 7 casualty officers, 13 nurse practitioners and 18 radiographers. All 20 radiographic examinations selected for the image test bank had been acquired following trauma and included some subtle, yet clinically significant abnormalities. The test bank score (maximum 40 marks), sensitivity and specificity percentages were calculated against an agreed radiological diagnosis (reference standard). Alternative Free-response Receiver Operating Characteristic (AFROC) analysis was used to assess the overall performance of the diagnostic accuracy of these professional groups. The variation in performance between each group was measured using the analysis of variance (ANOVA) test, to identify any statistical significant differences in the performance in interpretation between these groups. The relationship between the participants' perceived image interpretation accuracy during clinical practice and the actual accuracy of their image test bank score was examined using Pearson's Correlation Coefficient (r). Results: The results revealed that the radiographers gained the highest mean test bank score (28.5/40; 71%). This score was statistically higher than the mean test bank scores attained by the participating nurse practitioners (21/40; 53%) and casualty officers (21.5/40; 54%), with p < 0.01 and p = 0.02, respectively. When compared with each other, the scores from these latter groups showed no significant difference (p = 0.91). The mean 'area under the curve' (AUC) value achieved by the radiographers was also significantly higher (p < 0.01) in comparison to the AUC values demonstrated by the nurse practitioners and casualty officers, whose results, when compared, showed no significant

  9. Barron's AP English literature and composition

    CERN Document Server

    Ehrenhaft EdD, George

    2016-01-01

    Includes five full-length practice AP exams with all questions answered and explained. Also features additional reviews on poetry, fiction, and drama, definitions of 175 literary and rhetorical terms, and more. Can be purchased alone or with an optional CD-ROM with two additional practice tests.

  10. The Demographic Wave: Rethinking Hispanic AP Trends

    Science.gov (United States)

    Edwards, Kelcey; Sawtell, Ellen

    2013-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  11. MR imaging during arterial-portography (MR-AP) in the detection of hepatic tumor. Comparison with CT-AP

    International Nuclear Information System (INIS)

    Kajiya, Yoshiki; Nakajo, Masayuki; Miyazono, Nobuaki; Kajiya, Yoriko; Fujiyoshi, Fumito; Ichinari, Naohide

    1997-01-01

    This study was undertaken to compare the detection rate of hepatic space occupying lesion (SOLs) between computed tomography during arterial portography (CT-AP) and magnetic resonance imaging during arterial portography (MR-AP) and the differences in time intensity curve on MR-AP between HCC, metastatic tumor, FNH, and hemangioma. We performed CT-AP and MR-AP in 17 patients including 14 cases of HCC and one each of metastasis, FNH, and hemangioma. MR-AP was performed by Turbo-FLASH sequence. There was no statistically significant difference between CT-AP and MR-AP in detecting satellite lesions in terms of smallest diameter and number of flow defects (p>0.05). Hemangioma showed rapid enhancement after the first pass and, consequently, the same enhancement as the hepatic parenchyma. MR-AP was comparable to CT-AP in the detection of hepatic SOLs. Hemangioma showed an enhancement pattern different from those of HCC, metastatic tumor, and FNH, which showed patterns similar to each other. (author)

  12. Clinical manifestations of antiphospholipid syndrome (APS) with and without antiphospholipid antibodies (the so-called 'seronegative APS').

    Science.gov (United States)

    Rodriguez-Garcia, Jose Luis; Bertolaccini, Maria Laura; Cuadrado, Maria Jose; Sanna, Giovanni; Ateka-Barrutia, Oier; Khamashta, Munther A

    2012-02-01

    Although the medical literature currently provides a growing number of isolated case reports of patients with clinically well-defined antiphospholipid syndrome (APS) and persistently negative antiphospholipid antibodies (aPL), there are no studies including a series of patients addressing the clinical features of this condition. The authors assessed clinical manifestations of APS in 154 patients: 87 patients with seropositive APS and 67 patients with thrombosis and/or pregnancy morbidity persistently negative for aPL and presenting with at least two additional non-criteria manifestations of APS (the so-called 'seronegative APS', SN-APS). Patients were interviewed at the time of recruitment, and a retrospective file review was carried out. There were no significant differences in the frequency of thrombotic events or obstetric morbidity in patients with SN-APS versus patients with seropositive APS: deep vein thrombosis (31.4% vs 31.0%), pulmonary embolism (23.8% vs 28.7%), stroke (14.9% vs 17.2%), transient ischaemic attack (11.9% vs 10.3%), early spontaneous abortions (67.1% vs 52.1%), stillbirths (62.5% vs 59.4%), prematurity (28.1% vs 21.7%) or pre-eclampsia (28.1% vs 23.1%). Classic and SN-APS patients show similar clinical profiles. The results suggest that clinical management in patients with APS should not be based only on the presence of conventional aPL.

  13. Review on radiographic inspection in 1982

    International Nuclear Information System (INIS)

    Maruyama, Yutaka

    1983-01-01

    This is a report of the activities in the radiographic inspection department of Japanese Society for Non-destructive Inspection. The contents of activities are described about the following 15 items: standards, minimum discernible contrast and image distribution, contrast meter and penetrameter sensitivity, testing conditions, detection limit and simulation, photographing method for tube welding and corner welding, relationship between irradiation direction and flaw detectability, abnormal images, RI sources, X-ray equipment and observing device, sensitive materials, detectors, image processing and X-ray TV and automation, neutron radiography, other application and new techniques, and safety. Concerning the ''standards'', discussion was performed on revising JIS Z 3105 ''Methods of Radiographic Test and Classification of Radiographs for Aluminum Welds''. In ''Abnormal images'', the verification by the author that the abnormal shadows generated in the radiographic images of austenitic steel welded parts are the diffraction phenomenon to satisfy the Bragg's conditions is reported. In ''RI sources'', Yb-169 was found to be a good radiation source for relatively thin steel plates. In ''neutron radiography'', it was confirmed that the neutron radiography using a cyclotron as a neutron source can be used practically by its fundamental tests. ''Application and new techniques'' include a trial to utilize scattered radiation as a source, the testing method of γ shield for spent fuel transportation, the improvement of X-ray radiographic test for titanium thin plates and thin wall tubes, and others. (Wakatsuki, Y.)

  14. AP1000 Design for Security

    International Nuclear Information System (INIS)

    Long, L.B.; Cummins, W.E.; Winters, J.W.

    2006-01-01

    Nuclear power plants are protected from potential security threats through a combination of robust structures around the primary system and other vital equipment, security systems and equipment, and defensive strategy. The overall objective for nuclear power plant security is to protect public health and safety by ensuring that attacks or sabotage do not challenge the ability to safely shutdown the plant or protect from radiological releases. In addition, plants have systems, features and operational strategies to cope with external conditions, such as loss of offsite power, which could be created as part of an attack. Westinghouse considered potential security threats during design of the AP1000 PWR. The differences in plant configuration, safety system design, and safe shutdown equipment between existing plants and AP1000 affect potential vulnerabilities. This paper provides an evaluation of AP1000 with respect to vulnerabilities to security threats. The AP1000 design differs from the design of operating PWRs in the US in the configuration and the functional requirements for safety systems. These differences are intentional departures from conventional PWR designs which simplify plant design and enhance overall safety. The differences between the AP1000 PWR and conventional PWRs can impact vulnerabilities to security threats. The NRC addressed security concerns as part of their reviews for AP1000 Design Certification, and did not identify any security issues of concern. However, much of the detailed security design information for the AP1000 was deferred to the combined Construction and Operating License (COL) phase as many of the security issues are site-specific. Therefore, NRC review of security issues related to the AP1000 is not necessarily complete. Further, since the AP1000 plant design differs from existing PWRs, it is not obvious that the analyses and assessments prepared for existing plants also apply to the AP1000. We conclude that, overall, the AP1000

  15. AP1000. The PWR revisited

    International Nuclear Information System (INIS)

    The distinguishing features of Westinghouse's AP1000 advanced passive pressurized water reactor are highlighted. In particular, the AP1000's passive safety features are described as well as their implications for simplifying the design, construction, and operation of this design compared to currently operating plants, and significantly increasing safety margins over current plants as well. The AP1000 design specifically incorporates the knowledge acquired from the substantial accumulation of power reactor operating experience and benefits from the application of the Probabilistic Risk Assessment in the design process itself. The AP1000 design has been certified by the US Nuclear Regulatory Commission under its new rules for licensing new nuclear plants, 10 CFR Part 52, and is the subject of six combined Construction and Operating License applications now being developed. Currently the AP1000 design is being assessed against the EUR Rev C requirements for new nuclear power plants in Europe. (author)

  16. Avaliação radiográfica da descompensação do tronco após artrodese seletiva torácica em portadores de escoliose idiopática do adolescente King II (Lenke B e C Evaluación radiográfica de la descompensación del tronco después de una artrodesis selectiva torácica en portadores de escoliosis idiopática del adolescente King II (Lenke B y C Radiographic evaluation of trunk decompensation with selective thoracic arthrodesis in patients with adolescent idiopathic scoliosis type King II (Lenke B e C

    Directory of Open Access Journals (Sweden)

    Osmar Avanzi

    2009-12-01

    lumbar de 49±13%, se verificó descompensación coronal inmediata en seis pacientes (27,20%. Después de acompañamiento promedio de 65 meses, cuatro pacientes (18,18% estaban con el tronco descompensado. En sólo un paciente fue necesaria una extensión de la artrodesis, incluyendo la curva lumbar. CONCLUSIONES: la descompensación grave del tronco con necesidad de un segundo procedimiento para artrodesis lumbar fue una complicación no frecuente en esta serie de casos.OBJECTIVE: to evaluate radiographic results regarding trunk decompensation of AIS treated with selective thoracic arthrodesis and 3ª generation instrumentation. METHODS: pre-operatory, immediately post-operatory and last radiography evaluations were carried out in 22 patients with adolescent idiopathic scoliosis AIS type King II treated with selective thoracic arthrodesis from 1993 to 2007. The percentage of correction of the thoracic and lumbar curve was observed by means of Cobb method, as well as the trunk coronal balance by using SRS criteria. RESULTS: after mean percentage of correction in thoracic curve of 56 ± 11% and 49 ± 13% in lumbar curve, we observed an immediate coronal decompensation in six patients (27.20%. After a mean 65-month follow-up, four patients (18.18% showed trunk coronal decompensation. Only one patient needed a new surgery with arthrodesis extension, including the lumbar curve, due to lumbar curve decompensation. CONCLUSIONS: severe trunk decompensation in need of a second procedure for lumbar fusion was not a frequent complication in this series.

  17. Radiographic scanning agent

    International Nuclear Information System (INIS)

    Bevan, J.A.

    1983-01-01

    This invention relates to radiodiagnostic agents and more particularly to a composition and method for preparing a highly effective technetium-99m-based bone scanning agent. One deficiency of x-ray examination is the inability of that technique to detect skeletal metastases in their incipient stages. It has been discovered that the methanehydroxydiphosphonate bone mineral-seeking agent is unique in that it provides the dual benefits of sharp radiographic imaging and excellent lesion detection when used with technetium-99m. This agent can also be used with technetium-99m for detecting soft tissue calcification in the manner of the inorganic phosphate radiodiagnostic agents

  18. Radiopaque intrahepatic duct stones in plain radiograph: case report

    International Nuclear Information System (INIS)

    Kim, Mi Young; Suh, Chang Hae; Park, Chan Sup; Chung, Won Kyun

    1994-01-01

    We experienced 3 cases of intrahepatic duct stones detected on plain radiographs. The patients had history of multiple episodes of recurrent cholangitis. Radiographic characteristics of these stones included multiple, round or rectangular radiopaque densities surrounded by calcified rim; these densities showed a branching pattern along the intrahepatic ducts

  19. The best method for evaluating anteversion of the acetabular component after total hip arthroplasty on plain radiographs.

    Science.gov (United States)

    Park, Yang Soo; Shin, Won Chul; Lee, Sang Min; Kwak, Sang Ho; Bae, Jung Yun; Suh, Kuen Tak

    2018-04-02

    Several radiological methods for measuring the anteversion of the acetabular component after total hip arthroplasty (THA) exist, and no single standardized method has been established. We evaluated the reliability and accuracy of six widely utilized methods (Liaw et al., Lewinnek et al., Widmer, Hassan et al., Ackland et al., and Woo and Morrey) for measuring anteversion on plain radiographs, using a reference standard in the same definition obtained from the PolyWare programme. We reviewed 71 patients who underwent primary unilateral THA. The anteversion of the acetabular component was measured on pelvis AP radiographs using five different methods (Liaw et al., Lewinnek et al., Widmer, Hassan et al., and Ackland et al.) and on cross-table lateral radiographs using the method of Woo and Morrey. The values obtained using the PolyWare programme, which determines the anteversion of the acetabular component by edge detection, were regarded as the reference standard. Intra- and inter-observer reliabilities were excellent for all methods using plain radiographs, including the PolyWare programme. The method of Liaw et al. obtained values similar to those obtained using the PolyWare programme and was thus considered accurate (P = 0.447). However, values obtained using the other five methods significantly differed from those obtained using the PolyWare programme and were thus considered less accurate (P < 0.001, P < 0.001, P < 0.001, P = 0.007, and P < 0.001, respectively). The method of Liaw et al. is more accurate than other methods using plain radiographs for the measurement of the anteversion of the acetabular component after THA, with reference to the anteversion obtained from the PolyWare programme.

  20. Interpreting radiographs. 4. The carpus

    International Nuclear Information System (INIS)

    Burguez, P.N.

    1984-01-01

    The complexity of the carpus which has three major joints, seven or eight carpal bones and five adjacent bones, each of which articulates with one or more of the carpal elements, necessitates good quality radiographs for definitive radiographic interpretation may be extremely difficult because of the disparity between radiographic changes and obvious clinical signs and, therefore, must be discussed in the light of a thorough clinical assessment

  1. Simulated radiographic bone and joint modeling from 3D ankle MRI: feasibility and comparison with radiographs and 2D MRI

    Energy Technology Data Exchange (ETDEWEB)

    Nordeck, Shaun M. [University of Texas Southwestern Medical College, Dallas, TX (United States); University of Texas Southwestern Medical Center, Musculoskeletal Radiology, Dallas, TX (United States); Koerper, Conrad E.; Adler, Aaron [University of Texas Southwestern Medical College, Dallas, TX (United States); Malhotra, Vidur; Xi, Yin [University of Texas Southwestern Medical Center, Musculoskeletal Radiology, Dallas, TX (United States); Liu, George T. [University of Texas Southwestern Medical Center, Orthopaedic Surgery, Dallas, TX (United States); Chhabra, Avneesh [University of Texas Southwestern Medical Center, Musculoskeletal Radiology, Dallas, TX (United States); University of Texas Southwestern Medical Center, Orthopaedic Surgery, Dallas, TX (United States)

    2017-05-15

    The purpose of this work is to simulate radiographs from isotropic 3D MRI data, compare relationship of angle and joint space measurements on simulated radiographs with corresponding 2D MRIs and real radiographs (XR), and compare measurement times among the three modalities. Twenty-four consecutive ankles were included, eight males and 16 females, with a mean age of 46 years. Segmented joint models simulating radiographs were created from 3D MRI data sets. Three readers independently performed blinded angle and joint space measurements on the models, corresponding 2D MRIs, and XRs at two time points. Linear mixed models and the intraclass correlation coefficient (ICC) was ascertained, with p values less than 0.05 considered significant. Simulated radiograph models were successfully created in all cases. Good agreement (ICC > 0.65) was noted among all readers across all modalities and among most measurements. Absolute measurement values differed between modalities. Measurement time was significantly greater (p < 0.05) on 2D versus simulated radiographs for most measurements and on XR versus simulated radiographs (p < 0.05) for nearly half the measurements. Simulated radiographs can be successfully generated from 3D MRI data; however, measurements differ. Good inter-reader and moderate-to-good intra-reader reliability was observed and measurements obtained on simulated radiograph models took significantly less time compared to measurements with 2D and generally less time than XR. (orig.)

  2. The Ped-APS Registry: the antiphospholipid syndrome in childhood.

    Science.gov (United States)

    Avcin, T; Cimaz, R; Rozman, B

    2009-09-01

    In recent years, antiphospholipid syndrome (APS) has been increasingly recognised in various paediatric autoimmune and nonautoimmune diseases, but the relatively low prevalence and heterogeneity of APS in childhood made it very difficult to study in a systematic way. The project of an international registry of paediatric patients with APS (the Ped-APS Registry) was initiated in 2004 to foster and conduct multicentre, controlled studies with large number of paediatric APS patients. The Ped-APS Registry is organised as a collaborative project of the European Forum on Antiphospholipid Antibodies and Juvenile Systemic Lupus Erythematosus Working Group of the Paediatric Rheumatology European Society. Currently, it documents a standardised clinical, laboratory and therapeutic data of 133 children with antiphospholipid antibodies (aPL)-related thrombosis from 14 countries. The priority projects for future research of the Ped-APS Registry include prospective enrollment of new patients with aPL-related thrombosis, assessment of differences between the paediatric and adult APS, evaluation of proinflammatory genotype as a risk factor for APS manifestations in childhood and evaluation of patients with isolated nonthrombotic aPL-related manifestations.

  3. Final report for tank 241-AP-108, grab samples 8AP-96-1, 8AP-96-2 and 8AP-96-FB

    International Nuclear Information System (INIS)

    Esch, R.A.

    1996-01-01

    This document is the final report deliverable for the tank 241-AP-108 grab samples. The samples were subsampled and analyzed in accordance with the TSAP. Included in this report are the results for the Waste Compatibility analyses, with the exception of DSC and thermogravimetric analysis (TGA) results which were presented in the 45 Day report (Part 2 of this document). The raw data for all analyses, with the exception of DSC and TGA, are also included in this report

  4. Visual perception and radiographic interpretation

    International Nuclear Information System (INIS)

    Papageorges, M.

    1998-01-01

    Although interpretation errors are common in radiology, their causes are still debated. Perceptual mechanisms appear to be responsible for a large proportion of mistakes made by both neophytes and trained radiologists. Erroneous perception of familiar contours can be triggered by unrelated opacities. Conversely, visual information cannot induce a specific perception if the observer is not familiar with the concept represented or its radiographicappearance. Additionally, the area of acute vision is smaller than is commonly recognized. Other factors, such as the attitude, beliefs,.: preconceptions, and expectations of the viewer, can affect what he or she ''sees'' whenviewing any object, including a radiograph. Familiarity with perceptual mechanisms and the limitations of the visual system as well as multiple readings may be necessary to reduce interpretation errors

  5. Consumo de antimicrobianos en APS

    Directory of Open Access Journals (Sweden)

    María Cristina Lara Bastanzuri

    2003-08-01

    Full Text Available Con el propósito de describir el patrón de uso de los medicamentos para el tratamiento con antimicrobianos en APS en Cuba en el período de 1989 al 2000, se diseñó un estudio descriptivo, observacional y retrospectivo clasificado dentro de los estudios de utilización de medicamentos como de consumo. Para ello se calcularon las dosis diarias definidas cada día de determinado fármaco de los grupos clasificados según ATC como tetraciclinas, anfenicoles, penicilinas de amplio espectro, cefalosporinas, sulfonamidas y trimetoprim, macrólidos, estreptomicinas y quinolonas. Además, se tomaron las cifras de pacientes inscriptos a penicilina benzatínica y se comparó con la población expuesta obtenida a partir de las DHD. Las penicilinas son las de mayor consumo con tendencia al aumento, igual que los aminoglucósidos, mientras que la tetraciclina presenta cifras mayores de DHD. La tendencia del cloranfenicol es a disminuir. La población expuesta está muy por debajo de los pacientes inscriptos en penicilina benzatínica y las líneas de tendencia no son similares. Excepto la docixiclina, el resto de los antimicrobianos recomendados en la Guía Terapéutica para APS se encuentran en el Listado Básico de Medicamentos del país para el nivel primario de atención médica.With the objective of describing the pattern of drug use in antimicrobial-based treatment in the primary health care in Cuba from 1989 to 2000, we designed a retrospective descriptive and observational study, classified into the study of drug use as consumption. To this end, the daily doses of certain drugs from the ATC-classified groups were calculated, which included tetracycline, amphenicols, broad spectrum penicilins, cephalosporins, sulfonamides, trimethoprim, macrolides, streptomycin and quinolones. Also, the number of patients registered as benzathine peniciline consumers was taken and compared to the exposed population data obtained from the DHD. Penicillins are the

  6. Meet the APS Editors Reception

    Science.gov (United States)

    2014-03-01

    The APS Journal Editors invite you to join them for conversation and light refreshments. The Editors will be available to answer questions, discuss your ideas, and listen to your comments about the journals. All are welcome to attend.

  7. Radiographic and histological study of perennial bone defect repair in rat calvaria after treatment with blocks of porous bovine organic graft material Estudo radiográfico e histológico do reparo de defeito ósseo perene em calvária de rato após o tratamento com material de enxerto orgânico bovino poroso

    Directory of Open Access Journals (Sweden)

    Lucele Vieira Marins

    2004-03-01

    sseo têm sido lançados no comércio para serem utilizados em cirurgias bucomaxilofaciais. Na presente pesquisa avaliamos a capacidade de um material de enxerto ósseo orgânico em bloco (Gen-ox, Baumer SA - Brasil preparado à partir de osso medular bovino, em promover a reparação de lesões ósseas de tamanho crítico em calvária de ratos. Uma lesão trans-óssea de aproximadamente 8mm de diâmetro foi realizada com trefina cirúrgica nos ossos parietais de 25 ratos, sendo que em 15 os defeitos foram preenchidos com bloco de 8mm de diâmetro do material de enxerto, embebida com sangue do próprio animal e em 10 somente com coágulo sanguíneo. As calvárias dos ratos tratados com o material foram coletadas após 1, 3 e 6 meses após as cirurgias e dos tratados com coágulo sanguíneo, imediatamente após as cirurgias e decorridos 6 meses. Durante as cirurgias verificamos que esse material enxertado é de fácil manuseio e se adapta perfeitamente ao leito receptor após sua embebição com sangue. Os resultados obtidos mostraram que na maioria dos casos tratados, o material foi reabsorvido lentamente e serviu como material de preenchimento e mantenedora de espaço, favorecendo a angiogênese, migração e adesão celular e a neoformação óssea à partir das bordas da lesão. No entanto, em 2 casos no subgrupo tratado - 1 mês e 1 caso no subgrupo tratado - 3 meses, ocorreu a presença de reação granulomatosa tipo corpo estranho com a presença de inúmeras células gigantes, que inibiu a neoformação óssea local. Esses casos foram interpretados como decorrentes de falhas na desmineralização e na retirada de potenciais fatores antigênicos durante a produção do biomaterial. Concluímos que com um aprimoramento do controle de qualidade na linha de produção do material, a matriz orgânica medular em bloco poderá ser uma boa alternativa para ser usada no reparo de defeitos ósseos na região buco-maxilofacial, devido a sua alta capacidade osteocondutora.

  8. Odontogenic keratocyst radiographic features

    International Nuclear Information System (INIS)

    Nartey, N. O.; Saini, T.

    1990-01-01

    The clinical features often patients with odontogenic keratocysts were studied. One patient had Gorlin-GoJtz syndrome. A total of fourteen radiolucent lesions were observed on radiographic examination. All the fourteen lesions were diagnosed as odontogenic keratocyst after histopathclogical examination of biopsied tissue from the patients. The age at diagnosis ranged from 25-72 years with a mean age of 37.6 years. The male : female ratio was 2.3:1. Thirteen of these lesions occurred in the mandible, nine involved the mandibular third molar region. Involvement of the ramus of the mandible produced a sausage-shaped radiolucency. Cystic lesions which have been present for long periods of time showed scalloped margins, due to the regional resorption of the surrounding bone. The bony ledges present on the cortical bones simulated multilocular appearance in such cases. It was also observed that the lesions in older individuals perforated the cortical plates rather than eliciting a periostally induced bony expansion. (author)

  9. Radiographic contrast media

    International Nuclear Information System (INIS)

    Golman, K.; Holtz, E.; Almen, T.

    1987-01-01

    Contrast media are used in diagnostic radiology to enhance the X-ray attenuation between a body structure of interest and the surrounding tissue. A detail becomes perceptible on a roentgenogram only when its contrast exceeds a minimum value in relation to the background. Small areas of interest must have higher contrast than the background. The contrast effect depends on concentration of the contrast media with the body. A high contrast media concentration difference thus gives rise to more morphological details in the radiographs. Contrast media can be divided into negative contrast media such as air and gas which attenuate X-rays less than the body tissues, and positive contrast materials which attenuate X-rays more than the body tissues. The positive contrast media all contain either iodine (atomic number 53) or barium (atomic number 56) and can be divided into water-insoluble and water-soluble contrast media

  10. Emotional Intelligence Throughout the Lifecycle of Australian Radiographers.

    Science.gov (United States)

    Lewis, Sarah Jayne; Eccles, Grace Rose; Mackay, Stuart James; Robinson, John

    2017-09-01

    To measure global and domain trait emotional intelligence (EI) throughout the professional lifecycle of Australian radiographers and report the trends. A combination retrospective and prospective cross-sectional multiple-cohort study using the Trait Emotional Intelligence Questionnaire Short Form (TEIQue-SF) was designed to collect global and domain trait EI scores of several populations, including radiography students (n = 95), inexperienced radiographers (0-5 years' experience; n = 94), experienced radiographers (≥ 6 years' experience; n = 451), chief radiographers (n = 107), clinical educators (n = 24), application specialists (n = 24), and radiographers working in education (n = 15). Mean EI scores were calculated and statistical tests were performed to determine whether significant differences existed among the groups. Statistically significant differences were found among populations for global EI and the domains of self-control and well-being, with students demonstrating consistently lower scores than qualified radiographers ( P ≥ .001). Chief radiographers demonstrated higher scores for well-being than inexperienced radiographers, radiographers working in education, and students ( P < .001). Global EI scores increased steadily throughout the professional lifecycle of Australian radiographers, plateauing at 10 years of clinical experience. Chief radiographers demonstrated the highest scores for well-being, which is consistent with prior research acknowledging the importance of EI in organizational leadership. Students demonstrated lower EI scores likely because they are at the beginning of their careers and might not yet perceive themselves as confident or successful. Higher EI scores are expected in normal career advancement, plateauing at about 10 years of clinical experience. A statistically significant difference exists between global and domain trait EI scores throughout the professional lifecycle of Australian radiologic technologists. Global trait

  11. AP1000TM plant modularization

    International Nuclear Information System (INIS)

    Cantarero L, C.; Demetri, K. J.; Quintero C, F. P.

    2016-09-01

    The AP1000 TM plant is an 1100 M We pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. Modules are used extensively in the design of the AP1000 plant nuclear island. The AP1000 plant uses modern, modular-construction techniques for plant construction. The design incorporates vendor-designed skids and equipment packages, as well as large, multi-ton structural modules and special equipment modules. Modularization allows traditionally sequential construction tasks to be completed simultaneously. Factory-built modules can be installed at the site in a planned construction schedule. The modularized AP1000 plant allows many more construction activities to proceed in parallel. This reduces plant construction calendar time, thus lowering the costs of plant financing. Furthermore, performing less work onsite significantly reduces the amount of skilled field-craft labor, which costs more than shop labor. In addition to labor cost savings, doing more welding and fabrication in a factory environment raises the quality of work, allowing more scheduling flexibility and reducing the amount of specialized tools required onsite. The site layout for the AP1000 plant has been established to support modular construction and efficient operations during construction. The plant layout is compact, using less space than previous conventional plant layouts. This paper provides and overview of the AP1000 plant modules with an emphasis on structural modules. Currently the Westinghouse AP1000 plant has four units under construction in China and four units under construction in the United States. All have shown successful fabrication and installation of various AP1000 plant modules. (Author)

  12. Clavicle segmentation in chest radiographs

    NARCIS (Netherlands)

    Hogeweg, L.E.; Sanchez, C.I.; Jong, P.A. de; Maduskar, P.; Ginneken, B. van

    2012-01-01

    Automated delineation of anatomical structures in chest radiographs is difficult due to superimposition of multiple structures. In this work an automated technique to segment the clavicles in posterior-anterior chest radiographs is presented in which three methods are combined. Pixel classification

  13. The use of reference image criteria in X-ray diagnostics: an application for the optimisation of lumbar spine radiographs

    International Nuclear Information System (INIS)

    Almen, A.; Tingberg, A.; Mattsson, S.; Besjakov, J.

    2004-01-01

    To ensure that sufficient image quality is obtained in diagnostic radiology, the image quality of clinical radiographs has to be evaluated. We present two methods herein for evaluating antero-posterior (AP) radiographs of the lumbar spine. One was using image criteria, including six anatomical details (absolute method). In the other, the visibility of anatomical details relative to a reference radiograph was evaluated (visual grading analysis). In total, 14 technique groups were evaluated. The technique groups differed in tube voltage and detector system characteristics. Six different gradients of the H and D curves were simulated. The visual grading analysis showed larger differences in image quality compared with the absolute method. The influence on the image quality due to a variation in tube voltage was easier to detect than the influence on the image quality from the detector characteristics. The visibility of the anatomical details was significantly dependent on the location in the spine. The visual grading analysis was found to be the preferable evaluation method in studies such as the present; however, it is necessary to guide and train the observer before the evaluation is performed. (orig.)

  14. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (I): catastrophic APS, APS nephropathy and heart valve lesions.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyse the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analysed on the catastrophic APS, APS nephropathy and heart valve lesions, and presents the recommendations elaborated by the Task Force after this analysis.

  15. [Diverse histological lesions in a patient with antiphospholipid syndrome (APS)].

    Science.gov (United States)

    Salvatore, Ermanno; Luciani, Remo; Di Palma, Annamaria; Aversano, Arturo; Stellato, Davide; Liuzzi, Marco; Iele, Emilio; Martignetti, Vinicio; Spagnuolo, Enrico; Morrone, Luigi

    2011-01-01

    Antiphospholipid syndrome (APS) is a rare autoimmune disorder. It can be secondary to systemic lupus erythematosus (SLE) or occur in the absence of autoimmune disease. The hallmark of this so-called primary APS is the presence of circulating antiphospholipid antibodies. Renal involvement in primary APS is caused by thrombosis within the renal vasculature. Recently, nonthrombotic glomerulonephritic renal lesions have been described in primary APS as a new histological entity. We here report a patient with primary APS in whom both lesion types were present. A 58-year-old Caucasian man with no significant past medical history presented to our nephrology unit with diffuse edema. Urinalysis showed proteinuria exceeding 400 mg/dL. The autoantibody panel (p-ANCA, c- ANCA, anti-nucleus, anti-DS-DNA) was negative except for anticardiolipin antibodies, which tested positive in two different samples. The diagnostic workup included a kidney biopsy that revealed thrombotic lesions compatible with primary APS and a typical pattern of focal segmental glomerulosclerosis. The kidney is a major target in APS but the exact mechanism underlying the pathogenesis of APS nephropathy has been poorly recognized. The use of kidney biopsy is a fundamental diagnostic tool in this setting, with possible implications also from a prognostic and therapeutic viewpoint.

  16. Development of a superconducting undulator for the APS

    International Nuclear Information System (INIS)

    Ivanyushenkov, Y; Abliz, M; Doose, C; Fuerst, J; Hasse, Q; Kasa, M; Trakhtenberg, E; Vasserman, I; Gluskin, E; Lev, V; Mezentsev, N; Syrovatin, V; Tsukanov, V

    2013-01-01

    As the western hemisphere's premier x-ray synchrotron radiation source, the Advanced Photon Source (APS) continues to advance the state of the art in insertion device technology in order to maintain record high brightness, especially in the hard x-ray wavelength region. Due to the unique bunch pattern used for normal APS operations and its ultimate capabilities, the APS has chosen superconducting technology for its future hard x-ray undulator sources. In the last several years, the APS in collaboration with the Budker Institute of Nuclear Physics has being developing the technology for planar, small-period superconducting undulators (SCUs). These developments include the design and construction of several prototypes and the construction of the necessary mechanical, vacuum, and cryogenic infrastructure at the APS site. Several prototypes of the SCU magnetic structure have been built and tested. The first SCU is assembled and will be installed in the APS storage ring at the end of 2012. Expected SCU performance in terms of x-ray brightness should noticeably exceed that of existing APS undulators. Immediately after commissioning, the SCU will be used at APS Sector 6 as the radiation source for high-energy x-ray studies.

  17. Retrospective assessment of thoracic radiographic findings in metastatic canine hemangiosarcoma

    International Nuclear Information System (INIS)

    Hammer, A.S.; Bailey, M.Q.; Sagartz, J.E.

    1994-01-01

    Twenty-one dogs with histopathologically confirmed hemangiosarcoma were evaluated by thoracic radiography for metastatic disease. All dogs had histopathologic examinations of the lungs within two weeks of thoracic radiography. Fourteen dogs had histopathologic evidence of pulmonary hemangiosarcoma; metastatic disease was detected radiographically in eleven of these dogs. The most common radiographic pattern was that of poorly defined small coalescing nodules (8 dogs); other radiographic patterns included well-circumscribed nodules (3 dogs) and alveolar infiltrates secondary to hemorrhage (2 dogs). Differential diagnoses for diffuse, poorly defined, coalescing pulmonary opacities should include hemangiosarcoma in addition to edema, lymphoma, systemic mycoses, fibrosis, allergy, toxicosis, and carcinomas

  18. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  19. Beryllium window for an APS diagnostics beamline

    International Nuclear Information System (INIS)

    Sheng, I.C.; Yang, B.X.; Sharma, Y.S.

    1997-01-01

    A beryllium (Be) window for an Advanced Photon Source (APS) diagnostics beamline has been designed and built. The window, which has a double concave axisymmetrical profile with a thickness of 0.5 mm at the center, receives 160 W/mm 2 (7 GeV/100 mA stored beam) from an undulator beam. The window design as well as thermal and thermomechanical analyses, including thermal buckling of the Be window, are presented

  20. Chest radiographic features of human metapneumovirus infection in pediatric patients

    Energy Technology Data Exchange (ETDEWEB)

    Hilmes, Melissa A.; Daniel Dunnavant, F.; Singh, Sudha P.; Ellis, Wendy D. [Vanderbilt University School of Medicine, Department of Radiology, Nashville, TN (United States); Payne, Daniel C. [Centers for Disease Control and Prevention, Atlanta, GA (United States); Zhu, Yuwei [Vanderbilt University School of Medicine, Department of Biostatistics, Nashville, TN (United States); Griffin, Marie R. [Vanderbilt University School of Medicine, Department of Health Policy, Nashville, TN (United States); Edwards, Kathryn M. [Vanderbilt University School of Medicine, Department of Pediatrics, Nashville, TN (United States); Williams, John V. [University of Pittsburgh School of Medicine, Department of Pediatrics, Pittsburgh, PA (United States); University of Pittsburgh of UPMC, Children' s Hospital of Pittsburgh, Pittsburgh, PA (United States)

    2017-12-15

    Human metapneumovirus (HMPV) was identified in 2001 and is a common cause of acute respiratory illness in young children. The radiologic characteristics of laboratory-confirmed HMPV acute respiratory illness in young children have not been systematically assessed. We systematically evaluated the radiographic characteristics of acute respiratory illness associated with HMPV in a prospective cohort of pediatric patients. We included chest radiographs from children <5 years old with acute respiratory illness who were enrolled in the prospective New Vaccine Surveillance Network (NVSN) study from 2003 to 2009 and were diagnosed with HMPV by reverse transcription-polymerase chain reaction (RT-PCR). Of 215 HMPV-positive subjects enrolled at our tertiary care children's hospital, 68 had chest radiographs obtained by the treating clinician that were available for review. Two fellowship-trained pediatric radiologists, independently and then in consensus, retrospectively evaluated these chest radiographs for their radiographic features. Parahilar opacities were the most commonly observed abnormality, occurring in 87% of children with HMPV. Hyperinflation also occurred frequently (69%). Atelectasis (40%) and consolidation (18%) appeared less frequently. Pleural effusion and pneumothorax were not seen on any radiographs. The clinical presentations of HMPV include bronchiolitis, croup and pneumonia. Dominant chest radiographic abnormalities include parahilar opacities and hyperinflation, with occasional consolidation. Recognition of the imaging patterns seen with common viral illnesses like respiratory syncytial virus (RSV) and HMPV might facilitate diagnosis and limit unnecessary antibiotic treatment. (orig.)

  1. Chest radiographic features of human metapneumovirus infection in pediatric patients

    International Nuclear Information System (INIS)

    Hilmes, Melissa A.; Daniel Dunnavant, F.; Singh, Sudha P.; Ellis, Wendy D.; Payne, Daniel C.; Zhu, Yuwei; Griffin, Marie R.; Edwards, Kathryn M.; Williams, John V.

    2017-01-01

    Human metapneumovirus (HMPV) was identified in 2001 and is a common cause of acute respiratory illness in young children. The radiologic characteristics of laboratory-confirmed HMPV acute respiratory illness in young children have not been systematically assessed. We systematically evaluated the radiographic characteristics of acute respiratory illness associated with HMPV in a prospective cohort of pediatric patients. We included chest radiographs from children <5 years old with acute respiratory illness who were enrolled in the prospective New Vaccine Surveillance Network (NVSN) study from 2003 to 2009 and were diagnosed with HMPV by reverse transcription-polymerase chain reaction (RT-PCR). Of 215 HMPV-positive subjects enrolled at our tertiary care children's hospital, 68 had chest radiographs obtained by the treating clinician that were available for review. Two fellowship-trained pediatric radiologists, independently and then in consensus, retrospectively evaluated these chest radiographs for their radiographic features. Parahilar opacities were the most commonly observed abnormality, occurring in 87% of children with HMPV. Hyperinflation also occurred frequently (69%). Atelectasis (40%) and consolidation (18%) appeared less frequently. Pleural effusion and pneumothorax were not seen on any radiographs. The clinical presentations of HMPV include bronchiolitis, croup and pneumonia. Dominant chest radiographic abnormalities include parahilar opacities and hyperinflation, with occasional consolidation. Recognition of the imaging patterns seen with common viral illnesses like respiratory syncytial virus (RSV) and HMPV might facilitate diagnosis and limit unnecessary antibiotic treatment. (orig.)

  2. Postoperative radiographs after maxillofacial trauma: sense or nonsense?

    NARCIS (Netherlands)

    van den Bergh, B.; Goey, Y.; Forouzanfar, T.

    2011-01-01

    The purpose of the present study was to investigate the necessity of routine postoperative radiographic analysis in patients with maxillofacial trauma. Between January 2000 and January 2010, 579 patients were treated surgically for 646 maxillofacial fractures including complex maxillofacial trauma.

  3. Postoperative radiographs after maxillofacial trauma: Sense or nonsense?

    NARCIS (Netherlands)

    van den Bergh, B.; Goey, Y.; Forouzanfar, T.

    2011-01-01

    The purpose of the present study was to investigate the necessity of routine postoperative radiographic analysis in patients with maxillofacial trauma. Between January 2000 and January 2010, 579 patients were treated surgically for 646 maxillofacial fractures including complex maxillofacial trauma.

  4. Correlation between static radiographic measurements and intersegmental angular measurements during gait using a multisegment foot model.

    Science.gov (United States)

    Lee, Dong Yeon; Seo, Sang Gyo; Kim, Eo Jin; Kim, Sung Ju; Lee, Kyoung Min; Farber, Daniel C; Chung, Chin Youb; Choi, In Ho

    2015-01-01

    Radiographic examination is a widely used evaluation method in the orthopedic clinic. However, conventional radiography alone does not reflect the dynamic changes between foot and ankle segments during gait. Multiple 3-dimensional multisegment foot models (3D MFMs) have been introduced to evaluate intersegmental motion of the foot. In this study, we evaluated the correlation between static radiographic indices and intersegmental foot motion indices. One hundred twenty-five females were tested. Static radiographs of full-leg and anteroposterior (AP) and lateral foot views were performed. For hindfoot evaluation, we measured the AP tibiotalar angle (TiTA), talar tilt (TT), calcaneal pitch, lateral tibiocalcaneal angle, and lateral talcocalcaneal angle. For the midfoot segment, naviculocuboid overlap and talonavicular coverage angle were calculated. AP and lateral talo-first metatarsal angles and metatarsal stacking angle (MSA) were measured to assess the forefoot. Hallux valgus angle (HVA) and hallux interphalangeal angle were measured. In gait analysis by 3D MFM, intersegmental angle (ISA) measurements of each segment (hallux, forefoot, hindfoot, arch) were recorded. ISAs at midstance phase were most highly correlated with radiography. Significant correlations were observed between ISA measurements using MFM and static radiographic measurements in the same segment. In the hindfoot, coronal plane ISA was correlated with AP TiTA (P foot motion indices at midstance phase during gait measured by 3D MFM gait analysis were correlated with the conventional radiographic indices. The observed correlation between MFM measurements at midstance phase during gait and static radiographic measurements supports the fundamental basis for the use of MFM in analysis of dynamic motion of foot segment during gait. © The Author(s) 2014.

  5. Chest radiographic findings of leptospirosis

    International Nuclear Information System (INIS)

    Kim, Mee Hyun; Jung, Hee Tae; Lee, Young Joong; Yoon, Jong Sup

    1986-01-01

    1. A study on chest radiographic findings of 54 cases with pneumonia like symptoms was performed. Of 54 cases, 8 cases were confirmed to be leptospirosis and 7 cases were leptospirosis combined with Korean hemorrhagic fever. 2. Of 8 cases of leptospirosis, 4 cases showed abnormal chest radiographic findings: acinar nodular type 2, massive confluent consolidation type 2. Of 7 cases of leptospirosis combined with Korean hemorrhagic fever: acinar nodular type 3, massive confluent consolidation type 1, and increased interstitial markings type 1 respectively. 3. It was considered to be difficult to diagnose the leptospirosis on chest radiographic findings alone, especially the case combined with Korean hemorrhagic fever.

  6. Autosomal recessive spastic tetraplegia caused by AP4M1 and AP4B1 gene mutation: expansion of the facial and neuroimaging features.

    Science.gov (United States)

    Tüysüz, Beyhan; Bilguvar, Kaya; Koçer, Naci; Yalçınkaya, Cengiz; Çağlayan, Okay; Gül, Ece; Sahin, Sezgin; Çomu, Sinan; Günel, Murat

    2014-07-01

    Adaptor protein complex-4 (AP4) is a component of intracellular transportation of proteins, which is thought to have a unique role in neurons. Recently, mutations affecting all four subunits of AP4 (AP4M1, AP4E1, AP4S1, and AP4B1) have been found to cause similar autosomal recessive phenotype consisting of tetraplegic cerebral palsy and intellectual disability. The aim of this study was analyzing AP4 genes in three new families with this phenotype, and discussing their clinical findings with an emphasis on neuroimaging and facial features. Using homozygosity mapping followed by whole-exome sequencing, we identified two novel homozygous mutations in AP4M1 and a homozygous deletion in AP4B1 in three pairs of siblings. Spastic tetraplegia, microcephaly, severe intellectual disability, limited speech, and stereotypic laughter were common findings in our patients. All patients also had similar facial features consisting of coarse and hypotonic face, bitemporal narrowing, bulbous nose with broad nasal ridge, and short philtrum which were not described in patients with AP4M1 and AP4B1 mutations previously. The patients presented here and previously with AP4M1, AP4B1, and AP4E1 mutations shared brain abnormalities including asymmetrical ventriculomegaly, thin splenium of the corpus callosum, and reduced white matter volume. The patients also had hippocampal globoid formation and thin hippocampus. In conclusion, disorders due to mutations in AP4 complex have similar neurological, facial, and cranial imaging findings. Thus, these four genes encoding AP4 subunits should be screened in patients with autosomal recessive spastic tetraplegic cerebral palsy, severe intellectual disability, and stereotypic laughter, especially with the described facial and cranial MRI features. © 2014 Wiley Periodicals, Inc.

  7. AP Human Geography and Success on the AP Test

    Science.gov (United States)

    Roncone, John; Newhalfen, Nate

    2013-01-01

    Classroom projects that explore culture and globalization enhance the curriculum and help students see how geography directly connects to their lives. These authors contend that a project-based approach can supplement the teaching of an AP Human Geography course, and visualize this course as an essential tool for students to truly understand how…

  8. The course of the radial nerve in the distal humerus: A novel, anatomy based, radiographic assessment.

    Directory of Open Access Journals (Sweden)

    H P Theeuwes

    Full Text Available Measurements were done on both arms of ten specially embalmed specimens. Arms were dissected and radiopaque wires attached to the radial nerve in the distal part of the upper arm. Digital radiographs were obtained to determine the course of the radial nerve in the distal 20 cm of the humerus in relation to bony landmarks; medial epicondyle and capitellum-trochlea projection (CCT. Analysis was done with ImageJ and Microsoft Excel software. We also compared humeral nail specifications from different companies with the course of the radial nerve to predict possible radial nerve damage.The distance from the medial epicondyle to point where the radial nerve bends from posterior to lateral was 142 mm on AP radiographs and 152 mm measured on the lateral radiographs. The average distance from the medial epicondyle to point where the radial nerve bends from lateral to anterior on AP radiographs was 66 mm. On the lateral radiographs where the nerve moves away from the anterior cortex 83 mm to the center of capitellum and trochlea (CCT. The distance from the bifurcation of the radial nerve into the posterior interosseous nerve (PIN and superficial radial nerve was 21 mm on AP radiographs and 42 mm on the lateral radiographs (CCT.The course of the radial nerve in the distal part of the upper arm has great variety. Lateral fixation is relatively safe in a zone between the center of capitellum-trochlea and 48 mm proximal to this point. The danger zone in lateral fixation is in-between 48-122 mm proximal from CCT. In anteroposterior direction; distal fixation is dangerous between 21-101 mm measured from the medial epicondyle. The more distal, the more medial the nerve courses making it more valuable to iatrogenic damage. The IMN we compared with our data all show potential risk in case of (blind distal locking, especially from lateral to medial direction.

  9. The radiographic image: A cultural artefact?

    International Nuclear Information System (INIS)

    Strudwick, Ruth M.

    2014-01-01

    This article looks at the role of the radiographic images produced by diagnostic radiographers. An ethnographic study of the workplace culture in one diagnostic imaging department was undertaken using participant observation for four months and semi-structured interviews with ten key informants. One of the key themes; that of the radiographic image as a cultural artefact, is explored in this article. The radiographic image is a cultural artefact which radiographers are protective of and take ownership of. Radiographers are conscious of the quality of their images and the images are an important aspect of their work. Radiographers take criticism of their images personally. The radiographic image is a record of the interaction that occurs between the radiographer and the patient. The way in which radiographic images are viewed, used and judged is an important aspect of the role of diagnostic radiographer

  10. Scanning radiographic apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Albert, R.D.

    1980-04-01

    Visual display of dental, medical or other radiographic images is realized with an x-ray tube in which an electron beam is scanned through an x-y raster pattern on a broad anode plate, the scanning being synchronized with the x-y sweep signals of a cathode ray tube display and the intensity signal for the display being derived from a small x-ray detector which receives x-rays that have passed through the subject to be imaged. Positioning and support of the detector are provided for by disposing the detector in a probe which may be attached to the x-ray tube at any of a plurality of different locations and by providing a plurality of such probes of different configuration in order to change focal length, to accommodate to different detector placements relative to the subject, to enhance patient comfort and to enable production of both periapical images and wider angle pantomographic images. High image definition with reduced radiation dosage is provided for by a lead glass collimator situated between the x-ray tube and subject and having a large number of spaced-apart minute radiation transmissive passages convergent on the position of the detector. Releasable mounting means enable changes of collimator in conjunction with changes of the probe to change focal length. A control circuit modifies the x-y sweep signals applied to the x-ray tube and modulates electron beam energy and current in order to correct for image distortions and other undesirable effects which can otherwise be present in a scanning x-ray system.

  11. Radiographic evaluation of AIDS patients

    Energy Technology Data Exchange (ETDEWEB)

    Le Blang, S.D.; Witheman, M.L.; Donovan Post, M.J.; Casillas, J.V. [Miami Univ., FL (United States). Dept. of Radiology

    1995-09-01

    Morphological imaging, based on the use of various techniques including ultrasound, X-ray computed tomography (CT), and magnetic resonance imaging (MRI), plays an important role in the characterization, diagnosis and follow-up of patients with Human Immunodeficiency Virus (HIV) infection and Acquired Immunodeficiency Syndrome (AIDS). While the presence of thoracic infections, the most frequently observed illnesses in AIDS patients, can best be performed by using conventional chest films and CT, the assessment of cerebral involvement in AIDS patients - characterized by the presence of focal masses, demyelination, meningitis, and infarction - is best achieved using MRI. The work-up of patients with gastrointestinal symptoms should include the use of ultrasound for the evaluation of visceral involvement and lymphadenopathy, completed by CT to further characterize pathologic conditions in either the bowel or visceral organs. Ultrasound is the screening exam of choice in AIDS patients with suspected renal disease, but other methods may be necessary for the assessment of the complications due to pharmacological treatment. Musculoskeletal complications may require the combined use of all the above methods, since they may be caused by infections, tumors and rheumatologic illness. The use of the radiographic methods for the detection of the numerous forms of infections and malignancies in AIDS patients is described in detail for the various body districts.

  12. Radiographic evaluation of AIDS patients

    International Nuclear Information System (INIS)

    Le Blang, S.D.; Witheman, M.L.; Donovan Post, M.J.; Casillas, J.V.

    1995-01-01

    Morphological imaging, based on the use of various techniques including ultrasound, X-ray computed tomography (CT), and magnetic resonance imaging (MRI), plays an important role in the characterization, diagnosis and follow-up of patients with Human Immunodeficiency Virus (HIV) infection and Acquired Immunodeficiency Syndrome (AIDS). While the presence of thoracic infections, the most frequently observed illnesses in AIDS patients, can best be performed by using conventional chest films and CT, the assessment of cerebral involvement in AIDS patients - characterized by the presence of focal masses, demyelination, meningitis, and infarction - is best achieved using MRI. The work-up of patients with gastrointestinal symptoms should include the use of ultrasound for the evaluation of visceral involvement and lymphadenopathy, completed by CT to further characterize pathologic conditions in either the bowel or visceral organs. Ultrasound is the screening exam of choice in AIDS patients with suspected renal disease, but other methods may be necessary for the assessment of the complications due to pharmacological treatment. Musculoskeletal complications may require the combined use of all the above methods, since they may be caused by infections, tumors and rheumatologic illness. The use of the radiographic methods for the detection of the numerous forms of infections and malignancies in AIDS patients is described in detail for the various body districts

  13. APS Wheatley Prize Talk

    Science.gov (United States)

    Glyde, Henry R.

    2001-03-01

    It is a pleasure to describe our collaborative program in International Development [1] between the University of Ottawa, Canada and Chulalongkorn University, Bangkok, Thailand. The goal of our linked program was broadly to develop physics and graduate education at Chulalongkorn with an emphasis on semiconductor materials and theoretical science. The aim of my description is to illustrate how links that combine several important components of development sustained over many years can greatly assist research institutions in developing countries. The link was initially funded between 1979-85 by the Canadian International Development Agency. The link included (1) Ph.D. education for junior Thai faculty at Ottawa, (2) secondment of faculty between Chulalongkorn and Ottawa, (3) equipment and technical assistance and (4) institution building at Chulalongkorn. With assistance of the link and other agencies the first Ph.D. program in physics in Thailand was initiated, the Semiconductor Physics Research Lab was created and the Forum for Theoretical Science was established. The FTS was also greatly assisted by ICTP. Later, activity involved the university of Delaware and the FTS obtained major funding for superconductivity research in Thailand from the USAID between 1987-91. The successes, disappointments, benefits and costs of these programs, which exist today, will be discussed. [1]Institutional Links. An example in science and technology, Henry R. Glyde and Virulh Sa-yakanit, Higher Education in Europe, X4, 51 (1985); Asia-Pacific Physics News 2, 29 (1987).

  14. Method for taking X radiographs

    International Nuclear Information System (INIS)

    Orth, G.

    1983-01-01

    The method is aimed at obtaining X radiographs of any human organ with the aid of an X-ray-shadowless radiation detector of a dose measuring device, which is arranged between patient and imaging system, and of a controlling microprocessor system, so that the image-forming parameters are automatically adjusted to the specific properties of the patient. This procedure minimices the efforts in preparing the radiograph and the radiation exposure of the patient

  15. Radiographic differentiation of atypical tuberculosis from mycobacterium tuberculosis

    International Nuclear Information System (INIS)

    Tarver, R.D.; Pearcy, E.A.; Conces, D.J. Jr.; Mathur, P.N.

    1987-01-01

    The chest radiographs of 95 patients with the new diagnosis of atypical turberculosis were reviewed to determine if any significant differences between atypical tuberculosis and that caused by Mycobacterium tuberculosis could be discerned. Findings included upper lobe involvement in B4 of the 95 patients and cavities in 76, with nearly equal groups having no, moderate, or extensive surrounding alveolar disease. Nodules were common; in six patients a nodule was the sole manifestation of disease. Adenopathy was seen in 12 of the 95 patients, atlectasis in 45, pleural thickening in 90, and effusions in three. These radiographic findings did not allow the radiographic differentiation of atypical tuberculosis from Mycobacterium tuberculosis infection

  16. Skeletal changes mimicking intrathoracic disease on chest radiographs

    International Nuclear Information System (INIS)

    Gelderen, WFC van

    2009-01-01

    Full text: Various chest radiographs are illustrated to demonstrate features where bony changes may mimic intrathoracic disease. To confirm the skeletal origin and nature, further conventional radiographs often suffice, and the need for CT or scintigraphy may therefore be obviated. At the time of presentation for radiography of the chest, further pertinent clinical details can be obtained from the patient by the department staff, as required. All previous radiographs and radiological reports should be readily available. In order to add to the educational value of the 13 cases illustrated, all are presented in quiz format, with the answers and further images included in the text.

  17. Comparison of radiographic and radionuclide skeletal surveys in battered children

    Energy Technology Data Exchange (ETDEWEB)

    Pickett, W.J.; Faleski, E.J.; Chacko, A.; Jarrett, R.V.

    1983-02-01

    A review of 13 cases of suspected child abuse in which radionuclide (RN) scans, radiographic skeletal surveys, and sufficient follow-up were available showed that the RN scans were insensitive, even though fractures were more than 48 hours old at the time of the scan. Frequently missed lesions included skull and extremity fractures. Furthermore, soft tissue and visceral abnormalities that were identified on radiographic examination went undetected on RN scan. We conclude that, although the RN scan may augment the radiographic examination, it should not be used alone to screen for the battered child.

  18. Comparison of radiographic and radionuclide skeletal surveys in battered children

    International Nuclear Information System (INIS)

    Pickett, W.J.; Faleski, E.J.; Chacko, A.; Jarrett, R.V.

    1983-01-01

    A review of 13 cases of suspected child abuse in which radionuclide (RN) scans, radiographic skeletal surveys, and sufficient follow-up were available showed that the RN scans were insensitive, even though fractures were more than 48 hours old at the time of the scan. Frequently missed lesions included skull and extremity fractures. Furthermore, soft tissue and visceral abnormalities that were identified on radiographic examination went undetected on RN scan. We conclude that, although the RN scan may augment the radiographic examination, it should not be used alone to screen for the battered child

  19. Standard reference radiographs for steel fusion welds

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2011-01-01

    1.1 This standard provides reference radiographs for steel fusion welds that contain typical discontinuities with varying severity levels in different thicknesses of material. The reference radiograph films are an adjunct to this standard and must be purchased separately from ASTM International if needed. 1.2 There are three volumes of reference radiographs based on seven nominal weld thicknesses as follows: Vol ISet of 16 plates (81/2 by 11 in.) covering base material up to and including ¼ in. (6.4 mm) in thickness. Vol IISet of 29 plates (8½ by 11 in.) covering base material over ¼ to and including 3 in. (6.4 to 76 mm) in thickness. Vol IIISet of 32 plates (8 ½ by 11 in.) covering base material over 3 to including 8 in. (76 to 203 mm) in thickness. 1.3 The values stated in inch-pound units are to be regarded as the standard. The values given in parentheses are mathematical conversions to SI units that are provided for information only and are not considered standard. 1.4 This standard does not purport t...

  20. Radiographic and tomographic study of the elbow joint in dogs

    International Nuclear Information System (INIS)

    Sendyk-Grunkraut, Alessandra; Martin, Claudia M.; Souza, Alexandre N.A.; Patricio, Geni Cristina F.; Lorigados, Carla A.B.; Matera, Julia M.; Fonseca-Pinto, Ana C.B.C.

    2017-01-01

    Elbow dysplasia disease includes an united anconeal process, fragmented medial coronoid process, osteochondrosis of humeral trochlea, articular incongruity and degenerative joint disease. The aim of this study was to present detailed morphologic and morphometric aspects of the elbow joint in dog in clinical and correlate with radiographic and tomographic (CT) exam. Inter-observer variation for articular incongruity measurements by CT, comparative analysis in the radiographic exam, angle in ulnar notch and its comparative analysis between radiographic and tomographic agreement examination in 44 elbow of dogs with different ages were evaluated. The statistics analyses included the kappa coefficient and interclass correlation and Fischer's test and McNemar's test. It was evidenced that individual performance of each radiographic incidence had poor agreement with the tomographic exam, suggesting that the accomplishment of more than two radiograph views are needed. There was no agreement between the three evaluators in the ulnar notch angle at radiographic and tomographic exams. However, there was good/moderate agreement for articular incongruity measurement in the sagittal plane between evaluators. It was possible to conclude that none of the five radiographic incidences was better than the others for radiographic analysis because each incidence had a better identification of a particular elbow compartment; measurements at the tomographic exam to evaluate radioulnar incongruity had no reproductiveness in the frontal plane, but in sagittal plan had a good/moderate agreement between observers and the angle in ulnar notch presented no repeatability at radiographic exam and no reproductiveness at tomographic exam. (author)

  1. Tibial bowing in children - what is normal? A radiographic study

    International Nuclear Information System (INIS)

    Zbinden, Isabella; Rutz, Erich; Jacobson, Jon A.; Magerkurth, Olaf

    2015-01-01

    To define osseous landmarks on tibia radiographs in order to establish age-related normal values characterizing physiological tibial bowing in children. Five hundred and twenty-six patients aged 0-17 years with normal radiographs of the lower legs were identified and retrospectively reviewed by two blinded radiologists. In anteroposterior (ap)/lateral (lat)-views, 3 lines defined tibial length and angulation. Line-A connecting proximal to distal corner of tibial metaphysic, lines B and C corresponding to corners of tibial metaphysis. Angle A/B defines proximal, A/C distal tibial-angulation. Tibial curvature is defined by distance of line-D parallel to A and tangential to tibial cortex. Normal values were calculated with linear-regression. Intra-/Interreader agreement were tested with a Bland-Altman-plot. Intrareader-agreement: Reader 1 showed a bias of -0.1, standard-deviation of bias was 1.9 and 95 %-limits-of-agreement -3.9- 3.7. Reader 2: -0.01, 2.4 and -4.7- 4.7. Interreader: 0.2, 1.6 and -2.9- 3.3. Angle-A/B ap was 80-100 , increasing with age (86.5-88); angle-AC ap was 82-107 (96.8-90.5), angle-AB lat was 81-107 (93.0-98.0); angle-AC lat was 76-102 (89.5-86.5); depth of curve ap was 0-11 % (8-3.5) and lat 2-13 %, (8.5-3.5). Age dependent tibial bowing can be assessed with this new measurement system and age-related normal-values characterizing physiological tibial bowing in children is established. (orig.)

  2. Quantitative localization of impacted mesiodens using panoramic and periapical radiographs.

    Science.gov (United States)

    Choi, Hang-Moon; Han, Jin-Woo; Park, In-Woo; Baik, Jee-Seon; Seo, Hyun-Woo; Lee, Joo-Hyun; Park, Ho-Won

    2011-06-01

    The purpose of this study was to evaluate a new technique for localizing impacted mesiodens using its horizontal magnification ratio on panoramic radiographs. Location-magnification equation of a panoramic equipment was obtained from horizontal magnification ratio of a metal ball which was located variable positions from the center of image layer at interval of 2 mm. Panoramic radiographs were obtained from a skull phantom with a metal ball which was a substitute for impacted mesiodens and was embedded 10mm(Group 1), 15mm(Group 2), and 20mm(Group 3) posterior to the central incisor. Each group obtained 7 panoramic radiographs at variable positions and one periapical radiograph. Three methods were used to estimate the actual width of the incisors and the balls which were used to calculate the magnification ratio. The methods included using the actual incisor width and the calculated ball width (Method 1), using the actual incisor width and the ball widths measured on periapical radiograph (Method 2), and using the incisor and the ball widths measured on periapical radiograph (Method 3). The location of the metal ball was calculated by using the location-magnification equation. The smallest difference between the calculated and the actual distance was 0.1±0.7 mm in Group 1/Method 3. The largest difference was -4.2±1.6 mm in Group 3/Method 2. In all groups, method 3 was the most accurate. Quantitative localization of impacted mesiodens is possible by using panoramic radiograph.

  3. Quantitative localization of impacted mesiodens using panoramic and periapical radiographs

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hang Moon; Han, Jin Woo; Park, In Woo; Baik, Jee Seon; Seo, Hyun Woo; Lee, Joo Hyun; Park, Ho Won [College of Dentistry, Gangneung-Wonju National University, Gangneung (Korea, Republic of)

    2011-06-15

    The purpose of this study was to evaluate a new technique for localizing impacted mesiodens using its horizontal magnification ratio on panoramic radiographs. Location-magnification equation of a panoramic equipment was obtained from horizontal magnification ratio of a metal ball which was located variable positions from the center of image layer at interval of 2 mm. Panoramic radiographs were obtained from a skull phantom with a metal ball which was a substitute for impacted mesiodens and was embedded 10 mm (Group 1), 15 mm (Group 2), and 20 mm (Group 3) posterior to the central incisor. Each group obtained 7 panoramic radiographs at variable positions and one periapical radiograph. Three methods were used to estimate the actual width of the incisors and the balls which were used to calculate the magnification ratio. The methods included using the actual incisor width and the calculated ball width (Method 1), using the actual incisor width and the ball widths measured on periapical radiograph (Method 2), and using the incisor and the ball widths measured on periapical radiograph (Method 3). The location of the metal ball was calculated by using the location-magnification equation. The smallest difference between the calculated and the actual distance was 0.1{+-}0.7 mm in Group 1/Method 3. The largest difference was -4.2{+-}1.6 mm in Group 3/Method 2. In all groups, method 3 was the most accurate. Quantitative localization of impacted mesiodens is possible by using panoramic radiograph.

  4. Image quality preferences among radiographers and radiologists. A conjoint analysis

    International Nuclear Information System (INIS)

    Ween, Borgny; Kristoffersen, Doris Tove; Hamilton, Glenys A.; Olsen, Dag Rune

    2005-01-01

    Purpose: The aim of this study was to investigate the image quality preferences among radiographers and radiologists. The radiographers' preferences are mainly related to technical parameters, whereas radiologists assess image quality based on diagnostic value. Methods: A conjoint analysis was undertaken to survey image quality preferences; the study included 37 respondents: 19 radiographers and 18 radiologists. Digital urograms were post-processed into 8 images with different properties of image quality for 3 different patients. The respondents were asked to rank the images according to their personally perceived subjective image quality. Results: Nearly half of the radiographers and radiologists were consistent in their ranking of the image characterised as 'very best image quality'. The analysis showed, moreover, that chosen filtration level and image intensity were responsible for 72% and 28% of the preferences, respectively. The corresponding figures for each of the two professions were 76% and 24% for the radiographers, and 68% and 32% for the radiologists. In addition, there were larger variations in image preferences among the radiologists, as compared to the radiographers. Conclusions: Radiographers revealed a more consistent preference than the radiologists with respect to image quality. There is a potential for image quality improvement by developing sets of image property criteria

  5. Relationship between stress ankle radiographs and injured ligaments on MRI

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyoung Min; Chung, Chin Youb; Chung, Myung Ki; Won, Sung Hun; Lee, Seung Yeol; Park, Moon Seok [Seoul National University Bundang Hospital, Department of Orthopaedic Surgery, Kyungki (Korea, Republic of); Kwon, Soon-Sun [Seoul National University Bundang Hospital, Biomedical Research Institute, Kyungki (Korea, Republic of)

    2013-11-15

    This study was performed to investigate the relationship between the injured lateral ankle ligaments on MRI and stress ankle radiographs. Two hundred and twenty-nine consecutive patients (mean age 35.5 years, SD 14.6 years; 136 males and 93 females) that underwent ankle stress radiographs and MRI for lateral ankle instability were included. Tibiotalar tilt angle and anterior translation of talus were measured on stress ankle radiographs. Degree of lateral ligaments (anterior talofibular, calcaneofibular, and posterior talofibular) and deltoid ligament injuries were evaluated and scored as intact (0), partial injury (1), and complete injury (2) on MR images. Effusion of ankle joint was also recorded. The effects of gender, age, injuries of ligaments, and ankle joint effusion on stress radiographs were statistically analyzed. Gender (p = 0.010), age (p = 0.020), and anterior talofibular ligament (ATFL) injury (p < 0.001) were the factors significantly affecting tibiotalar tilt angle. Posterior talofibular ligament (PTFL) injury (p = 0.014) was found to be the only significant factor affecting the anterior translation on the anterior drawer radiographs. ATFL injury and PTFL injury on MRI significantly affected tibiotalar tilt angle and anterior drawer on stress radiographs. Other factors, such as age and gender, need to be considered in evaluating radiographic lateral ankle instability. (orig.)

  6. The reliability of tablet computers in depicting maxillofacial radiographic landmarks

    Energy Technology Data Exchange (ETDEWEB)

    Tadinada, Aditya; Mahdian, Mina; Sheth, Sonam; Chandhoke, Taranpreet K.; Gopalakrishna, Aadarsh; Potluri, Anitha; Yadav, Sumit [University of Connecticut School of Dental Medicine, Farmington (United States)

    2015-09-15

    This study was performed to evaluate the reliability of the identification of anatomical landmarks in panoramic and lateral cephalometric radiographs on a standard medical grade picture archiving communication system (PACS) monitor and a tablet computer (iPad 5). A total of 1000 radiographs, including 500 panoramic and 500 lateral cephalometric radiographs, were retrieved from the de-identified dataset of the archive of the Section of Oral and Maxillofacial Radiology of the University Of Connecticut School Of Dental Medicine. Major radiographic anatomical landmarks were independently reviewed by two examiners on both displays. The examiners initially reviewed ten panoramic and ten lateral cephalometric radiographs using each imaging system, in order to verify interoperator agreement in landmark identification. The images were scored on a four-point scale reflecting the diagnostic image quality and exposure level of the images. Statistical analysis showed no significant difference between the two displays regarding the visibility and clarity of the landmarks in either the panoramic or cephalometric radiographs. Tablet computers can reliably show anatomical landmarks in panoramic and lateral cephalometric radiographs.

  7. Relationships between rotator cuff tear types and radiographic abnormalities

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Soo Hyun; Chun, Kyung Ah; Lee Soo Jung; Kang, Min Ho; Yi, Kyung Sik; Zhang, Ying [Dept. of Diagnostic Radiology, College of Medicine, Chungbuk National University, Cheongju (Korea, Republic of)

    2014-11-15

    To determine relationships between different types of rotator cuff tears and radiographic abnormalities. The shoulder radiographs of 104 patients with an arthroscopically proven rotator cuff tear were compared with similar radiographs of 54 age-matched controls with intact cuffs. Two radiologists independently interpreted all radiographs for; cortical thickening with subcortical sclerosis, subcortical cysts, osteophytes in the humeral greater tuberosity, humeral migration, degenerations of the acromioclavicular and glenohumeral joints, and subacromial spurs. Statistical analysis was performed to determine relationships between each type of rotator cuff tears and radiographic abnormalities. Inter-observer agreements with respect to radiographic findings were analyzed. Humeral migration and degenerative change of the greater tuberosity, including sclerosis, subcortical cysts, and osteophytes, were more associated with full-thickness tears (p < 0.01). Subacromial spurs were more common for full-thickness and bursal-sided tears (p < 0.01). No association was found between degeneration of the acromioclavicular or glenohumeral joint and the presence of a cuff tear. Different types of rotator cuff tears are associated with different radiographic abnormalities.

  8. Magnification of digital hip radiographs differs between clinical workplaces.

    Directory of Open Access Journals (Sweden)

    Jana Hornová

    Full Text Available Preoperative planning for total hip arthroplasty includes templating on anteroposterior radiographs. It is necessary to consider radiographic magnification in order to scale templates accurately. Studies dealing with hip templating report different values of radiographic magnification. It is not clear if the observed difference in magnification between the studies is caused by variability in studied groups, methodology or instrumentation. We hypothesize that there is a difference in magnification between clinical workplaces. Within this study, radiographic magnification was estimated on 337 radiographs of patients after total hip surgery from five orthopaedic departments in the Czech Republic. Magnification was determined for each patient as a ratio between diameter of implanted femoral head measured on radiogram and its true size. One-way ANOVA revealed significant differences in magnification between workplaces (F(4,332 = 132, p≤0.001. These results suggest that radiographic magnification depends on the workplace where it is taken or more precisely on radiographic device. It indicates potential limits in generalizability of results of studies dealing with preoperative planning accuracy to other institutions.

  9. Relationship between stress ankle radiographs and injured ligaments on MRI

    International Nuclear Information System (INIS)

    Lee, Kyoung Min; Chung, Chin Youb; Chung, Myung Ki; Won, Sung Hun; Lee, Seung Yeol; Park, Moon Seok; Kwon, Soon-Sun

    2013-01-01

    This study was performed to investigate the relationship between the injured lateral ankle ligaments on MRI and stress ankle radiographs. Two hundred and twenty-nine consecutive patients (mean age 35.5 years, SD 14.6 years; 136 males and 93 females) that underwent ankle stress radiographs and MRI for lateral ankle instability were included. Tibiotalar tilt angle and anterior translation of talus were measured on stress ankle radiographs. Degree of lateral ligaments (anterior talofibular, calcaneofibular, and posterior talofibular) and deltoid ligament injuries were evaluated and scored as intact (0), partial injury (1), and complete injury (2) on MR images. Effusion of ankle joint was also recorded. The effects of gender, age, injuries of ligaments, and ankle joint effusion on stress radiographs were statistically analyzed. Gender (p = 0.010), age (p = 0.020), and anterior talofibular ligament (ATFL) injury (p < 0.001) were the factors significantly affecting tibiotalar tilt angle. Posterior talofibular ligament (PTFL) injury (p = 0.014) was found to be the only significant factor affecting the anterior translation on the anterior drawer radiographs. ATFL injury and PTFL injury on MRI significantly affected tibiotalar tilt angle and anterior drawer on stress radiographs. Other factors, such as age and gender, need to be considered in evaluating radiographic lateral ankle instability. (orig.)

  10. Overview of the advanced photon source (APS)

    International Nuclear Information System (INIS)

    White, M.M.

    1994-01-01

    The Advanced Photon Source (APS) is a state-of-the-art synchrotron light source facility dedicated to the production of extremely brilliant x-ray beams for research. Its super-intense x-ray beams will be used in many areas of research including industrial research, biological and medical research, defense-related research, and basic research. The APS x-ray beams will allow scientists to study smaller samples, more complex systems, faster reactions and processes, and gather data at a greater level of detail than has been possible to date. Creation of these beams begins with electron production by an electron gun with a thermionic cathode. The electrons are accelerated to 200 MeV by a linear accelerator (linac) and then impinge on a tungsten target, resulting in electron-positron pair production. The positrons are accelerated to 450 MeV in the remainder of the linac, then accumulated, damped, and transferred to a synchrotron that increases their energy to 7 GeV. The 7-GeV positrons are injected into a storage ring, where they pass through special magnets that cause them to emit x-rays of the desired quality. Construction at ANL is nearly complete at this time, and the APS will begin operating for users in 1996. The accelerator and experimental facilities are described in this paper, and a brief overview of some of the experimental programs is given

  11. APS beamline standard components handbook

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.

    1992-01-01

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction.

  12. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    Kuzay, T.M.

    1992-01-01

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  13. AP1000R licensing and deployment in the United States

    International Nuclear Information System (INIS)

    Jordan, R. P.; Russ, P. A.; Filiak, P. P.; Castiglione, L. L.

    2012-01-01

    towards deployment. AP1000 Design Certification and COL deployment, and management of the plant construction in accordance with the conditions within these approvals, remain as significant site and corporate responsibilities. These licensing-construction integrated activities must now focus on identifying and resolving 'as-built' departures from the standardized design as assessed against the certified AP1000 technical and licensing basis. Within this paper, significant aspects of the AP1000 U.S. licensing will be discussed, including identifying systems and processes used in ensuring compliance while deploying the standardized design. Critical licensing steps, licensing deployment actions as plant construction progresses and defining the road forward to a successful completion of licensing actions will be addressed. (authors)

  14. A hot-spare injector for the APS linac

    International Nuclear Information System (INIS)

    Lewellen, J. W.

    1999-01-01

    Last year a second-generation SSRL-type thermionic cathode rf gun was installed in the Advanced Photon Source (APS) linac. This gun (referred to as ''gun2'') has been successfully commissioned and now serves as the main injector for the APS linac, essentially replacing the Koontz-type DC gun. To help ensure injector availability, particularly with the advent of top-up mode operation at the APS, a second thermionic-cathode rf gun will be installed in the APS linac to act as a hot-spare beam source. The hot-spare installation includes several unique design features, including a deep-orbit Panofsky-style alpha magnet. Details of the hot-spare beamline design and projected performance are presented, along with some plans for future performance upgrades

  15. When disaster strikes; the role of the forensic radiographer

    International Nuclear Information System (INIS)

    Walsh, Mary; Reeves, Pauline; Scott, Susan

    2004-01-01

    Forensic radiography is a vital tool utilised in the many facets of Forensic Medicine. This paper investigates the role of the forensic radiographer in a mass disaster situation; it also explores the psychological impact of this type of work on radiographers. A literature review indicated that limited work had been documented on the role of the radiographer in mass disasters. This ultimately creates doubt about whether or not the radiographer is acknowledged for the vital role he/she plays and if proper provisions were in place to assess any emotional damage in the aftermath of an emotionally and physically straining situation. A qualitative method of research was used (semi-structured interviews) in order to elicit radiographers' feelings and perceptions. This method is best suited to this research topic because it is a delicate subject. Four interviews were carried out and the responses are presented in themes including emergency versus mass grave experiences (including issues of time and preparation). Other themes include the role of the radiographer and interaction with other members of the team, as well as a discussion of the aftermath of their experiences, including the feelings of pride experienced

  16. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Cohen, M.; David, J.P.

    1999-01-01

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60 Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  17. A radiographic study of mental foramen in intraoral radiographs

    International Nuclear Information System (INIS)

    Sohn, Jeong Ick; Choi, Karp Shik

    1995-01-01

    The purpose of this study was to evaluate the position and shape of mental foramen in periapical radiographs. For this study, periapical radiographs of premolar areas were obtained from the 200 adults. Accordingly, the positional and shape changes of mental foramen were evaluated. The authors obtained radiographs according to changes in radiation beam direction in periapical radiographs of premolar areas, and then evaluated the positional and shape changes of mental foramen. The following results were obtained: 1. Shapes of mental foramen were observed elliptical (34.3%), round or oval (28.0%), unidentified (25.5%) and diffuse (12.2%) type in descending order of frequency. 2, Horizontal positions of mental foramen were most frequently observed at the 2nd premolar area (55.3%), the area between the 1st premolar and 2nd premolar (39.6%), the area between the 2nd premolar and 1st molar (3.4%), the 1st premolar area (1.0%), the area between the canine and 1st premolar (0.7%) in descending order of frequency. 3. Vertical positions of mental foramen were most frequently observed at the inferior to apex (67.1%), and at apex (24.8%), overlap with apex (6.4%), superior to apex (1.7%) in descending order of frequency. 4. Shapes of mental foramen were more obviously observed at the upward 10 degree positioned periapical radiographs. And according to the changes of horizontal and vertical position, they were observed similar to normally positioned periapical radiographs.

  18. A radiographic study of mental foramen in intraoral radiographs

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, Jeong Ick; Choi, Karp Shik [Dept. of Oral and Maxillofacial Radiology, College of Dentistry, Kyungpook National University, Daegu (Korea, Republic of)

    1995-08-15

    The purpose of this study was to evaluate the position and shape of mental foramen in periapical radiographs. For this study, periapical radiographs of premolar areas were obtained from the 200 adults. Accordingly, the positional and shape changes of mental foramen were evaluated. The authors obtained radiographs according to changes in radiation beam direction in periapical radiographs of premolar areas, and then evaluated the positional and shape changes of mental foramen. The following results were obtained: 1. Shapes of mental foramen were observed elliptical (34.3%), round or oval (28.0%), unidentified (25.5%) and diffuse (12.2%) type in descending order of frequency. 2, Horizontal positions of mental foramen were most frequently observed at the 2nd premolar area (55.3%), the area between the 1st premolar and 2nd premolar (39.6%), the area between the 2nd premolar and 1st molar (3.4%), the 1st premolar area (1.0%), the area between the canine and 1st premolar (0.7%) in descending order of frequency. 3. Vertical positions of mental foramen were most frequently observed at the inferior to apex (67.1%), and at apex (24.8%), overlap with apex (6.4%), superior to apex (1.7%) in descending order of frequency. 4. Shapes of mental foramen were more obviously observed at the upward 10 degree positioned periapical radiographs. And according to the changes of horizontal and vertical position, they were observed similar to normally positioned periapical radiographs.

  19. Application of digital techniques to the restoration of radiographic images

    International Nuclear Information System (INIS)

    Burch, S.F.

    1980-09-01

    The methods of constrained least squares and maximum entropy have been used to restore digital X and γ-ray radiographs. Both methods require the blurring of the image to be a linear, spatially invariant process. Although the blurring processes in radiography can be complex, situations have been identified where these simplifying assumptions are valid. Algorithms for deriving the point-spread function of each image are discussed. These include a pinhole method for X-ray radiographs, and reconstruction from edge profiles for γ-ray radiographs. The results from the restoration of geometrically blurred radiographs of sparking plugs are given. Maximum entropy gives results superior to those obtained by constrained least squares. The resolution is improved by a factor of about three when maximum entropy is used, and by a factor of about two for constrained least squares. (author)

  20. Radiographic findings in pulmonary hypertension from unresolved embolism

    Energy Technology Data Exchange (ETDEWEB)

    Woodruff, W.W. III; Hoeck, B.E.; Chitwood, W.R. Jr.; Lyerly, H.K.; Sabiston, D.C. Jr.; Chen, J.T.T.

    1985-04-01

    Pulmonary artery hypertension with chronic pulmonary embolism is an uncommon entity that is potentially treatable with pulmonary embolectomy. Although the classic radiographic features have been described, several recent investigators report a significant percentage of these patients with normal chest radiographs. In a series of 22 patients, no normal radiographs were seen. Findings included cardiomegaly (86.4%) with right-sided enlargement (68.4%), right descending pulmonary artery enlargement (54.5%), azygos vein enlargement (27.3%), mosaic oligemia (68.2%), chronic volume loss (27.3%), atelectasis and/or effusion (22.7%), and pleural thickening (13.6%). Good correlation with specific areas of diminished vascularity was seen on chest radiographs compared with pulmonary angiograms.

  1. Radiographic findings in pulmonary hypertension from unresolved embolism

    International Nuclear Information System (INIS)

    Woodruff, W.W. III; Hoeck, B.E.; Chitwood, W.R. Jr.; Lyerly, H.K.; Sabiston, D.C. Jr.; Chen, J.T.T.

    1985-01-01

    Pulmonary artery hypertension with chronic pulmonary embolism is an uncommon entity that is potentially treatable with pulmonary embolectomy. Although the classic radiographic features have been described, several recent investigators report a significant percentage of these patients with normal chest radiographs. In a series of 22 patients, no normal radiographs were seen. Findings included cardiomegaly (86.4%) with right-sided enlargement (68.4%), right descending pulmonary artery enlargement (54.5%), azygos vein enlargement (27.3%), mosaic oligemia (68.2%), chronic volume loss (27.3%), atelectasis and/or effusion (22.7%), and pleural thickening (13.6%). Good correlation with specific areas of diminished vascularity was seen on chest radiographs compared with pulmonary angiograms

  2. Industrial radiography on radiographic paper

    International Nuclear Information System (INIS)

    Domanus, J.C.

    1977-11-01

    An investigation was performed to compare the quality of radiographic paper with that of X-ray film, after a review had been made of the rather scarce literature on the subject. The equipment used throughout the investigation is described, and characteristic curves for Agfa-Gevaert and Kodak papers exposed with different intensifying screens in the low and intermediate voltage range are reproduced. The relative speed, contrast and exposure latitude were computed from these curves. The quality of the radiographic image was checked on U/Al blocks and plates, Al and Fe blocks, and fiber-reinforced composites. Exposure charts for Al and Fe were made for various paper and screen combinations. Both the sharpness of the radiographic image as well as the influence of processing on speed and contrast were checked. Examples are given of the practical application of the paper for radiography of castings, weldings, solderings, assemblies, etc. (author)

  3. Caries detection in dental radiographs

    International Nuclear Information System (INIS)

    Dunn, S.M.

    1987-01-01

    Caries, or the decay of teeth are difficult to automatically detect in dental radiographs because of the small area of the image that is occupied by the decay. Images of dental radiographs has distinct regions of homogeneous gray levels, and therefore naturally lead to a segmentation based automatic caries detection algorithm. This paper describes a method for caries detection based on a multiclass, area independent thresholding and segmenting scheme. This multiclass thresholding algorithm is an extension of the uniform error threshold, an area independent, distribution free thresholding method used for images of only two classes of objects. The authors first consider the problem of caries detection and the image features that characterize the presence of caries. Next, the uniform error threshold is reviewed, and the general multiclass uniform error threshold algorithm is presented. This algorithm is used to automatically detect caries in dental radiographs

  4. Digital image analysis of NDT radiographs

    International Nuclear Information System (INIS)

    Graeme, W.A. Jr.; Eizember, A.C.; Douglass, J.

    1989-01-01

    Prior to the introduction of Charge Coupled Device (CCD) detectors the majority of image analysis performed on NDT radiographic images was done visually in the analog domain. While some film digitization was being performed, the process was often unable to capture all the usable information on the radiograph or was too time consuming. CCD technology now provides a method to digitize radiographic film images without losing the useful information captured in the original radiograph in a timely process. Incorporating that technology into a complete digital radiographic workstation allows analog radiographic information to be processed, providing additional information to the radiographer. Once in the digital domain, that data can be stored, and fused with radioscopic and other forms of digital data. The result is more productive analysis and management of radiographic inspection data. The principal function of the NDT Scan IV digital radiography system is the digitization, enhancement and storage of radiographic images

  5. PACS influence the radiographer's work

    International Nuclear Information System (INIS)

    Fridell, Kent; Aspelin, Peter; Edgren, Lars; Lindskoeld, Lars; Lundberg, Nina

    2009-01-01

    Radiological departments are changing rapidly due to the implementation of digital images and PACS (Picture Archiving and Communication Systems). The introduction of new technology seems to dissolve boundaries between the professions in the work environment where the technology is introduced. This process tends to change the organization and its routines. The aim of this qualitative study is to explore changes in radiographers' work with regard to skills, work practice and technology. The study used open-ended interviews to explore the radiographers' perceptions of such changes, and to identify problems and solutions pertaining to work practice. Inspiration is taken from grounded theory to explain the changes in work that were found. Respondents were selected from a total of 133 potential participants as a theoretical or purposive sample. The changing trends within the professional role indicated that radiographers, as image producers, shifted their focus from the ability to set the optimal exposure parameters in order to obtain the optimal image for diagnosis to become expert in exposure parameters, projection techniques and diagnostic practice, having multifaceted skills, as being the jack of all trades. When implementing PACS there was an obvious change in image production. At the start there were visions of new routines, and therefore the radiographers became early adopters to the new technology; in practice the organization was stacked in old routines, as the routines were inflexible and PACS work was pushed into old work routines. Although inflexible, this does not mean that they cannot change, and obviously in 2006 new routines had been implemented making it possible for the radiographers in finding new ways for collaborating with colleagues. The new technology immediately created a vision of improved service to the clinicians. In order to optimize the service the radiographers developed an insight into the need for a more comprehensive change in work using

  6. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  7. Correlation between radiographic parameters and functional scores in degenerative lumbar and thoracolumbar scoliosis.

    Science.gov (United States)

    Simon, J; Longis, P-M; Passuti, N

    2017-04-01

    Adult scoliosis is a condition in which the spinal deformity occurs because of degeneration. Although various studies have agreed on the importance of restoring the sagittal balance, few have evaluated the relationship between functional scores and radiological parameters. The primary objective of this retrospective study was to demonstrate the correlation between radiographic parameters and functional outcomes in adult patients with lumbar or thoracolumbar degenerative scoliosis. The secondary objective was to assess the long-term effects of posterolateral fusion for treating this deformity. This single-centre retrospective study included 47 patients over 50years of age who had degenerative lumbar scoliosis treated with an instrumented posterolateral fusion; the mean follow-up was 6.4years (range 2 to 20). Radiographic analysis of A/P and lateral full spine standing radiographs was carried out with the KEOPS software. Three pelvic parameters (pelvic tilt, pelvic incidence, sacral slope), two spinal parameters (lumbar lordosis and thoracic kyphosis) and three sagittal balance parameters (C7 sagittal tilt, C7 Barrey's ratio and spinosacral angle) were calculated. The functional outcomes were evaluated through three self-assessment questionnaires: Oswestry Disability Index, SRS-30 and SF-36. The correlation between clinical and radiographic parameters was calculated with Spearman's correlation test. There was a significant correlation between the SF-36 (PCS) and the following three sagittal parameters: sacral slope (r=-0.31453; P=0.04), lumbar lordosis (r=-0.30198; P=0.0491) and spinosacral angle (r=-0.311967; P=0.0366). The mean ODI score was 33.61, which corresponds to minimal to moderate disability. The mean physical (PCS) and mental (MCS) component summary scores of the SF-36 were 37.70 and 38.40, respectively. The mean SRS-30 score was 3.07. It is essential that the sagittal balance be restored when treating degenerative lumbar scoliosis to generate better

  8. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  9. Computed tomography for radiographers

    International Nuclear Information System (INIS)

    Brooker, M.

    1986-01-01

    Computed tomography is regarded by many as a complicated union of sophisticated x-ray equipment and computer technology. This book overcomes these complexities. The rigid technicalities of the machinery and the clinical aspects of computed tomography are discussed including the preparation of patients, both physically and mentally, for scanning. Furthermore, the author also explains how to set up and run a computed tomography department, including advice on how the room should be designed

  10. Radiographic classification of the femoral intercondylar notch posterolateral rim.

    Science.gov (United States)

    Farrow, Lutul D; Chen, Michael R; Cooperman, Daniel R; Goodfellow, Donald B; Robbin, Mark S

    2008-10-01

    The purpose of this study was to determine whether posterolateral rim morphology can be delineated on plain radiographic images. We obtained 20 femora from the Cleveland Museum of Natural History (10 each with distinct and indistinct posterolateral rims). Four blinded reviewers evaluated radiographic posterolateral rim morphology on lateral radiographs. The reviewers included a musculoskeletal radiologist, a fellowship-trained sports medicine surgeon, a pediatric orthopaedic surgeon, and a junior orthopaedic resident. Interobserver and intraobserver reliability was determined. Radiographically, posterolateral rim morphology was classified into 2 types. Type 1 rims have a defined transition from Blumensaat's line to the posterior femoral cortex. Type 2 rims have an indistinct transition. Interobserver reliability showed substantial agreement during the first (kappa = 0.65) and second (kappa = 0.70) sessions. Intraobserver reliability was nearly perfect, with kappa values ranging from 0.8 to 1.0. It has been shown anatomically that the posterolateral rim has variable morphology. We have shown that posterolateral rim morphology can be delineated on lateral plain film images. Radiographic type 1 rims correlate with distinct posterolateral rim morphology. Radiographic type 2 rims correlate with indistinct posterolateral rim morphology. For surgeons who reference the posterolateral rim for femoral tunnel placement during anterior cruciate ligament reconstruction, indistinct posterolateral rim morphology may result in errant tunnel placement. Improved awareness of posterolateral rim morphology preoperatively may help avoid technical errors with placement of the femoral tunnel.

  11. Radiographic testing in concrete structures

    International Nuclear Information System (INIS)

    Oliveira, D. de

    1987-01-01

    The radiographic testing done in concrete structures is used to analyse the homogeneity, position and corrosion of armatures and to detect discontinuity in the concrete such as: gaps, cracks and segregations. This work develops a Image quality Indicator (IQI) with an adequated sensibility to detect discontinuites based on BS4408 norm. (E.G.) [pt

  12. [Traditional risk factors for cardiovascular disease in primary antiphospholipid syndrome (APS) when compared with secondary APS: a study with 96 patients].

    Science.gov (United States)

    Ribeiro, A R; Carvalho, J F

    2010-01-01

    To evaluate the prevalence of traditional risk factors in patients with primary antiphospholipid syndrome (APS) in comparison to those with systemic lupus erythematosus-secondary APS. Transversal study of 96 APS patients (Sapporo's criteria). Demographic and clinical data, cardiovascular risk factors and drug use were investigated. Thirty-nine Primary APS and 57 secondary APS were included. The groups did not differ regarding age (38.5 +/- 9.9 vs. 39.4 +/- 10.5 years, p=0.84) and female gender (84.6 vs. 96.5%, p=0.06), respectively. Arterial events were more observed in primary than secondary APS (59 vs. 36.8%, p=0.04) patients. No difference was seen concerning venous and obstetric events. In regard to traditional risk factors for cardiovascular disease, both groups were comparable related to current or previous smoking, sedentarism, family history for coronary disease, systemic hypertension, diabetes mellitus, overweight and obesity. The frequencies of altered lipid profiles were alike in the two groups, except for a higher prevalence of low HDL-c levels in primary APS group (84.6 vs. 45.5%, p=0.0001). Concerning drug use, no significant differences were observed related to chloroquine and statin use, however the secondary APS patients had a higher rate of prednisone use (10.2 vs. 57.9%, pAPS, except for a high frequency of low HDL-c in primary APS patients.

  13. The Westinghouse Advanced Passive Pressurized Water Reactor, AP1000

    International Nuclear Information System (INIS)

    Schene, R.

    2009-01-01

    Featuring proven technology and innovative passive safety systems, the Westinghouse AP1000 pressurized water reactor can achieve competitive generation costs in the current electricity market without emitting harmful greenhouse gases and further harming the environment. Westinghouse Electric Company, the pioneer in nuclear energy once again sets a new industry standard with the AP1000. The AP1000 is a two-loop pressurized water reactor that uses simplified, innovative and effective approach to safety. With a gross power rating of 3415 megawatt thermal and a nominal net electrical output of 1117 megawatt electric, the AP1000 is ideal for new base load generation. The AP1000 is the safest and most economical nuclear power plant available in the worldwide commercial marketplace, and is the only Generation III+ reactor to receive a design certification from the U.S. Nuclear Regulatory Commission (NRC). Based on nearly 20 years of research and development, the AP1000 builds and improves upon the established technology of major components used in current Westinghouse designed plants. These components, including steam generators, digital instrumentation and controls, fuel, pressurizers, and reactor vessels, are currently in use around the world and have years of proven, reliable operating experience. Historically, Westinghouse plant designs and technology have forged the cutting edge technology of nuclear plant around the world. Today, nearly 50 percent of the world's 440 nuclear plants are based on Westinghouse technology. Westinghouse continues to be the nuclear industry's global leader. (author)

  14. Fellow's Apéro

    CERN Document Server

    Staff Association

    2017-01-01

    Let's get together, meet each other, exchange experiences and ideas, and share useful information on CERN and the Staff Association. Join us for Fellow's Apéro, organised by the Staff Association on Tuesday 21 February at 16.30 in Restaurant 1. There will be drinks and snacks for everybody! We look forward to seeing you there! Please confirm your participation on Doodle http://doodle.com/poll/skvm7ucm2z78i6bt or alternatively on Facebook https://www.facebook.com/events/1862757017340069/. Your delegates in the Staff Association, Barbora & Jiri

  15. Radiographic pathology for technologists

    International Nuclear Information System (INIS)

    Mace, J.D.; Kowalczyk, N.

    1988-01-01

    This book explains the fundamentals of disease mechanisms and relates this to the practice of radiologic science. Each chapter begins with a discussion of normal anatomy and physiology, then covers pathology and demonstrates how the pathology appears on film. Imaging modalities such as computed tomography, MRI, and ultrasound are also discussed. Clinical case studies are included

  16. Structural modules in AP1000 plant design

    International Nuclear Information System (INIS)

    Prasad, N.; Tunon-Sanjur, L.

    2007-01-01

    Structural modules are extensively used in AP1000 plant design. The shop manufacturing of modules components improves the quality and reliability of plant structures. The application of modules has a positive impact on construction schedules, and results in substantial savings in the construction cost. This paper describes various types of structural modules used for AP1000 plant structures. CA structural wall modules are steel plate modules with concrete placed, on or within the module, after module installation. The layout and design of the largest CA wall modules, CA01 and CA20, is described in detail. General discussion of structural floor modules, such as the composite and finned floors, is also included. Steel form CB modules (liners) consist of plate reinforced with angle stiffeners and tee sections. The angles and the tee sections are on the concrete side of the plate. Design of CB20 has been included as an example of CB type modules. Design codes and structural concepts related to module designs are discussed. (authors)

  17. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  18. Puncture wounds into the navicular bursa of the horse: role of radiographic evaluation

    International Nuclear Information System (INIS)

    Richardson, G.L.; O'Brien, T.R.

    1985-01-01

    Radiography was used to evaluate 32 horses presented for puncture wounds into the navicular bursa. At the initial radiographic examination, 21 horses had no radiographic signs of osteomyelitis, while 11 did. The mean-time interval between injury and radiographic examination was 20.6 days for horses without evidence of osteomyelitis and 59.3 days for those with evidence of osteomyelitis. Radiographic signs of osteomyelitis of the navicular bone included flexor cortical destruction and irregularity of the flexor surface. Other abnormalities included pathologic fracture of the navicular bone, subluxation of the distal interphalangeal joint, or secondary joint disease. The lateromedial and palmaroproximal-palmarodistal oblique projections were most useful for identifying abnormalities of the navicular bone. There was a high correlation between horses that had positive presurgical radiographic signs and surgical findings. However, approximately 50% of horses that had negative radiographic findings initially had positive surgical findings. Ten of 21 horses with negative radiographic findings on initial examination had evidence of bony lesions when reevaluated from 3 weeks to 6 years later. Nine of 11 horses with radiographic signs of osteomyelitis on initial radiographic examination were euthanatized or had an unsatisfactory outcome. Seven of 10 horses with radiographic signs on reexamination were euthanatized. Thirteen of 20 horses with positive surgical findings for navicular bone infection were euthanatized or had an unsatisfactory outcome

  19. Normal xeroradiographic and radiographic anatomy of the mallard duck (Anas platyrhynchos) with reference to other anserine species

    International Nuclear Information System (INIS)

    Smith, B.J.; Smith, S.A.

    1991-01-01

    he purpose of this study was to provide a reference for xeroradiographic and conventional radiographic anatomy of the mallard duck (Anas platyrhynchos) as a representative of the avian Order Anseriformes. The head, body, wing, and pelvic limb of three adult birds were radiographed using xeroradiographic and conventional radiographic techniques. Nine xeroradiographs and their corresponding conventional radiographs were selected, and the xeroradiographs labeled to illustrate normal anatomy. Selected views of other anseriform species were included to illustrate certain anatomical features unique to those species

  20. Simulated radiographic bone and joint modeling from 3D ankle MRI: feasibility and comparison with radiographs and 2D MRI.

    Science.gov (United States)

    Nordeck, Shaun M; Koerper, Conrad E; Adler, Aaron; Malhotra, Vidur; Xi, Yin; Liu, George T; Chhabra, Avneesh

    2017-05-01

    The purpose of this work is to simulate radiographs from isotropic 3D MRI data, compare relationship of angle and joint space measurements on simulated radiographs with corresponding 2D MRIs and real radiographs (XR), and compare measurement times among the three modalities. Twenty-four consecutive ankles were included, eight males and 16 females, with a mean age of 46 years. Segmented joint models simulating radiographs were created from 3D MRI data sets. Three readers independently performed blinded angle and joint space measurements on the models, corresponding 2D MRIs, and XRs at two time points. Linear mixed models and the intraclass correlation coefficient (ICC) was ascertained, with p values less than 0.05 considered significant. Simulated radiograph models were successfully created in all cases. Good agreement (ICC > 0.65) was noted among all readers across all modalities and among most measurements. Absolute measurement values differed between modalities. Measurement time was significantly greater (p 3D MRI data; however, measurements differ. Good inter-reader and moderate-to-good intra-reader reliability was observed and measurements obtained on simulated radiograph models took significantly less time compared to measurements with 2D and generally less time than XR.

  1. Chest radiographic manifestations of scrub typhus

    Directory of Open Access Journals (Sweden)

    KPP Abhilash

    2016-01-01

    Full Text Available Background and Rationale: Respiratory system involvement in scrub typhus is seen in 20–72% of patients. In endemic areas, good understanding and familiarity with the various radiologic findings of scrub typhus are essential in identifying pulmonary complications. Materials and Methods: Patients admitted to a tertiary care center with scrub typhus between October 2012 and September 2013 and had a chest X ray done were included in the analysis. Details and radiographic findings were noted and factors associated with abnormal X-rays were analyzed. Results: The study cohort contained 398 patients. Common presenting complaints included fever (100%, generalized myalgia (83%, headache (65%, dyspnea (54%, cough (24.3%, and altered sensorium (14%. Almost half of the patients (49.4% had normal chest radiographs. Common radiological pulmonary abnormalities included pleural effusion (14.6%, acute respiratory distress syndrome (14%, airspace opacity (10.5%, reticulonodular opacities (10.3%, peribronchial thickening (5.8%, and pulmonary edema (2%. Cardiomegaly was noted in 3.5% of patients. Breathlessness, presence of an eschar, platelet counts of 2 mg/dL had the highest odds of having an abnormal chest radiograph. Patients with an abnormal chest X-ray had a higher requirement of noninvasive ventilation (odds ratio [OR]: 13.98; 95% confidence interval CI: 5.89–33.16, invasive ventilation (OR: 18.07; 95% CI: 6.42–50.88, inotropes (OR: 8.76; 95% CI: 4.35–17.62, higher involvement of other organ systems, longer duration of hospital stay (3.18 ± 3 vs. 7.27 ± 5.58 days; P< 0.001, and higher mortality (OR: 4.63; 95% CI: 1.54–13.85. Conclusion: Almost half of the patients with scrub typhus have abnormal chest radiographs. Chest radiography should be included as part of basic evaluation at presentation in patients with scrub typhus, especially in those with breathlessness, eschar, jaundice, and severe thrombocytopenia.

  2. Normal radiographic findings. 4. act. ed.; Roentgennormalbefunde

    Energy Technology Data Exchange (ETDEWEB)

    Moeller, T.B. [Gemeinschaftspraxis fuer Radiologie und Nuklearmedizin, Dillingen (Germany)

    2003-07-01

    This book can serve the reader in three ways: First, it presents normal findings for all radiographic techniques including KM. Important data which are criteria of normal findings are indicated directly in the pictures and are also explained in full text and in summary form. Secondly, it teaches the systematics of interpreting a picture - how to look at it, what structures to regard in what order, and for what to look in particular. Checklists are presented in each case. Thirdly, findings are formulated in accordance with the image analysis procedure. All criteria of normal findings are defined in these formulations, which make them an important didactic element. (orig.)

  3. Normal radiographic findings. 4. act. ed.

    International Nuclear Information System (INIS)

    Moeller, T.B.

    2003-01-01

    This book can serve the reader in three ways: First, it presents normal findings for all radiographic techniques including KM. Important data which are criteria of normal findings are indicated directly in the pictures and are also explained in full text and in summary form. Secondly, it teaches the systematics of interpreting a picture - how to look at it, what structures to regard in what order, and for what to look in particular. Checklists are presented in each case. Thirdly, findings are formulated in accordance with the image analysis procedure. All criteria of normal findings are defined in these formulations, which make them an important didactic element. (orig.)

  4. Radiographic assessment of endodontic working length

    OpenAIRE

    Osama S Alothmani; Lara T Friedlander; Nicholas P Chandler

    2013-01-01

    The use of radiographs for working length determination is usual practice in endodontics. Exposing radiographs following the principles of the paralleling technique allows more accurate length determination compared to the bisecting-angle method. However, it has been reported that up to 28.5% of cases can have the file tip extending beyond the confines of the root canals despite an acceptable radiographic appearance. The accuracy of radiographic working length determination could be affected ...

  5. Intra-observer reproducibility and interobserver reliability of the radiographic parameters in the Spinal Deformity Study Group's AIS Radiographic Measurement Manual.

    Science.gov (United States)

    Dang, Natasha Radhika; Moreau, Marc J; Hill, Douglas L; Mahood, James K; Raso, James

    2005-05-01

    Retrospective cross-sectional assessment of the reproducibility and reliability of radiographic parameters. To measure the intra-examiner and interexaminer reproducibility and reliability of salient radiographic features. The management and treatment of adolescent idiopathic scoliosis (AIS) depends on accurate and reproducible radiographic measurements of the deformity. Ten sets of radiographs were randomly selected from a sample of patients with AIS, with initial curves between 20 degrees and 45 degrees. Fourteen measures of the deformity were measured from posteroanterior and lateral radiographs by 2 examiners, and were repeated 5 times at intervals of 3-5 days. Intra-examiner and interexaminer differences were examined. The parameters include measures of curve size, spinal imbalance, sagittal kyphosis and alignment, maximum apical vertebral rotation, T1 tilt, spondylolysis/spondylolisthesis, and skeletal age. Intra-examiner reproducibility was generally excellent for parameters measured from the posteroanterior radiographs but only fair to good for parameters from the lateral radiographs, in which some landmarks were not clearly visible. Of the 13 parameters observed, 7 had excellent interobserver reliability. The measurements from the lateral radiograph were less reproducible and reliable and, thus, may not add value to the assessment of AIS. Taking additional measures encourages a systematic and comprehensive assessment of spinal radiographs.

  6. Scoring radiographic progression in ankylosing spondylitis: should we use the modified Stoke Ankylosing Spondylitis Spine Score (mSASSS) or the Radiographic Ankylosing Spondylitis Spinal Score (RASSS)?

    NARCIS (Netherlands)

    Ramiro, Sofia; van Tubergen, Astrid; Stolwijk, Carmen; Landewé, Robert; van de Bosch, Filip; Dougados, Maxime; van der Heijde, Désirée

    2013-01-01

    ABSTRACT: INTRODUCTION: Radiographic damage is one of the core outcomes in axial SpA and is usually assessed with the modified Stoke Ankylosing Spondylitis (AS) Spine Score (mSASSS). Alternatively, the Radiographic AS Spinal Score (RASSS) is proposed, which includes the lower thoracic vertebrae,

  7. 21 CFR 892.1840 - Radiographic film.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Radiographic film. 892.1840 Section 892.1840 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES RADIOLOGY DEVICES Diagnostic Devices § 892.1840 Radiographic film. (a) Identification. Radiographic film is a device that consists of a thin...

  8. Chest radiographic findings in Human Immunodeficiency Virus ...

    African Journals Online (AJOL)

    Patients had postero-anterior (PA) chest radiographs done in full inspiration, with a Roentgen 301 radiographic machine (GEC Medical) using the following factors; KVp = 65, focus-film distance = 150cm and 12 – 15mAs. A total of 308 confirmed HIV- positive patients had chest radiographic examinations. Ninety-nine ...

  9. Quantitative radiographic assessment of the anatomic attachment sites of the anterior and posterior complexes of the proximal tibiofibular joint.

    Science.gov (United States)

    Marchetti, Daniel Cole; Chahla, Jorge; Moatshe, Gilbert; Slette, Erik L; LaPrade, Robert F

    2018-04-01

    Quantitative guidelines for radiographic identification of the anterior and posterior ligaments of the proximal tibiofibular joint have not been well defined. The purpose of this study was to provide reproducible, quantitative descriptions of radiographic landmarks identifying the anterior and posterior ligament complexes of the proximal tibiofibular joint. It was hypothesized that consistent quantitative data regarding the radiographic location of the anterior and posterior proximal tibiofibular joint ligament complexes could be identified. The footprint centers of the individual ligament bundles of the anterior and posterior complexes of the proximal tibiofibular joint were labeled with radio-opaque markers in ten non-paired, fresh-frozen cadaveric knee specimens. Anteroposterior (AP) and lateral radiographs of the proximal tibiofibular joint were obtained, and distances between the markers and pertinent radiographic landmarks were recorded. On AP radiographs, the tibial span of the anterior complex was 12.8 ± 3.9 mm and started at a median of 11.4 mm distal to the tibial plateau; the fibular span was 11.6 ± 6.8 mm and started at a median of 5.1 mm from the apex of the fibular styloid. The tibial span of the posterior complex was 11.7 ± 8.4 mm and began at a median of 12.1 mm distal to the tibial plateau; the fibular span was 11.8 ± 7.9 mm and began at a median of 3.1 mm distal to the apex of the fibular styloid. Values were similar for lateral radiographs. The attachment locations of the proximal tibiofibular anterior and posterior complexes could be quantitatively correlated to reliable osseous landmarks and radiographic lines. This information will allow for consistent radiographic assessments of proper tunnel placement intraoperatively and postoperatively during anatomic reconstructions of the proximal tibiofibular joint.

  10. The role of a consultant breast radiographer: A description and a reflection

    International Nuclear Information System (INIS)

    Kelly, Judith; Hogg, Peter; Henwood, Suzanne

    2008-01-01

    Consultant radiographers are a relatively new concept within the British healthcare system, with them being first established in 2003. Consultant radiographer job roles are broad and include advanced clinical activities (often being similar in nature to those delivered by medical practitioners, e.g. radiologists), professional leadership, teaching and education and service improvement. Given their relative novelty almost no literature exists to describe in detail specific roles of consultant breast radiographers. Consequently, in this article we use a case study approach to describe and reflect critically upon the role of one consultant breast radiographer. The article commences with a general introduction about consultant radiographers; it then progresses to outline the context in which the case study of the breast consultant radiographer sits. Through description and reflective commentary we take the reader through the role of the consultant breast radiographer to highlight where the role has had perceived value and also to highlight where the role has been particularly challenging for the post holder. As a consequence of the case study approach taken, the article is written partly in the first person (taken from interview comments made by the consultant breast radiographer) and partly in the third person. The final element of the article is a reflective commentary given by the consultant radiographer regarding her feelings about her first few years as a consultant breast radiographer

  11. Radiographer's impact on improving clinical decision-making, patient care and patient diagnosis: a pilot study

    International Nuclear Information System (INIS)

    Lam, Daniel; Egan, Ingrid; Baird, Marilyn

    2004-01-01

    This pilot study attempts to quantify the benefits of a documented radiographic clinical history through the use of the clinical history template form designed by Egan and Baird. Six radiographers completed the clinical history template for 40 patients and four radiologists included the recorded information as part of their reporting process. A focus discussion group was held between the radiographers to ascertain the level of satisfaction and benefits encountered with the use of the template form. A questionnaire was designed for the radiologists to complete regarding the usefulness of the template form with respect to the radiological reporting process. Results/Discussion: 15 cases for which the form was used demonstrated a direct benefit in respect to improved radiographic clinical decision-making. Radiographers agreed the template form aided the establishment of a stronger radiographer-patient relationship during the radiographic examination. Two radiologists agreed the form aided in establishing a radiological diagnosis and suggested the form be implemented as part of the standard departmental protocol. Despite the small sample size, there is evidence the form aided radiographic decision-making and assisted in the establishment of an accurate radiological diagnosis. The overall consensus amongst radiographers was that it enhanced radiographer-patient communication and improved the level of patient care. Copyright (2004) Australian Institute of Radiography

  12. Assessment of Radiographic Image Quality by Visual Examination of Neutron Radiographs of the Calibration Fuel Pin

    DEFF Research Database (Denmark)

    Domanus, Joseph Czeslaw

    1986-01-01

    Up till now no reliable radiographic image quality standards exist for neutron radiography of nuclear reactor fuel. Under the Euratoro Neutron Radiography Working Group (NRWG) Test Program neutron radiographs were produced at different neutron radiography facilities within the European Community...... of a calibration fuel pin. The radiographs were made by the direct, transfer and tracketch methods using different film recording materials. These neutron radiographs of the calibration fuel pin were used for the assessement of radiographic image quality. This was done by visual examination of the radiographs...... and assessing their radiographic image quality on an arbitrary scale....

  13. Pulmonary edema: radiographic differential diagnosis

    International Nuclear Information System (INIS)

    Yoo, Dong Soo; Choi, Young Hi; Kim, Seung Cheol; An, Ji Hyun; Lee, Jee Young; Park, Hee Hong

    1997-01-01

    To evaluate the feasibility of using chest radiography to differentiate between three different etiologies of pulmonary edema. Plain chest radiographs of 77 patients, who were clinically confirmed as having pulmonary edema, were retrospectively reviewed. The patients were classified into three groups : group 1 (cardiogenic edema : n = 35), group 2 (renal pulmonary edema : n = 16) and group 3 (permeability edema : n = 26). We analyzed the radiologic findings of air bronchogram, heart size, peribronchial cuffing, septal line, pleural effusion, vascular pedicle width, pulmonary blood flow distribution and distribution of pulmonary edema. In a search for radiologic findings which would help in the differentiation of these three etiologies, each finding was assessed. Cardiogenic and renal pulmonary edema showed overlapping radiologic findings, except for pulmonary blood flow distribution. In cardiogenic pulmonary edema (n=35), cardiomegaly (n=29), peribronchial cuffing (n=29), inverted pulmonary blood flow distribution (n=21) and basal distribution of edema (n=20) were common. In renal pulmonary edema (n=16), cardiomegaly (n=15), balanced blood flow distribution (n=12), and central (n=9) or basal distribution of edema (n=7) were common. Permeability edema (n=26) showed different findings. Air bronchogram (n=25), normal blood flow distribution (n=14) and peripheral distribution of edema (n=21) were frequent findings, while cardiomegaly (n=7), peribronchial cuffing (n=7) and septal line (n=5) were observed in only a few cases. On plain chest radiograph, permeability edema can be differentiated from cardiogenic or renal pulmonary edema. The radiographic findings which most reliably differentiated these two etiologies were air bronchogram, distribution of pulmonary edema, peribronchial cuffing and heart size. Only blood flow distribution was useful for radiographic differentiation of cardiogenic and renal edema

  14. Who are they? Identities in the Norwegian radiographer profession as presented in the Norwegian printed press

    International Nuclear Information System (INIS)

    Stalsberg, R.; Thingnes, E.R.

    2016-01-01

    Purpose: To explore how Norwegian radiographers are portrayed in written press. Method: Textual discourse analysis, following a multiple step strategy, combining both a quantitative and a qualitative approach. 189 newspaper articles were included. The articles were registered and subject fields were inductively categorized. Each subject field was analysed regarding the field's role as an agent of influence on public perception of radiographers. Results: On average, less than one article a year concerning radiography profession is published in Norwegian newspapers. A majority are published in newspapers with small circulation figures, often reporting on resources in the local health services where radiographers are involved. Mostly radiographers are placed in the articles' background playing supporting roles, frequently mentioned in the cutline as an operator of a new medical technology. There is a heavy emphasis on the technology, leaving the specialized expertise and radiography knowledge out. This focus persist in the instances where radiographers play a main role in the texts. When patient stories are told, positive value-laden words are used to describe the radiographer and both the technical and the patient-care aspects of being a radiographer are noticeable. Conclusion: Norwegian radiographers typically appear, in glimpses, as anonymous allied health technicians in local reports on new diagnostic equipment or resource utilization. The professional qualities and decisive skills required to handle sophisticated diagnostic equipment and continuity of patient care are underestimated. A more-nuanced media coverage might give radiographers a strengthened identity as important health-care service contributors. - Highlights: • The radiography profession is an inconspicuous topic in Norwegian written press. • Written press involving radiographers highlight new equipment and medical technology. • Radiographers' professional qualities and decisive

  15. Submitting to the APS Journals

    Science.gov (United States)

    Hall, Donavan; Johnson, Brant; Kim-Zajonz, Julie; Ucko, Daniel

    2006-03-01

    This session will contain a short presentation of policies, practices and general advice for authors submitting to APS journals. For both the Physical Review and Physical Review Letters, it will focus on such things as the importance of a properly written introduction; our current drive for increased accessibility in the Phys. Rev. journals; how a well written cover letter and how suggesting referees will aid your manuscript in the review process. We shall also discuss responding to referees and offer advice on resubmitting your manuscript. In addition there will be information on technical details such as web submission and the Author Status Information Service (ASIS). The presentation will then be followed by a moderated panel discussion, where editors from PRL, PRB and PRE will answer questions from the audience on author issues.

  16. APS: Lighting up the future

    International Nuclear Information System (INIS)

    Potent, V.J.

    1993-01-01

    Work on the Advanced Photon Source (APS) at Argonne National Laboratory (ANL) involves the construction and supporting research and development for a national user facility for synchrotron radiation research in the x-ray region. The facility, when operational in 1997, will provide super-intense x-ray beams for many areas of basic research and will serve the entire US x-ray research community of several thousand users. This paper describes the pertinent features of the design, construction and planned operation of the facility; and the impact quality has had in these areas. In addition, the introduction of several quality management techniques such as total quality management, reliability/availability planning, and user interface are discussed concerning their status and success

  17. A Radiographic Study of Odontoma

    International Nuclear Information System (INIS)

    Lee, Kyung Ho; Choi, Karp Shik

    1998-01-01

    The purpose of this study was to obtain information on the clinical and radiographic features of the odontomas in the jaws. For this study, the authors examined and analyzed the clinical records and radiographs of 119 patients who had lesion of odontoma diagnosed by clinical and radiographic examinations. The obtained results were as follows ; 1. Odontoma occurred the most frequently in the 2nd decade (45.4%) and occurred more frequently in males (60.5%) than in females (39.5%). 2. The most common clinical symptom was the delayed eruption of the teeth (34.2%). 3. The type of lesions was mainly observed as compound odontoma (80.8%), and internal pattern of the complex odontoma was unevenly radiopaque (73.9%). 4. The compound odontoma frequently occurred in anterior portion of the maxilla (57.7%) and mandible (30.9%), and complex odontoma frequently occurred in anterior portion of maxilla (34.8%) and posterior portion of mandible (30.5%). 5. The effects on adjacent teeth were impaction of teeth (71.7%) and prolonged retention of deciduous teeth (31.7%). 6. The impaction of the teeth occurred in anterior portion of maxilla (44.2%) amd mandible (19.2%), but root resorption of the adjacent teeth were not seen. 7. The boundary to adjacent structure was well-defined , the lesions appear as radiopaque mass with radiolucent rim.

  18. A Radiographic Study of Odontoma

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyung Ho; Choi, Karp Shik [Dept. of Dental Radiology, College of Dentistry, Kyungpook National University, Daegu (Korea, Republic of)

    1998-02-15

    The purpose of this study was to obtain information on the clinical and radiographic features of the odontomas in the jaws. For this study, the authors examined and analyzed the clinical records and radiographs of 119 patients who had lesion of odontoma diagnosed by clinical and radiographic examinations. The obtained results were as follows: 1. Odontoma occurred the most frequently in the 2nd decade (45.4%) and occurred more frequently in males (60.5%) than in females (39.5%). 2. The most common clinical symptom was the delayed eruption of the teeth (34.2%). 3. The type of lesions was mainly observed as compound odontoma (80.8%), and internal pattern of the complex odontoma was unevenly radiopaque (73.9%). 4. The compound odontoma frequently occurred in anterior portion of the maxilla (57.7%) and mandible (30.9%), and complex odontoma frequently occurred in anterior portion of maxilla (34.8%) and posterior portion of mandible (30.5%). 5. The effects on adjacent teeth were impaction of teeth (71.7%) and prolonged retention of deciduous teeth (31.7%). 6. The impaction of the teeth occurred in anterior portion of maxilla (44.2%) amd mandible (19.2%), but root resorption of the adjacent teeth were not seen. 7. The boundary to adjacent structure was well-defined , the lesions appear as radiopaque mass with radiolucent rim.

  19. Automating the radiographic NDT process

    International Nuclear Information System (INIS)

    Aman, J.K.

    1986-01-01

    Automation, the removal of the human element in inspection, has not been generally applied to film radiographic NDT. The justication for automating is not only productivity but also reliability of results. Film remains in the automated system of the future because of its extremely high image content, approximately 8 x 10 9 bits per 14 x 17. The equivalent to 2200 computer floppy discs. Parts handling systems and robotics applied for manufacturing and some NDT modalities, should now be applied to film radiographic NDT systems. Automatic film handling can be achieved with the daylight NDT film handling system. Automatic film processing is becoming the standard in industry and can be coupled to the daylight system. Robots offer the opportunity to automate fully the exposure step. Finally, computer aided interpretation appears on the horizon. A unit which laser scans a 14 x 17 (inch) film in 6 - 8 seconds can digitize film information for further manipulation and possible automatic interrogations (computer aided interpretation). The system called FDRS (for Film Digital Radiography System) is moving toward 50 micron (*approx* 16 lines/mm) resolution. This is believed to meet the need of the majority of image content needs. We expect the automated system to appear first in parts (modules) as certain operations are automated. The future will see it all come together in an automated film radiographic NDT system (author) [pt

  20. A radiographic study of cementoma

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Eui Hwan; Lee, Sang Rae [Dept. of Oral Radiology, Division of Dentistry, Kyung Hee University, Seoul (Korea, Republic of)

    1986-11-15

    This study was undertaken to document and better define this condition to help clarify this clinical and radiographic appearances by analysis of clinical and radiographic features of cementoma. A study was made of a series of 104 cases with cementoma. This investigation of cementoma revealed the following features: 1. The female occurred in 73% of periapical cemental dysplasia and benign cementoblastoma, and 80% of cementifying fibroma. 2. 40% of periapical cemental dysplasia occurred in the fifth decades, and 73% of benign cementoblastoma during the second and third decades, while there was no age predilection in the cementifying fibroma. 3. 63% of periapical cemental dysplasia occurred in the mandibular anterior region. 91% of benign cementoblastom a and 80% of cementifying fibroma occurred in the mandibular premolar and/or molar region. 4. There were no cases complaining the associated clinical signs and subjective symptoms in the periapical cemental dysplasia, however the patient complained the pain in 36% of benign cementoblastoma and 40% of cementifying fibroma. 5. There were no cases expanding the cortical plates in the periapical cemental dysplasia, however 73% of benign cementoblastoma and all of 5 cases of cementifying fibroma showed the expansion of cortical plates. 6. Several radiographic features of the periapical cemental dysplasia were shown. a. 29% of the cases had multiple lesion. b. 53% of the cases were in mature stage. c. During the osteolytic stage, the alveolar lamina dura was lost in 89% of the cases.

  1. Problematic fine bore nasogastric intubation: A radiographer led service development

    International Nuclear Information System (INIS)

    Law, Robert

    2008-01-01

    Developing from the intubation and performing of small bowel enteroclysis a consultant radiographer led service expanded to include problematic gastric, enteric and colonic intubations for diagnostic, therapeutic and interventional purposes. The radiographer led service has also extended to include 'hot reporting' chest images taken to check siting of ward placed nasogastric tubes as well as resiting those tubes that were misplaced. The service has demonstrated itself to be safe and efficient. It has also proven to be both cost and clinically effective. The protracted discomfort and distress to the patient are reduced by minimizing the delay in correctly relocating misplaced tubes

  2. Mesiodens: a radiographic study in children.

    Science.gov (United States)

    Gündüz, Kaan; Celenk, Peruze; Zengin, Zeynep; Sümer, Pinar

    2008-09-01

    We analyzed the frequency and radiological features of mesiodens in a group of children in Turkey. The study was based on a radiographic review of 23,000 pediatric patients (male: 12,667 female; 10,333) who visited the Department of Oral Diagnosis and Radiology during the period 2003-2005 (3 years). The presence of an unerupted supernumerary tooth, or tooth bud between the 2 central incisors or as unilateral or bilateral teeth in the midline of the maxilla was noted as mesiodens on radiographs. Eighty-five cases of mesiodens in 69 patients were found. Complete documentation, including radiographs, for these 69 patients were studied and analyzed. In addition to gender and age, the following information about the mesiodens was recorded: 1) number; 2) shape; 3) position; 4) complications caused by the mesiodens; 5) treatment. Of the 69 patients, the ratio of boys (47 cases) to girls (22 cases) was 2.1:1. Fifty-three (76.8%) of the children had 1 mesiodens, and 16 (23.1%) had 2 mesiodentes bilaterally to the midline. Of the 85 mesiodentes, 67 (78.8%) were fully impacted, 6 (7%) were partially erupted, and 12 (14.1%) were fully erupted. Most of the mesiodentes (55.2%) were found in the vertical position, followed by inverted position (37.6%), and horizontal position (7%). The main complications were delayed eruption of the permanent incisors (38.8%), maxillary midline diastema (17.6%), axial rotation or inclination of erupted permanent incisors (16.4%), and resorption of the adjacent teeth (4.7%) The prevelance of mesiodens has been estimated to be 0.15% to 2.2% of the population.

  3. Assessment of dose in cervical vertebrae radiographic examinations

    International Nuclear Information System (INIS)

    Owrnasir, Wafa Fadol Orsud

    2014-12-01

    Reference dose levels provide a framework to reduce doses variability and aid in the optimization of radiation protection.This study was performed in Khartoum Teaching Hospital in period of January to June 2014. This study performed to assess the entrance surface dose ( ESD) received in Cervical Vertebrae radiographic examination and to analyze effective dose distributions among radiological departments under study. The study was performed in Khartoum Teaching Hospital, covering two x-ray units and a sample of 64 patients. The following parameter were recorded; age, weight, height, body mass index (BMI) derived from weight (kg) and height (m) and exposure factors. The dose was measured for Cervical Vertebrae x-ray examinations, the entrance surface dose (ESD) values were estimated from the x-ray tube output parameters for Cervical Vertebrae AP and lateral examinations. The ESD values were then calculated using IAEA calculation methods. The results of ESD values calculated showed than patient exposure were within the normal range of exposure. The mean ED values calculated were ( 3.85 ±0.04) and (4.02 ±0.05) mGy for Cervical Vertebrae AP and lateral examinations, respectively in department Na1 and (3.99± 0.15) and (4.23± 0.34) mGy, for Cervical Vertebrae Ap and lateral examinations respectively in department Na2, the IAEA standard value of ESD for cervical equal (7), (20) mGy AP and LAT, Further studies are recommended with more number of patients and using more than two modalities for comparison. (Author)

  4. Cauda equina syndrome in the dog: radiographic evaluation

    International Nuclear Information System (INIS)

    Morgan, J.P.; Bailey, C.S.

    1990-01-01

    Dogs with clinical signs typical of cauda equina syndrome require careful evaluation to determine the cause of the disease as this strongly influences choice of treatment. Possible aetiologies include congenital or developmental, inflammatory, traumatic, neoplastic, and degenerative lesions that may involve vertebrae, vertebral joints, intervertebral discs, spinal cord, spinal nerves, or meninges. It must be determined whether clinical signs are due to musculoskeletal or neurological disease before performing special radiographic procedures. Non-contrast radiography permits false-positive diagnosis of obvious degenerative changes involving the L-S disc that may be without clinical signs or permits a false-negative diagnosis due to the failure to appreciate soft tissue lesions not seen radiographically. Special radiographic techniques are recommended and include: (1) stress radiography, (2) discography, and (3) epidural myelography. Evaluation of the results of these studies assists in determining the cause of the cauda equina syndrome and the type of therapy required

  5. Monte Carlo simulation for radiographic applications

    International Nuclear Information System (INIS)

    Tillack, G.R.; Bellon, C.

    2003-01-01

    Standard radiography simulators are based on the attenuation law complemented by built-up-factors (BUF) to describe the interaction of radiation with material. The assumption of BUF implies that scattered radiation reduces only the contrast in radiographic images. This simplification holds for a wide range of applications like weld inspection as known from practical experience. But only a detailed description of the different underlying interaction mechanisms is capable to explain effects like mottling or others that every radiographer has experienced in practice. The application of Monte Carlo models is capable to handle primary and secondary interaction mechanisms contributing to the image formation process like photon interactions (absorption, incoherent and coherent scattering including electron-binding effects, pair production) and electron interactions (electron tracing including X-Ray fluorescence and Bremsstrahlung production). It opens up possibilities like the separation of influencing factors and the understanding of the functioning of intensifying screen used in film radiography. The paper discusses the opportunities in applying the Monte Carlo method to investigate special features in radiography in terms of selected examples. (orig.) [de

  6. Cases report of ossifying fibroma showing various radiographic appearances in posterior mandible

    International Nuclear Information System (INIS)

    Lee, Byung Do; Oh, Seung Hwan; Son, Hyun Jin

    2010-01-01

    Common radiographic appearances of ossifying fibroma (OF) are well demarcated margin, radiolucent or mixed lesion. Lesions for the radiographic differential diagnosis with OF include fibrous dysplasia, focal cemento-osseous dysplasia. Other confusing lesions might be the mixed lesions such as calcifying odontogenic cyst, adenomatoid odontogenic tumor, calcifying epithelial odontogenic tumor, and benign cementoblastoma. We reported three cases of OF in posterior mandible. These cases showed a little distinguished radiographic features of OF and diagnosed from a combination of clinical, radiographic, and histopathologic information. We need to further refine radiographic and histopathological features of OF and other confusing lesions with literatures review because some cases of these lesions are not easily differentiated radiographically and histopathologically.

  7. Cases report of ossifying fibroma showing various radiographic appearances in posterior mandible

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Byung Do; Oh, Seung Hwan [School of Dentistry, Wonkwang University, Seoul (Korea, Republic of); Son, Hyun Jin [Department of Pathology, School of Medicine, Eulji University, Daejeon (Korea, Republic of)

    2010-06-15

    Common radiographic appearances of ossifying fibroma (OF) are well demarcated margin, radiolucent or mixed lesion. Lesions for the radiographic differential diagnosis with OF include fibrous dysplasia, focal cemento-osseous dysplasia. Other confusing lesions might be the mixed lesions such as calcifying odontogenic cyst, adenomatoid odontogenic tumor, calcifying epithelial odontogenic tumor, and benign cementoblastoma. We reported three cases of OF in posterior mandible. These cases showed a little distinguished radiographic features of OF and diagnosed from a combination of clinical, radiographic, and histopathologic information. We need to further refine radiographic and histopathological features of OF and other confusing lesions with literatures review because some cases of these lesions are not easily differentiated radiographically and histopathologically.

  8. Factors for lifelong job retention among Swiss radiographers

    International Nuclear Information System (INIS)

    Lehmann, P.; Meystre, N. Richli; Mamboury, N.

    2015-01-01

    In Switzerland, a shortage of radiographers in the three radiology domains, radio-diagnostic, radiotherapy and nuclear medicine, is supposed to increase in the upcoming years. As job satisfaction has been shown to contribute to workplace retention, one purpose of the study was to explore the relationship between workplace retention and duration in the profession with job satisfaction. The study was based on two surveys. The institutional survey was addressed to all chiefs of radiology units in hospitals and ambulatory institutes (340, response rate 48%). All radiographers were asked to complete the individual survey (3000, response rate 25%). Two thirds of radiographers had been employed for five or more years in the same workplace, and nearly half intended to stay for 10 more years. The professional lifespan of radiographers is estimated to be approximately 27 years. 75% expressed their satisfaction with key aspects of professional activity, including the content of the work, autonomy, technology and their relationships with professionals and patients. These factors were not linked to a particular workplace, but to the profession itself. The radiographers build their own propitious work environment, even if salary and recognition by physicians are contributing to their dissatisfaction. The retention in the profession, consolidated by a high level of satisfaction, is an essential feature for a workforce policy. However, active measures for reinforcing retention are still necessary when considering that a lifelong career needs challenges and rewards. Additionally, the retention rate does not provide a guarantee adequacy for the future projected needs in the profession. - Highlights: • Retention in the profession, with a high level of satisfaction, is a major point for a workforce policy. • Job satisfaction of radiographers is not linked to a particular workplace, but to the profession itself. • The professional lifespan of radiographers in Switzerland is

  9. Interactive radiographic image retrieval system.

    Science.gov (United States)

    Kundu, Malay Kumar; Chowdhury, Manish; Das, Sudeb

    2017-02-01

    Content based medical image retrieval (CBMIR) systems enable fast diagnosis through quantitative assessment of the visual information and is an active research topic over the past few decades. Most of the state-of-the-art CBMIR systems suffer from various problems: computationally expensive due to the usage of high dimensional feature vectors and complex classifier/clustering schemes. Inability to properly handle the "semantic gap" and the high intra-class versus inter-class variability problem of the medical image database (like radiographic image database). This yields an exigent demand for developing highly effective and computationally efficient retrieval system. We propose a novel interactive two-stage CBMIR system for diverse collection of medical radiographic images. Initially, Pulse Coupled Neural Network based shape features are used to find out the most probable (similar) image classes using a novel "similarity positional score" mechanism. This is followed by retrieval using Non-subsampled Contourlet Transform based texture features considering only the images of the pre-identified classes. Maximal information compression index is used for unsupervised feature selection to achieve better results. To reduce the semantic gap problem, the proposed system uses a novel fuzzy index based relevance feedback mechanism by incorporating subjectivity of human perception in an analytic manner. Extensive experiments were carried out to evaluate the effectiveness of the proposed CBMIR system on a subset of Image Retrieval in Medical Applications (IRMA)-2009 database consisting of 10,902 labeled radiographic images of 57 different modalities. We obtained overall average precision of around 98% after only 2-3 iterations of relevance feedback mechanism. We assessed the results by comparisons with some of the state-of-the-art CBMIR systems for radiographic images. Unlike most of the existing CBMIR systems, in the proposed two-stage hierarchical framework, main importance

  10. The Reliability of the Symax Method of Measuring the Radiographic Femoral Varus Angle

    DEFF Research Database (Denmark)

    Allpass, Maja; Miles, James Edward; Schmökel, Hugo

    2014-01-01

    Objective: To determine the practicability of curved osteotomy to correct femoral varus in small breed dogs, and to assess the reliability of the Symax method of measuring the radiographic femoral varus angle (FVA). Methods: Eleven cadaveric femora plus one clinical case were included in this study...... was reassessed from postoperative radiographs. All radiographs were blinded and randomized for statistical analysis. FVA measurement reliability was assessed using all radiographs (n=24), whereas surgical practicability was assessed from 8 femora with a preoperative FVA >6º. Results: Femoral varus measurements...

  11. Which factors influence radiographic progression during treatment with tumor necrosis factor inhibitors in clinical practice?

    DEFF Research Database (Denmark)

    Ørnbjerg, Lykke Midtbøll; Østergaard, Mikkel; Bøyesen, Pernille

    2014-01-01

    years after anti-TNF initiation in clinical practice. METHODS: DANBIO-registered patients with RA who had available radiographs (anti-TNF initiation and ∼2 yrs followup) were included. Radiographs were scored, blinded to chronology with the Sharp/van der Heijde method and linked with DANBIO data...... with radiographic progression during 2 years of followup of 930 anti-TNF-treated patients with RA in clinical practice. High disease activity and switching/stopping anti-TNF treatment were associated with radiographic progression....

  12. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  13. [Type 2 autoimmune polyendocrine syndromes (APS-2)].

    Science.gov (United States)

    Vialettes, Bernard; Dubois-Leonardon, Noémie

    2013-01-01

    Type 2 autoimmune polyendocrine syndromes (APS-2) are the most frequent disorders associating several organ-specific autoimmune diseases. Their high prevalence is due to the fact that the main manifestations of APS-2, such as thyroidal autoimmunity, type 1 diabetes, autoimmune gastric atrophy and vitiligo, are common diseases. APS-2 represents a clinical model that can serve to help unravel the mechanisms underlying autoimmunity. Diagnosis of APS-2 is a challenge for the clinician, especially in poorly symptomatic forms, and may require systematic screening based on measurement of autoantibodies and functional markers.

  14. A prospective comparison of intestinal sonography and abdominal radiographs in a neonatal intensive care unit.

    Science.gov (United States)

    Silva, Cicero T; Daneman, Alan; Navarro, Oscar M; Moineddin, Rahim; Levine, Daniel; Moore, Aideen M

    2013-11-01

    No study reported in the literature comprehensively compares findings on neonatal abdominal radiographs with sonography. To compare the findings on abdominal radiographs and sonograms in infants in intensive care, to better understand how the various intestinal gas patterns on radiographs relate to the spectrum of appearances on sonography and, second, to evaluate the ability of sonography to differentiate necrotizing enterocolitis from other intestinal pathology. We prospectively evaluated sonograms and radiographs, blinded to the other modality and to clinical information. Patients' charts were reviewed by a third blinded reader and used as a reference standard for diagnosis. We made associations between sonographic findings, radiographic intestinal gas patterns and clinical diagnoses. We included 75 infants with gestational ages between 23 weeks and 41 weeks. Sonographic abnormalities were present in infants with all radiographic intestinal gas patterns, including normal patterns. We only saw absent intestinal perfusion and fluid collections on sonography (suggesting intestinal necrosis and sealed perforation) in infants with intestinal dilatation with elongation on radiographs. Separation of intestinal loops on radiographs was most commonly caused by reasons other than intestinal wall thickening. Increased intestinal echogenicity or free fluid with echoes on sonography correlated with a diagnosis of necrotizing enterocolitis, whereas anechoic free fluid correlated with absence of necrotizing enterocolitis. Sonography is complementary to radiographs in infants with suspected intestinal pathology, with a spectrum of appearances seen on each modality. Some sonographic findings either strongly suggest necrotizing enterocolitis or supply evidence against this diagnosis.

  15. Measurements of radiation dose to patients undergoing some common radiographic x-ray examinations in Wad Madani hospitals

    International Nuclear Information System (INIS)

    Mohammedzein, T. S.

    2009-12-01

    The aim of this study was to assess patient doses in most common radiographic x-ray examinations in Wad Madani hospitals of Al Gazera State. The examination parameters of 388 radiographs were used to calculate the Entrance Surface Air Kerma (ESAK) of patients undergoing skull (AP and LAT), chest (PA), pelvis (AP), abdomen (AP) and lumbar spin (AP and LAT) in six major hospitals. Hospital mean ESAKs estimated range from 0.0729-0.69 mGy for chest PA, 0.338-6.64 mGy for skull PA, 0.195-5.8 mGy for skull LAT, 0.595-3.42 mGy for pelvis AP, 0.772-6.31 mGy for lumbar spine AP, 2.1-15.2 mGy for lumbar spine LAT and 0.742-5.79 mGy for abdomen. This data will be useful for the formulation of national reference levels as recommended by International Atomic Energy Agency (IAEA). (Author)

  16. Control units for APS power supplies

    International Nuclear Information System (INIS)

    Despe, O.D.; Saunders, C.; McGhee, D.G.

    1993-01-01

    The Advanced Photon Source (APS) accelerator facility is made up of five major subsystems in addition to the linac: the positron accumulator ring (PAR), low energy transport (LET), booster synchrotron (SYNCH), high energy transport (HET), the storage ring (SR). Each subsystem has multiple magnet power supply combinations, some requiring multiple of operation. These magnet and power supply combinations computer controlled and monitored. The power supply control unit (PSCU) is the first layer of hardware and software above the power supply itself and is described in this paper. The description includes the basic philosophy for each of operation and how it influences the topology and of implementing control. The design of the analog reference blocks (ARBs) influenced the design of other custom functions well as the feedback controls for vibration and other dynamic corrections. The command set supported by the PSCU is discussed

  17. AP1000 - the new standard for nuclear power

    International Nuclear Information System (INIS)

    Lipman, Daniel S.

    2006-01-01

    /modularization The AP1000 is explicitly designed for modular construction. While modularization techniques can be applied to some extent to most designs, in order to realize maximum benefits the plant must be designed for modular construction from the very beginning. This approach offers significant benefits for sequencing and durations of construction activities. The AP1000 design incorporates structural modules, mechanical modules and piping modules. The benefits of modularization include reduced construction schedule, reduced field manpower, increased factory work, and reduced site construction. The AP1000 has a site construction duration of 36 months from first concrete to fuel loading. Reductions in equipment and bulk quantities allow AP1000's construction costs to be among the most competitive. Safety: As measured by the Probabilistic Safety Assessment, the AP1000 is designed to be more than 100 times safer than already safe operating nuclear plants--harnessing natural forces such as gravity, convection and condensation to maintain a passive safety system that kicks in automatically. This reduces the burden on the operator and greatly reduces the potential for human error. Other advantages to the passive safety system include: no reliance on AC power, an increase in containment reliability, and large margin to safety limits. (author)

  18. Mucopolysaccharidosis: radiographic findings in a series of 16 cases.

    Science.gov (United States)

    de Santana Sarmento, Dmitry José; de Carvalho, Sérgio Henrique Gonçalves; Melo, Saulo Leonardo Sousa; Fonseca, Fátima Roneiva Alves; Diniz, Denise Nóbrega; Bento, Patrícia Meira; Mesquita, Germana de Queiroz Tavares Borges; de Melo, Daniela Pita

    2015-12-01

    To investigate the radiographic findings of mucopolysaccharidoses (MPS) on panoramic radiographs in a series of 16 patients. This retrospective cross-sectional study included panoramic radiographs of 16 patients with cytogenetically diagnosed MPS. Two blinded, previously calibrated observers evaluate the presence or absence of the following features: type of dentition; stage of dental age in comparison with chronologic age; delayed exfoliation of deciduous teeth; supernumerary teeth; teeth impaction; enlarged, cyst-like dental crypt; hypercementosis; taurodontism; generalized enamel hypoplasia; enlargement of the bone marrow spaces; thinning of cortical bone; unusual morphology of condyles; and flattening of the condylar head. The final sample was composed of 8 MPS IV, 7 MPS VI, and 1 MPS I cases. All patients presented unusual morphology of condyles. Cyst-like dental crypt (75%), taurodontism, and teeth impaction (68.75% each) were also overall common findings. Generalized enamel hypoplasia was exclusively identified in patients with MPS IV (75% of those patients). Radiographic features of oral and maxillofacial manifestations in patients with MPS frequently encountered by dentists may help recognize the disorder. However, because of sample size limitations, it was not possible to infer any statistical relationship between the radiographic features and the types of MPS. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. ION EFFECTS IN THE APS PARTICLE ACCUMULATOR RING

    Energy Technology Data Exchange (ETDEWEB)

    Calvey, J.; Harkay, K.; Yao, CY.

    2017-06-25

    Trapped ions in the APS Particle Accumulator Ring (PAR) lead to a positive coherent tune shift in both planes, which increases along the PAR cycle as more ions accumulate. This effect has been studied using an ion simulation code developed at SLAC. After modifying the code to include a realistic vacuum profile, multiple ionization, and the effect of shaking the beam to measure the tune, the simulation agrees well with our measurements. This code has also been used to evaluate the possibility of ion instabilities at the high bunch charge needed for the APS-Upgrade.

  20. Accuracy of dental radiographs for caries detection.

    Science.gov (United States)

    Keenan, James R; Keenan, Analia Veitz

    2016-06-01

    Data sourcesMedline, Embase, Cochrane Central and grey literature, complemented by cross-referencing from bibliographies. Diagnostic reviews were searched using the Medion database.Study selectionStudies reporting on the accuracy (sensitivity/specificity) of radiographic detection of primary carious lesions under clinical (in vivo) or in vitro conditions were included. The outcome of interest was caries detection using radiographs. The study also assessed the effect of the histologic lesion stage and included articles to assess the differences between primary or permanent teeth, if there had been improvements recently due to technical advances or radiographic methods, or if there are variations within studies (between examiners or applied radiographic techniques).Data extraction and synthesisData extraction was done by one reviewer first, using a piloted electronic spreadsheet and repeated independently by a second reviewer. Consensus was achieved by discussion. Data extraction followed guidelines from the Cochrane Collaboration. Risk of bias was assessed using QUADAS-2. Pooled sensitivity, specificity and diagnostic odds ratios (DORs) were calculated using random effects meta-analysis. Analyses were performed separately for occlusal and proximal lesions. Dentine lesions and cavitated lesions were analysed separately.Results947 articles were identified with the searches and 442 were analysed full text. 117 studies (13,375 teeth, 19,108 surfaces) were included. All studies were published in English. 24 studies were in vivo and 93 studies were in vitro. Risk of bias was found to be low in 23 and high in 94 studies. The pooled sensitivity for detecting any kind of occlusal carious lesions was 0.35 (95% CI : 0.31/40) and 0.41 (0.39/0.44) in clinical and in vitro studies respectively while the pooled specificity was 0.78 (0.73/0.83) and 0.70 (0.76/0.84). For the detection of any kind of proximal lesion the sensitivity in the clinical studies was 0.24 (CI 0.21/0/26) and

  1. Radiographic findings of femoroacetabular impingement in National Football League Combine athletes undergoing radiographs for previous hip or groin pain.

    Science.gov (United States)

    Nepple, Jeffrey J; Brophy, Robert H; Matava, Matthew J; Wright, Rick W; Clohisy, John C

    2012-10-01

    The purpose of this study was to investigate the prevalence of radiographic findings of femoroacetabular impingement (FAI) in elite football players with a history of hip pain or groin injury who underwent radiographs. We performed a retrospective review of athletes undergoing hip radiography at the National Football League Combine from 2007 to 2009. Radiographs were obtained in athletes with a history of hip pain or injury. Anteroposterior pelvis and frog-lateral radiographs were obtained in 123 hips (107 players) that met our inclusion criteria. Radiographic indicators of cam-type FAI (alpha angle, head-neck offset ratio) and pincer-type FAI (acetabular retroversion, center-edge angle, acetabular inclination) were recorded. Findings were correlated with clinical factors (previous groin/hip pain, position, race, and body mass index). The most common previous injuries included groin strain (n = 57) and sports hernia/abdominal strain (n = 21). Markers of cam- and/or pincer-type FAI were present in 94.3% of hips (116 of 123). Radiographic evidence of combined cam- and pincer-type FAI was the most common (61.8%, 76 hips), whereas isolated cam-type FAI (9.8%, 12 hips) and pincer-type FAI (22.8%, 28 hips) were less common. The most common deformities included acetabular retroversion (71.5%) and an abnormal alpha angle (61.8%). A body mass index greater than 35 was associated with the presence of global overcoverage (46.2% v 17.3%, P = .025). Radiographic indicators of FAI are very common among athletes evaluated at the National Football League Scouting Combine subjected to radiographic examination for the clinical suspicion of hip disease. Elite football athletes with significant or recurrent pain about the hip should be evaluated clinically and radiographically for FAI, because pain from FAI may be falsely attributed to or may be present in addition to other disorders. Level IV, therapeutic case series. Copyright © 2012 Arthroscopy Association of North America

  2. AP-2β is a transcriptional regulator for determination of digit length in tetrapods.

    Science.gov (United States)

    Seki, Ryohei; Kitajima, Keiichi; Matsubara, Haruka; Suzuki, Takayuki; Saito, Daisuke; Yokoyama, Hitoshi; Tamura, Koji

    2015-11-01

    The species-specific morphology of digits in the tetrapod limb, including the length and number of metacarpal, metatarsal, and phalangeal bones, suggests that a common developmental mechanism for digit formation is modified in a species-specific manner. Here, we examined the function of the AP-2β transcription factor in regulating digit length in the chicken autopod. Mutations in the gene encoding AP-2β are associated with Char syndrome, a human autosomal dominant disorder. Char syndrome patients exhibit autopod skeletal defects, including loss of phalanges and shortened fingers, suggestive of a function for AP-2β in normal digit development. The ectopic expression of two different dominant-negative forms of chick AP-2β, equivalent to mutant forms associated with human Char syndrome, in the developing chick hindlimb bud resulted in defective digit formation, including reductions in the number and length of phalanges and metatarsals. A detailed analysis of the AP-2β expression pattern in the limb bud indicated a correlation between the pattern/duration of AP-2β expression in the limb mesenchyme and digit length in three amniote species, the chicken, mouse and gecko. In addition, we found that AP-2β expression was downstream of Fgf signals from the apical ectodermal ridge, which is crucial in digit morphogenesis, and that excessive AP-2β function resulted in dysregulated digit length. Taken together, these results suggest that AP-2β functions as a novel transcriptional regulator for digit morphogenesis. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Subglottic cysts and asymmetrical subglottic narrowing on neck radiograph

    International Nuclear Information System (INIS)

    Holinger, L.D.; Torium, D.M.; Anandappa, E.C.

    1988-01-01

    The congenital subglottic hemangioma typically appears as an asymmetric subglottic narrowing or mass on frontal neck radiograph. Therefore, soft tissue neck radiography has been advocated as a definitive non-operative approach for diagnosing these lesions. However, we have noted similar asymmetric subglottic narrowing in patients with acquired subglottic cysts. These retention cysts occur following long-term intubation in the neonate. The mechanism probably involves subglottic fibrosis which obstructs glands with subsequent cyst formation. Acquired subglottic cysts typically appear as an asymmetric narrowing on frontal or lateral soft tissue neck radiographs. These lesions may produce airway compromise but are effectively treated by forceps or laser removal. Acquired subglottic cysts must be included in the differential diagnosis of asymmetric subglottic narrowing. The definitive diagnosis is made by direct laryngoscopy, not soft tissue neck radiograph. (orig.)

  4. Defects quantization in industrial radiographs by image processing

    International Nuclear Information System (INIS)

    Briand, F.Y.; Brillault, B.; Philipp, S.

    1988-01-01

    This paper refers to the industrial application of image processing using Non Destructive Testing by radiography. The various problems involved by the conception of a numerical tool are described. This tool intends to help radiograph experts to quantify defects and to follow up their evolution, using numerical techniques. The sequences of processings that achieve defect segmentation and quantization are detailed. They are based on the thorough knowledge of radiographs formation techniques. The process uses various methods of image analysis, including textural analysis and morphological mathematics. The interface between the final product and users will occur in an explicit language, using the terms of radiographic expertise without showing any processing details. The problem is thoroughly described: image formation, digitization, processings fitted to flaw morphology and finally product structure in progress. 12 refs [fr

  5. Radiographic imaging for Ilizarov limb lengthening in children

    International Nuclear Information System (INIS)

    Blane, C.E.; DiPietro, M.A.; Herzenberg, J.E.

    1991-01-01

    The Ilizarov method for limb lengthening is rapidly gaining popularity in North America. Use of this new technique has necessitated modifications in radiographic protocol. Initial imaging problems gained from our experience with twenty children are detailed including accurate centering for the plain films, correcting for magnification to accurately measure the distraction gap and the expected radiographic appearance of the regenerate bone. Ultrasonography has potential value in accurately measuring the distraction gap and in imaging the new bone prior to radiographic appearance. Since overly fast distraction inhibits bone formation and overly slow distraction leads to premature consolidation, ultrasound may serve a useful role in the qualitative evaluation of new bone formation in Ilizarov limb lengthening, enabling the orthopedic surgeon to tailor the distraction rate to the particular child. (orig.)

  6. Automated Procurement System (APS) revised project management plan (DS-03)

    Science.gov (United States)

    Murphy, Diane R.

    1995-01-01

    The Project Plan is the governing document for the implementation of the Automated Procurement System (APS). It includes a description of the proposed system, describes the work to be done, establishes a schedule of deliverables, and discusses the major standards and procedures to be followed.

  7. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses

    Science.gov (United States)

    Prilliman, Stephen G.

    2014-01-01

    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  8. Clinical history and physical examination skills - A requirement for radiographers?

    International Nuclear Information System (INIS)

    Snaith, Beverly A.; Lancaster, Anne

    2008-01-01

    Radiographer's roles have evolved with their scope broadening over the last 20 years culminating in the development of advanced and consultant posts. Yet one development has not been embraced, despite being inherent in medicine and a common extension of nurse and other allied health professionals' roles, is that of clinical assessment. This article explores the evolving role of the radiographer and discusses whether this should include skills in clinical history taking and physical examination. Issues for education and development will be addressed together with examples of current and potential roles

  9. Pre-procedural scout radiographs are unnecessary for routine pediatric fluoroscopic examinations

    Energy Technology Data Exchange (ETDEWEB)

    Creeden, Sean G.; Rao, Anil G.; Eklund, Meryle J.; Hill, Jeanne G.; Thacker, Paul G. [Medical University of South Carolina, Department of Radiology and Radiological Science, Charleston, SC (United States)

    2017-03-15

    Although practice patterns vary, scout radiographs are often routinely performed with pediatric fluoroscopic studies. However few studies have evaluated their utility in routine pediatric fluoroscopy. To evaluate the value of scout abdomen radiographs in routine barium or water-soluble enema, upper gastrointestinal (GI) series, and voiding cystourethrogram pediatric fluoroscopic procedures. We retrospectively evaluated 723 barium or water-soluble enema, upper GI series, and voiding cystourethrogram fluoroscopic procedures performed at our institution. We assessed patient history and demographics, clinical indication for the examination, prior imaging findings and impressions, scout radiograph findings, additional findings provided by the scout radiograph that were previously unknown, and whether the scout radiograph contributed any findings that significantly changed management. We retrospectively evaluated 723 fluoroscopic studies (368 males and 355 females) in pediatric patients. Of these, 700 (96.8%) had a preliminary scout radiograph. Twenty-three (3.2%) had a same-day radiograph substituted as a scout radiograph. Preliminary scout abdomen radiographs/same-day radiographs showed no new significant findings in 719 (99.4%) studies. New but clinically insignificant findings were seen in 4 (0.6%) studies and included umbilical hernia, inguinal hernia and hip dysplasia. No findings were found on the scout radiographs that would either alter the examination performed or change management with regard to the exam. Pre-procedural scout abdomen radiographs are unnecessary in routine barium and water-soluble enema, upper GI series, and voiding cystourethrogram pediatric fluoroscopic procedures and can be substituted with a spot fluoroscopic last-image hold. (orig.)

  10. The future for the radiographer

    DEFF Research Database (Denmark)

    Mussmann, Bo Redder

    that it is not the patient who must comply with technology, but the other way around. My point is that if reporting radiographers merely focuses on technology then they leave behind the very core of radiography, namely radiography as a caring practice, which would leave care in the hands of less educated personnel. So I....... We believe that it is time that we take responsibility for this important part of radiography and systematically teaching it in the context where it unfolds instead of insinuating that care is learned best elsewhere. I believe and hope that especially the Nordic countries could learn from each other...

  11. Do Routine Radiographs Obtained at Initial Outpatient Postoperative Visit Change Management?

    Science.gov (United States)

    Grenier, Eric; Tennent, Dave; Patzkowski, Jean; Hsu, Joseph; Johnson, Anthony

    Routine postoperative radiographs are commonly obtained at the initial postoperative visit. The purpose of this study was to demonstrate the clinical utility of routine postoperative radiographs and quantify the radiation exposure and cost to the health care system. All orthopaedic surgeries performed during 2007 at a level I trauma center were retrospectively analyzed. Surgical procedures that were likely to require follow-up radiographs were included. Analysis demonstrated 878 procedures with 471 procedures (54%) receiving initial postoperative radiographs. Routine radiographs were performed in 455 (96.6%) procedures with 4/455 (0.879%) resulting in a change in management. Nonroutine radiographs were performed in 16 (3.40%) procedures with 2/16 (12.5%) triggering a change in management. Subjects receiving radiographs at the initial postoperative visit obtained a mean of 2.54 radiographs per procedure with a mean exposure of 0.199 mSv with a median cost of $29.98 per radiographic series in 2013 Medicare reimbursement dollars. (Journal of Surgical Orthopaedic Advances.

  12. NF-κB/AP-1-Targeted Inhibition of Macrophage-Mediated Inflammatory Responses by Depigmenting Compound AP736 Derived from Natural 1,3-Diphenylpropane Skeleton

    Directory of Open Access Journals (Sweden)

    Van Thai Ha

    2014-01-01

    Full Text Available AP736 was identified as an antimelanogenic drug that can be used for the prevention of melasma, freckles, and dark spots in skin by acting as a suppressor of melanin synthesis and tyrosinase expression. Since macrophage-mediated inflammatory responses are critical for skin health, here we investigated the potential anti-inflammatory activity of AP736. The effects of AP736 on various inflammatory events such as nitric oxide (NO/prostaglandin (PG E2 production, inflammatory gene expression, phagocytic uptake, and morphological changes were examined in RAW264.7 cells. AP736 was found to strongly inhibit the production of both NO and PGE2 in lipopolysaccharide- (LPS- treated RAW264.7 cells. In addition, AP736 strongly inhibited both LPS-induced morphological changes and FITC-dextran-induced phagocytic uptake. Furthermore, AP736 also downregulated the expression of multiple inflammatory genes, such as inducible NO synthase (iNOS, cyclooxygenase- (COX- 2, and interleukin- (IL- 1β in LPS-treated RAW264.7 cells. Transcription factor analysis, including upstream signalling events, revealed that both NF-κB and AP-1 were targeted by AP736 via inhibition of the IKK/IκBα and IRAK1/TAK1 pathways. Therefore, our results strongly suggest that AP736 is a potential anti-inflammatory drug due to its suppression of NF-κB-IKK/IκBα and AP-1-IRAK1/TAK1 signalling, which may make AP736 useful for the treatment of macrophage-mediated skin inflammation.

  13. Sagittal plane mal-alignment in lumbar spinal radiographs in a ...

    African Journals Online (AJOL)

    Background: Plane radiograph of the spine is still the primary or first line investigation in patients with a variety of symptoms including back pain in a resource limited setting like ours. Methods: A crosssectional study of radiographs of patients who were referred to Radiology Department of Jos University Teaching Hospital for ...

  14. Advanced APS Impacts on Vehicle Payloads

    Science.gov (United States)

    Schneider, Steven J.; Reed, Brian D.

    1989-01-01

    Advanced auxiliary propulsion system (APS) technology has the potential to both, increase the payload capability of earth-to-orbit (ETO) vehicles by reducing APS propellant mass, and simplify ground operations and logistics by reducing the number of fluids on the vehicle and eliminating toxic, corrosive propellants. The impact of integrated cryogenic APS on vehicle payloads is addressed. In this system, launch propulsion system residuals are scavenged from integral launch propulsion tanks for use in the APS. Sufficient propellant is preloaded into the APS to return to earth with margin and noncomplete scavenging assumed. No propellant conditioning is required by the APS, but ambient heat soak is accommodated. High temperature rocket materials enable the use of the unconditioned hydrogen/oxygen in the APS and are estimated to give APS rockets specific impulse of up to about 444 sec. The payload benefits are quantified and compared with an uprated monomethyl hydrazine/nitrogen tetroxide system in a conservative fashion, by assuming a 25.5 percent weight growth for the hydrogen/oxygen system and a 0 percent weight growth for the uprated system. The combination and scavenging and high performance gives payload impacts which are highly mission specific. A payload benefit of 861 kg (1898 lbm) was estimated for a Space Station Freedom rendezvous mission and 2099 kg (4626 lbm) for a sortie mission, with payload impacts varying with the amount of launch propulsion residual propellants. Missions without liquid propellant scavenging were estimated to have payload penalties, however, operational benefits were still possible.

  15. Coaching Strategies for AP: Building a Successful AP European History Program

    Science.gov (United States)

    Fornaciari, Jim

    2014-01-01

    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's Advanced…

  16. routine radiographic findings in clinically healthy edentulous jaw ...

    African Journals Online (AJOL)

    2012-08-08

    Aug 8, 2012 ... intensifying screen. The films were processed using a. Durr XR-24 Nova automatic processor, (Durr Dental,. Germany). The records of all the patients including those who never had radiographs were examined to confirm that at presentation, the denture bearing tissues did not have evidence of a significant ...

  17. Assessment of the radioanatomic positioning of the osteoarthritic knee in serial radiographs: comparison of three acquisition techniques.

    Science.gov (United States)

    Le Graverand, M-P H; Mazzuca, S; Lassere, M; Guermazi, A; Pickering, E; Brandt, K; Peterfy, C; Cline, G; Nevitt, M; Woodworth, T; Conaghan, P; Vignon, E

    2006-01-01

    Recent studies using various standardized radiographic acquisition techniques have demonstrated the necessity of reproducible radioanatomic alignment of the knee to assure precise measurements of medial tibiofemoral joint space width (JSW). The objective of the present study was to characterize the longitudinal performance of several acquisition techniques with respect to long-term reproducibility of positioning of the knee, and the impact of changes in positioning on the rate and variability of joint space narrowing (JSN). Eighty subjects were randomly selected from each of three cohorts followed in recent studies of the radiographic progression of knee osteoarthritis (OA): the Health ABC study (paired fixed-flexion [FF] radiographs taken at a 36-month interval); the Glucosamine Arthritis Intervention Trial (GAIT) (paired metatarsophalangeal [MTP] radiographs obtained at a 12-month interval), and a randomized clinical trial of doxycycline (fluoroscopically assisted semiflexed anteroposterior (AP) radiographs taken at a 16-month interval). Manual measurements were obtained from each radiograph to represent markers of radioanatomic positioning of the knee (alignment of the medial tibial plateau and X-ray beam, knee rotation, femorotibial angle) and to evaluate minimum JSW (mJSW) in the medial tibiofemoral compartment. The effects on the mean annualized rate of JSN and on the variability of that rate of highly reproduced vs variable positioning of the knee in serial radiographs were evaluated. Parallel or near-parallel alignment was achieved significantly more frequently with the fluoroscopically guided positioning used in the semiflexed AP protocol than with either the non-fluoroscopic FF or MTP protocol (68% vs 14% for both FF and MTP protocols when measured at the midpoint of the medial compartment; 75% vs 26% and 34% for the FF and MTP protocols, respectively, when measured at the site of mJSW; Pradiographs than in FF radiographs (66% vs 45%, Ptechnique yielded a

  18. Validation of a new radiographic measurement of acetabular version: the transverse axis distance (TAD)

    Energy Technology Data Exchange (ETDEWEB)

    Nitschke, Ashley [University of Colorado School of Medicine, University of Colorado Denver, Division of Musculoskeletal Radiology, Department of Radiology, Aurora, CO (United States); Lambert, Jeffery R. [University of Colorado, Department of Biostatistics and Informatics, Colorado School of Public Health, Aurora, CO (United States); Glueck, Deborah H. [University of Colorado, Department of Biostatistics and Informatics, Colorado School of Public Health, Aurora, CO (United States); University of Colorado School of Medicine, University of Colorado Denver, Department of Radiology, Aurora, CO (United States); Jesse, Mary Kristen; Strickland, Colin [University of Colorado School of Medicine, University of Colorado Denver, Division of Musculoskeletal Radiology, Department of Radiology and Orthopaedics, Aurora, CO (United States); Mei-Dan, Omer [University of Colorado School of Medicine, University of Colorado Denver, Division of Sports Medicine and Hip Preservation, Department of Orthopaedics, Aurora, CO (United States); Petersen, Brian [University of Colorado School of Medicine, University of Colorado Denver, Division of Musculoskeletal Radiology, Department of Radiology and Orthopaedics, Aurora, CO (United States); Inland Imaging, Division of Musculoskeletal Radiology, Spokane, WA (United States)

    2015-11-15

    This study has three aims: (1) validate a new radiographic measure of acetabular version, the transverse axis distance (TAD) by showing equivalent TAD accuracy in predicting CT equatorial acetabular version when compared to a previously validated, but more cumbersome, radiographic measure, the p/a ratio; (2) establish predictive equations of CT acetabular version from TAD; (3) calculate a sensitive and specific cut point for predicting excessive CT acetabular anteversion using TAD. A 14-month retrospective review was performed of patients who had undergone a dedicated MSK CT pelvis study and who also had a technically adequate AP pelvis radiograph. Two trained observers measured the radiographic p/a ratio, TAD, and CT acetabular equatorial version for 110 hips on a PACS workstation. Mixed model analysis was used to find prediction equations, and ROC analysis was used to evaluate the diagnostic accuracy of p/a ratio and TAD. CT equatorial acetabular version can accurately be predicted from either p/a ratio (p < 0.001) or TAD (p < 0.001). The diagnostic accuracies of p/a ratio and TAD are comparable (p =0.46). Patients whose TAD is higher than 17 mm may have excessive acetabular anteversion. For that cutpoint, the sensitivity of TAD is 0.73, with specificity of 0.82. TAD is an accurate radiographic predictor of CT acetabular anteversion and provides an easy-to-use and intuitive point-of-care assessment of acetabular version in patients with hip pain. (orig.)

  19. Aviation Safety Program: Weather Accident Prevention (WxAP) Development of WxAP System Architecture And Concepts of Operation

    Science.gov (United States)

    Grantier, David

    2003-01-01

    This paper presents viewgraphs on the development of the Weather Accident Prevention (WxAP) System architecture and Concept of Operation (CONOPS) activities. The topics include: 1) Background Information on System Architecture/CONOPS Activity; 2) Activity Work in Progress; and 3) Anticipated By-Products.

  20. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  1. Gastric tumors on chest radiographs

    International Nuclear Information System (INIS)

    Tamura, Shozo; Kawanami, Takashi; Russell, W.J.

    1978-04-01

    Gastric neoplasms of three patients protruded into their gas-containing fornices and were first visualized on plain chest radiographs. Endoscopy and/or surgery confirmed these to be a polyp, a leiomyoma, and an adenocarcinoma. The polyp, 1.3 cm in diameter, was the smallest of these three, but smaller lesions may be detectable under suitable conditions. Adequate technique and positioning, sufficiently large lesions in the upper portion of the stomach, a central beam tangential to the tumor, sufficient gas in the stomach, and careful scrutiny by the observer are required. Lesions may be more readily visualized during chest radiography when oral sodium bicarbonate is used to distend the stomach. In chest radiography, exposure limited to the lung fields has been advocated for economy and dose reduction. However, too small an exposure field may result in loss of information potentially beneficial to the patient. Using the smaller of two popular film sizes (35 x 43 cm and 35 x 35 cm), the saving in surface and bone marrow doses is negligible, and the saving in gonad dose may be nil over that when shielding is used. The interest of the observer may be absorbed by a concomitant cardiac or pulmonary lesion. Careful scrutiny of the entire radiograph is therefore essential. (author)

  2. Digital processing of radiographic images

    Science.gov (United States)

    Bond, A. D.; Ramapriyan, H. K.

    1973-01-01

    Some techniques are presented and the software documentation for the digital enhancement of radiographs. Both image handling and image processing operations are considered. The image handling operations dealt with are: (1) conversion of format of data from packed to unpacked and vice versa; (2) automatic extraction of image data arrays; (3) transposition and 90 deg rotations of large data arrays; (4) translation of data arrays for registration; and (5) reduction of the dimensions of data arrays by integral factors. Both the frequency and the spatial domain approaches are presented for the design and implementation of the image processing operation. It is shown that spatial domain recursive implementation of filters is much faster than nonrecursive implementations using fast fourier transforms (FFT) for the cases of interest in this work. The recursive implementation of a class of matched filters for enhancing image signal to noise ratio is described. Test patterns are used to illustrate the filtering operations. The application of the techniques to radiographic images of metallic structures is demonstrated through several examples.

  3. Prognostic radiographic aspects of spondylolisthesis

    Energy Technology Data Exchange (ETDEWEB)

    Saraste, H.; Brostroem, L.A.; Aparisi, T.

    1984-01-01

    A series of 202 patients (133 men, 69 women) with lumbar spondylolysis were examined radiographically on two occasions, first at the time of diagnosis and later at a follow-up, after an observation period of 20 years or more. The films from patients in groups without and with moderate and severe olisthesis were evaluated with respect to variables describing lumbosacral lordosis, wedging of the spondylolytic vertebra, lengths of the transverse processes and iliolumbar ligaments, disk height, progression of slipping, and influence on measured olisthesis of lumbar spine flexion and extension at the radiographic examination. The evaluation was made with special attention to possible signs which could be predictive for the prognosis of vertebral slipping. Progression of slipping did not differ between patients diagnosed as adults or adolescents. Reduction of disk height was correlated to the degree of slipping present at the initial examination and to the progression of olisthesis. Flexion and extension of the lumbar spine did not modify the degree of olisthesis. Data concerning the lengths of the transverse processes and the iliolumbar ligaments, and lumbar lordosis, cannot be used for prognostic purposes. The lumbar index reflecting the degree of wedge deformity of the spondylolytic vertebra was shown to be the only variable of prognostic value for the development of vertebral slipping.

  4. Prognostic radiographic aspects of spondylolisthesis

    International Nuclear Information System (INIS)

    Saraste, H.; Brostroem, L.A.; Aparisi, T.

    1984-01-01

    A series of 202 patients (133 men, 69 women) with lumbar spondylolysis were examined radiographically on two occasions, first at the time of diagnosis and later at a follow-up, after an observation period of 20 years or more. The films frompatients in groups without and with moderate and severe olisthesis were evaluated with respect to variables describing lumbosacral lordosis, wedging of the spondylolytic vertebra, lengths of the transverse processes and iliolumbar ligaments, disk height, progression of slipping, and influence on measured olisthesis of lumbar spine flexion and extension at the radiographic examination. The evaluation was made with special attention to possible signs which could be predictive for the prognosis of vertebral slipping. Progression of slipping did not differ between patients diagnosed as adults or adolescents. Reduction of disk height was correlated to the degree of slipping present at the initial examination and to the progression of olisthesis. Flexion and extension of the lumbar spine did not modify the degree of olisthesis. Data concerning the lengths of the transverse processes and the iliolumbar ligaments, and lumbar lordosis, cannot be used for prognostic purposes. The lumbar index reflecting the degree of wedge deformity of the spondylolytic vertebra was shown to be the only variable of prognostic value for the development of vertebral slipping. (orig.)

  5. A radiographic analysis of implant component misfit.

    LENUS (Irish Health Repository)

    Sharkey, Seamus

    2011-07-01

    Radiographs are commonly used to assess the fit of implant components, but there is no clear agreement on the amount of misfit that can be detected by this method. This study investigated the effect of gap size and the relative angle at which a radiograph was taken on the detection of component misfit. Different types of implant connections (internal or external) and radiographic modalities (film or digital) were assessed.

  6. Radiation protection - radiographer's role and responsibilities

    International Nuclear Information System (INIS)

    Popli, P.K.

    2002-01-01

    Ever since discovery of x-rays, radiographers has been the prime user of radiation. With the passage of time, the harmful effects of radiation were detected. Some of radiographers, radiologists and public were affected by radiation, but today with enough knowledge of radiation, the prime responsibility of radiation protection lies with the radiographers only. The radiologist and physicist are also associated with radiation protection to some extent

  7. Measure by image analysis of industrial radiographs

    International Nuclear Information System (INIS)

    Brillault, B.

    1988-01-01

    A digital radiographic picture processing system for non destructive testing intends to provide the expert with computer tool, to precisely quantify radiographic images. The author describes the main problems, from the image formation to its characterization. She also insists on the necessity to define a precise process in order to automatize the system. Some examples illustrate the efficiency of digital processing for radiographic images [fr

  8. Early radiographic changes in radiation bone injury

    Energy Technology Data Exchange (ETDEWEB)

    Fujita, M.; Tanimoto, K.; Wada, T.

    1986-06-01

    A chronologic series of periapical radiographs was evaluated for the purpose of detecting damage to bone and tooth-supporting tissues in a patient receiving radiation therapy for a basal cell carcinoma of the mandibular gingiva. Widening of the periodontal space was one of the early radiographic changes observed. It is suggested, from the sequence of radiographic changes, that radiation-induced changed in the circulatory system of the bone might be primarily responsible for the resulting changes.

  9. Early radiographic changes in radiation bone injury

    International Nuclear Information System (INIS)

    Fujita, M.; Tanimoto, K.; Wada, T.

    1986-01-01

    A chronologic series of periapical radiographs was evaluated for the purpose of detecting damage to bone and tooth-supporting tissues in a patient receiving radiation therapy for a basal cell carcinoma of the mandibular gingiva. Widening of the periodontal space was one of the early radiographic changes observed. It is suggested, from the sequence of radiographic changes, that radiation-induced changed in the circulatory system of the bone might be primarily responsible for the resulting changes

  10. Reliability of the radiographic union scale in tibial fractures (RUST

    Directory of Open Access Journals (Sweden)

    Fernando Antonio Silva de Azevedo Filho

    Full Text Available ABSTRACT OBJECTIVE: This study aimed to evaluate the inter- and intra observer reproducibility of the radiographic score of consolidation of the tibia shaft fractures. METHODS: Fifty-one sets of radiographs in anteroposterior (AP and profile (P of the tibial shaft treated with intramedullary nail were obtained. The analysis of X-rays was performed in two stages, with a 21-day interval between assessments by a group of nine evaluators. To evaluate the reproducibility of RUST score between the evaluators, the intra-class correlation coefficient (ICC with a 95% confidence interval was used. ICC values range from +1, representing perfect agreement, to -1, complete disagreement. RESULTS: There was a significant correlation among all evaluators: ICC = 0.87 (95% CI 0.81 to 0.91. The intraobserver agreement proved to be substantial with ICC = 0.88 (95% CI 0.85 to 0.91 . CONCLUSION: This study confirms that the RUST scale shows a high degree of reliability and agreement.

  11. Inferior alveolar canal course: a radiographic study.

    Science.gov (United States)

    Liu, Tie; Xia, Bing; Gu, Zhiyuan

    2009-11-01

    To describe the morphology and course of the inferior alveolar canal (IAC) as it appears in digital panoramic radiographs. Three hundred and eighty-six digital rotational panoramic radiographs (OPG) were studied using the Clinview Software (6.1.3.7 version, Instrumentarium). Among the 386 radiographs, 86 radiographs with 5-mm steel balls were used to calculate the magnification. The average magnification of radiographs in this study was 7.24+/-7.55%. The course of IAC as seen in the panoramic radiograph may be classified into four types: (1) linear curve, 12.75%, (2) spoon-shaped curve, 29.25%, (3) elliptic-arc curve, 48.5%, and (4) turning curve, 9.5%. On panoramic radiographs, the IAC appeared closest to the inferior border of the mandible in the region of the first molar. In relation to the teeth, on panoramic radiographs, the IAC appeared closest to the distal root tip of the third molar and furthest from the mesial root tip of the first molar. In the OPG, there are four types of IAC: linear, spoon shape, elliptic-arc, and turning curve. The data found in the study may be useful for dental implant, mandibule surgery, and dental anesthesia. The limitations of the panoramic radiograph in depicting the true three-dimensional (3D) morphology of the IAC are recognized, computed tomography (CT) and cone beam (CB)3D imaging being more precise.

  12. Diagnostic performance of bilateral false profile radiographs in early hip osteoarthritis.

    Science.gov (United States)

    Laredo, Jean-Denis; Wyler, Annabelle; Alvarez, Cécile; Aout, Mounir; Lequesne, Michel; Vicaut, Eric

    2018-01-01

    1. To show that the anterior hip joint space is profiled only on the contralateral false profile radiograph. 2. To provide normal values of hip joint space width on anteroposterior and false profile radiographs. 3. To identify the best sites for joint space radiographic measurements to depict early hip osteoarthritis. Anteroposterior and bilateral false profile radiographs of a cadaveric pelvis with markers around the anterior part of the hip joint were obtained. Joint space width was measured at ten sites on anteroposterior pelvis and bilateral hip false profile radiographs in 37 patients without hip pain (mean age, 59 years) and 65 patients with hip pain (mean age, 57.5 years), including 30 with and 35 without radiographic osteoarthritic subchondral bone changes. Between-groups differences in joint space width at each site were evaluated using ANOVA. The ability of joint space width at each site to discriminate between patients groups was investigated using logistic regression. The anterior joint space was only profiled on a contralateral false profile radiograph. Presumably, normal joint space widths were obtained in the group without hip pain. Joint space widths measured on the false profile radiographs differed significantly between the patient groups while measurements on the anteroposterior pelvis radiograph did not. Bilateral false profile radiographs profile the entire hip joint space, including its anterior part, and discriminate better between patients with and without hip pain than the anteroposterior pelvis radiograph. The AS/P joint space width ratio (anterosuperior/posterior) was the best parameter. Copyright © 2016. Published by Elsevier SAS.

  13. Radiographers as doctors: A profile of UK doctoral achievement

    International Nuclear Information System (INIS)

    Snaith, B.; Harris, M.A.; Harris, R.

    2016-01-01

    Introduction: Radiography aspires to be a research active profession, but there is limited information regarding the number of individuals with, or studying for, a doctoral award. This study aims to profile UK doctoral radiographers; including their chosen award, approach and employment status. Method: This was a prospective cohort study utilising an electronic survey. No formal database of doctoral radiographers existed therefore a snowball sampling method was adopted. The study sample was radiographers (diagnostic and therapeutic) based in the UK who were registered with the Health and Care Professions Council (HCPC) and who held, or were studying for, a doctoral award. Results: A total of 90 unique responses were received within the timescale. The respondents comprised 58 females (64.4%) and the majority were diagnostic radiographers (n = 71/90; 78.9%). The traditional PhD was the most common award, although increasing numbers were pursuing Education or Professional Doctorates. An overall increase in doctoral studies is observed over time, but was greatest amongst those working in academic institutions, with 63.3% of respondents (n = 57/90) working solely within a university, and a further 10% employed in a clinical–academic role (n = 9/90). Conclusion: This study has demonstrated that radiography is emerging as a research active profession, with increasing numbers of radiographers engaged in study at a doctoral level. This should provide a platform for the future development of academic and clinical research. - Highlights: • 90 radiographers were identified as holding, or studying for, a doctoral award. • The PhD is the most common award. • EdD and professional doctorates are increasing in popularity. • Academic staff were more likely to pursue such research training.

  14. The prevalence of radiographic hip abnormalities in elite soccer players.

    Science.gov (United States)

    Gerhardt, Michael B; Romero, Alex A; Silvers, Holly Jacinda; Harris, David J; Watanabe, Diane; Mandelbaum, Bert R

    2012-03-01

    Hip injuries, both intra- and extra-articular, are becoming a more commonly recognized, diagnosed, and treated injury in athletes of all competitive levels. Our goal is to establish a previously undefined value in this athletic population--the prevalence of radiographic hip abnormalities in elite soccer athletes. To provide a foundation for the future body of literature regarding hip pathologic abnormalities and "at-risk" hips in athletes of all ages and levels of participation. Descriptive epidemiology study. We retrospectively reviewed the anteroposterior pelvis and frog-leg lateral radiographs of 95 elite male and female soccer players to determine the prevalence of hip abnormalities. Athletes with a history of hip or groin injuries were included. Multiple radiographic parameters were used to assess the presence of cam and pincer-type femoroacetabular impingement. Measurements were conducted by a blinded, sports medicine fellowship-trained orthopaedic surgeon with experience in treating hip disorders. In total, 72% (54/75) of male and 50% (10/20) of female players demonstrated some evidence of radiographic hip abnormality. Cam lesions were present in 68% (51/75) of men (76.5% [39/51] bilateral involvement) and 50% (10/20) of women (90% [9/10] bilateral involvement). Pincer lesions were present in 26.7% (20/75) of men and 10% (2/20) of women. The average male alpha angle overall was 65.6°. Cam-positive hips averaged 70.7°. The average female alpha angle overall was 52.9°, with cam-positive hips averaging 60.8°. The prevalence of radiographic hip abnormalities in elite soccer athletes is considerable, particularly in young male athletes. The establishment of the prevalence of these findings represents the first step in identifying the relationship between radiographic abnormalities and injuries of the hip and groin in athletes.

  15. APS: 125 Years of Progress of Physiology as a Scientific Discipline and a Profession

    Science.gov (United States)

    Carroll, Robert G.; Frank, Martin; Ra'anan, Alice; Matyas, Marsha L.

    2013-01-01

    The Experimental Biology 2012 meeting in San Diego, CA, included events to celebrate the 125th anniversary of the founding of the American Physiological Society (APS) and reflect on the recent accomplishments of the society. Most of the APS activities in the past quarter century were guided by a series of strategic plans. Membership in the APS…

  16. Dosimetry for Patients undergoing Radiographic Examinations in Sudan

    International Nuclear Information System (INIS)

    Halato, M.A.; Kafi, S.T.; Ahmed, A.M.; Sid Ahamed, F.A.; Ibrahim, Z.; Suliman, M.F.; Suliman, I.I.

    2009-01-01

    In this study we estimated the entrance skin doses ESDs for patients undergoing selected diagnostic X -ray examinations in two large public hospitals in Khartoum state, Sudan. The study included the examinations of the chest posterior-anterior (PA) , skull antero-posterior (AP), skull Lateral (LAT) , Lumber spine AP/LAT, abdomen Intravenous urogram (IVU) and Pelvis AP. Totally, 241 patients were included in this study. ESDs were estimated from patients specific exposure parameters using established relation between output (μ Gy/mAs) and tube voltage (kVp). The estimated ESDs ranged from 0.18 - 1.05 mGy for chest PA, 0.98 - 3.48 mGy for Skull (AP), 0.66 - 2.75 mGy for skull (LAT), 1.22 - 4.35 mGy for abdomen (IVU), 1.18 - 5.75 mGy for Pelvis, 1.52 - 5.01 mGy Lumbar spine AP and 2.48 - 10.41 mGy for Lumbar spine (LAT). These values compare well with the international reference dose levels. This study provides additional data that can help the regulatory authority to establish reference dose level for diagnostic radiology in Sudan

  17. Radiographer perceptions of managerial transformational leadership levels.

    Science.gov (United States)

    Legg, Jeffrey S; Akroyd, Duane; Jackowski, Melissa B

    2010-01-01

    Transformational leadership focuses on the ability of a leader to impact employees by inspiring employees to broaden interests in work as well as to be innovative and creative. It is positively associated with employee satisfaction and commitment to the organization. Characteristics of transformational leaders include confidence, ability to mange and deal with complexity, and belief in their employees and organizations. Considering the importance of leadership skills in radiology departments, this paper addresses directly the empirical evidence concerning radiographer's perception of their radiology managers and supervisors transformational leadership levels in the United States. Leadership can be taught, and we as a profession must begin to implement leadership training programs for our current and future leaders.

  18. Veratramine modulates AP-1-dependent gene transcription by directly binding to programmable DNA.

    Science.gov (United States)

    Bai, Fang; Liu, Kangdong; Li, Huiliang; Wang, Jiawei; Zhu, Junsheng; Hao, Pei; Zhu, Lili; Zhang, Shoude; Shan, Lei; Ma, Weiya; Bode, Ann M; Zhang, Weidong; Li, Honglin; Dong, Zigang

    2018-01-25

    Because the transcription factor activator protein-1 (AP-1) regulates a variety of protein-encoding genes, it is a participant in many cellular functions, including proliferation, transformation, epithelial mesenchymal transition (EMT), and apoptosis. Inhibitors targeting AP-1 have potential use in the treatment of cancer and other inflammatory diseases. Here, we identify veratramine as a potent natural modulator of AP-1, which selectively binds to a specific site (TRE 5'-TGACTCA-3') of the AP-1 target DNA sequence and regulates AP-1-dependent gene transcription without interfering with cystosolic signaling cascades that might lead to AP-1 activation. Moreover, RNA-seq experiments demonstrate that veratramine does not act on the Hedgehog signaling pathway in contrast to its analogue, cyclopamine, and likely does not harbor the same teratogenicity and toxicity. Additionally, veratramine effectively suppresses EGF-induced AP-1 transactivation and transformation of JB6 P+ cells. Finally, we demonstrate that veratramine inhibits solar-ultraviolet-induced AP-1 activation in mice. The identification of veratramine and new findings in its specific regulation of AP-1 down stream genes pave ways to discovering and designing regulators to regulate transcription factor. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

  19. CREB inhibits AP-2alpha expression to regulate the malignant phenotype of melanoma.

    Directory of Open Access Journals (Sweden)

    Vladislava O Melnikova

    2010-08-01

    Full Text Available The loss of AP-2alpha and increased activity of cAMP-responsive element binding (CREB protein are two hallmarks of malignant progression of cutaneous melanoma. However, the molecular mechanism responsible for the loss of AP-2alpha during melanoma progression remains unknown.Herein, we demonstrate that both inhibition of PKA-dependent CREB phosphorylation, as well as silencing of CREB expression by shRNA, restored AP-2alpha protein expression in two metastatic melanoma cell lines. Moreover, rescue of CREB expression in CREB-silenced cell lines downregulates expression of AP-2alpha. Loss of AP-2alpha expression in metastatic melanoma occurs via a dual mechanism involving binding of CREB to the AP-2alpha promoter and CREB-induced overexpression of another oncogenic transcription factor, E2F-1. Upregulation of AP-2alpha expression following CREB silencing increases endogenous p21(Waf1 and decreases MCAM/MUC18, both known to be downstream target genes of AP-2alpha involved in melanoma progression.Since AP-2alpha regulates several genes associated with the metastatic potential of melanoma including c-KIT, VEGF, PAR-1, MCAM/MUC18, and p21(Waf1, our data identified CREB as a major regulator of the malignant melanoma phenotype.

  20. AP1000 Containment Design and Safety Assessment

    International Nuclear Information System (INIS)

    Wright, Richard F.; Ofstun, Richard P.; Bachere, Sebastien

    2002-01-01

    The AP1000 is an up-rated version of the AP600 passive plant design that recently received final design certification from the US NRC. Like AP600, the AP1000 is a two-loop, pressurized water reactor featuring passive core cooling and passive containment safety systems. One key safety feature of the AP1000 is the passive containment cooling system which maintains containment integrity in the event of a design basis accident. This system utilizes a high strength, steel containment vessel inside a concrete shield building. In the event of a pipe break inside containment, a high pressure signal actuates valves which allow water to drain from a storage tank atop the shield building. Water is applied to the top of the containment shell, and evaporates, thereby removing heat. An air flow path is formed between the shield building and the containment to aid in the evaporation and is exhausted through a chimney at the top of the shield building. Extensive testing and analysis of this system was performed as part of the AP600 design certification process. The AP1000 containment has been designed to provide increased safety margin despite the increased reactor power. The containment volume was increased to accommodate the larger steam generators, and to provide increased margin for containment pressure response to design basis events. The containment design pressure was increased from AP600 by increasing the shell thickness and by utilizing high strength steel. The passive containment cooling system water capacity has been increased and the water application rate has been scaled to the higher decay heat level. The net result is higher margins to the containment design pressure limit than were calculated for AP600 for all design basis events. (authors)

  1. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  2. Operation of the APS rf gun

    International Nuclear Information System (INIS)

    Lewellen, J. W.

    1998-01-01

    The Advanced Photon Source (APS) has a thermionic-cathode rf gun system capable of providing beam to the APS linac. The gun system consists of a 1.6-cell thermionic-cathode rf gun, a fast kicker for beam current control, and an alpha magnet for bunch compression and injection into the APS linac line. This system is intended for use both as an injector for positron creation, and as a first beam source for the Low-Energy Undulator Test Line (LEUTL) project [1]. The first measured performance characteristics of the gun are presented.

  3. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.

    1999-08-12

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  4. Radiographic techniques for digital mammography

    International Nuclear Information System (INIS)

    Horita, Katsuhei

    2007-01-01

    Since the differences in X-ray absorption between various breast tissues are small, a dedicated X-ray system for examination of the breast and a high-contrast, high-resolution screen/film system (SFM) (light-receiving system) are employed for X-ray diagnosis. Currently, however, there is a strong trend toward digital imaging in the field of general radiography, and this trend is also reflected in the field of mammographic examination. In fact, approximately 70% of facilities purchasing new mammography systems are now selecting a digital mammography system (DRM). Given this situation, this report reviews the differences between SFM and DRM and discusses the radiographic techniques and quality assurance procedures for digital mammography. (author)

  5. Picture chamber for radiographic system

    International Nuclear Information System (INIS)

    1977-01-01

    The picture chamber for a radiographic system is characterised by a base, a first electrode carried in the base, an X-ray irradiation window provided with an outer plate and an inner plate and a conducting surface which serves as a second electrode, which has a plate gripping it at each adjacent edge and which has at the sides a space which is occupied by a filling material, maintained at a steady pressure, by means of the mounting against the base and wherein the inner plate lies against the first electrode and which is provided with a split, and with means for the separation of the split in the area of the inner plate so that a fluid may be retained in the split. (G.C.)

  6. Radiographic study of the odontoma

    Energy Technology Data Exchange (ETDEWEB)

    Ahn, Hyung Kyu [Department of Oral Radiology, College of Dentistry, Seoul National University, Seoul (Korea, Republic of)

    1983-11-15

    The author studied clinically and radiologically 55 cases which had been diagnosed as odontoma in SNUDH. The obtained results were as follows: 1. In sex distribution, there was no prevalence in both sexes. And the incidence was the highest in the 2nd decade (16 patient, 29%). 2. There were 42 cases of compound odontoma (76%) and 13 cases of complex odontoma (24%). In most cases, compound odontoma was located at the anterior portion (34 cases, 81%) and complex odontoma at the posterior portions (9 cases, 69%). 3. There was no apparent clinical symptom in compound odontoma (83%), but in complex odontoma, 80% of cases show swelling. 4. The adjacent root resorption was not observed in any case. 5. Five cases radiographically diagnosed as cystic odontoma were not confirmed histopathologically.

  7. Radiographic study of the odontoma

    International Nuclear Information System (INIS)

    Ahn, Hyung Kyu

    1983-01-01

    The author studied clinically and radiologically 55 cases which had been diagnosed as odontoma in SNUDH. The obtained results were as follows: 1. In sex distribution, there was no prevalence in both sexes. And the incidence was the highest in the 2nd decade (16 patient, 29%). 2. There were 42 cases of compound odontoma (76%) and 13 cases of complex odontoma (24%). In most cases, compound odontoma was located at the anterior portion (34 cases, 81%) and complex odontoma at the posterior portions (9 cases, 69%). 3. There was no apparent clinical symptom in compound odontoma (83%), but in complex odontoma, 80% of cases show swelling. 4. The adjacent root resorption was not observed in any case. 5. Five cases radiographically diagnosed as cystic odontoma were not confirmed histopathologically.

  8. Radiographic evaluation of hallux valgus

    International Nuclear Information System (INIS)

    Richardson, M.L.; Hansen, S.T.; Kilcoyne, R.F.

    1987-01-01

    This paper presents the common preoperative and postoperative findings in hallux valgus, a common foot disorder of multiple etiologies, which can lead to significant foot pain and deformity. Little has been published in radiologic literature about the proper initial radiographic workup and the postoperative follow-up of this very common and very treatable cause of foot pain. Besides the primary findings of varus angulation of the first metatarsal and valgus angulation of the great toe, one may also see dorsal slaying of the first metatarsal head. As increased weight is borne by the central metatarsals, they may develop hyperostosis and stress fractures. Angular deformities of the hallux sesamoid joint and lesser toes may also be seen

  9. Evaluating the periapical status of teeth with irreversible pulpitis by using cone-beam computed tomography scanning and periapical radiographs.

    Science.gov (United States)

    Abella, Francesc; Patel, Shanon; Duran-Sindreu, Fernando; Mercadé, Montse; Bueno, Rufino; Roig, Miguel

    2012-12-01

    The purpose of this study was to compare the prevalence of apical periodontitis (AP) on individual roots of teeth with irreversible pulpitis viewed with periapical (PA) radiographs and cone-beam computed tomography (CBCT) scans. PA radiographs and CBCT scans were taken of 138 teeth in 130 patients diagnosed with irreversible pulpitis (symptomatic and asymptomatic). Two calibrated examiners assessed the presence or absence of AP lesions by analyzing the PA and CBCT images. A consensus was reached in the event of any disagreement. The data were analyzed using the hypothesis test, and significance was set at P ≤ .05. Three hundred seven paired roots were assessed with both PA and CBCT images. A comparison of the 307 paired roots revealed that AP lesions were present in 10 (3.3%) and absent in 297 (96.7%) pairs of roots when assessed with PA radiography. When the same 307 sets of roots were assessed with CBCT scans, AP lesions were present in 42 (13.7%) and absent in 265 (86.3%) paired roots. The prevalence of AP lesions detected with CBCT was significantly higher in the symptomatic group compared with the asymptomatic group (P pulpitis. Copyright © 2012 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  10. Conversion into numerical form of radiographic images

    International Nuclear Information System (INIS)

    Cappabianca, C.; Della Rocca, A.B.; Ferriani, S.

    1986-01-01

    Radiographic means are widely used for non destructive testing. However, human and technological factors strongly influence reliability of the results and further use of these technique. Image Processing can help to overtake those difficulties if radiographic films are previously digitized. This paper shows methods and equipments used in this field. The system EDI (Enea Digital. Imagery) operating in Casaccia Energy Research Centre is described

  11. Radiographic arthrosis after elbow trauma: interobserver reliability.

    NARCIS (Netherlands)

    Lindenhovius, A.; Karanicolas, P.J.; Bhandari, M.; Ring, D.; Kampen, A. van; et al.,

    2012-01-01

    PURPOSE: This study measured observer variation in radiographic rating of elbow arthrosis. METHODS: Thirty-seven independent orthopedic surgeons graded the extent of elbow arthrosis in 20 consecutive sets of plain radiographs, according to the Broberg and Morrey rating system (grade 0, normal joint;

  12. Radiographic Arthrosis After Elbow Trauma: Interobserver Reliability

    NARCIS (Netherlands)

    Lindenhovius, Anneluuk; Karanicolas, Paul Jack; Bhandari, Mohit; Ring, David; Allan, Cristopher; Axelrod, Terry; Baratz, Mark; Beingessner, Daphne; Cassidy, Charles; Coles, Chad; Conflitti, Joe; Rocca, Gregory Della; van Dijk, C. Niek; Elmans, L. H. G. J.; Feibe, Roger; Frihagen, Frede; Gosens, Taco; Greenberg, Jeffrey; Grosso, Elena; Harness, Neil; van der Heide, Huub; Jeray, Kyle; Kalainov, David; van Kampen, Albert; Kawamura, Sumito; Kloen, Peter; McCormac, Bob; McKee, Michael; Page, Richard; Pesantez, Rodrigo; Peters, Anil; Petrisor, Brad; Poolman, Rudolf; Richardson, Martin; Seiler, John; Swiontkowski, Marc; Trumble, Thomas; Wright, Thomas; Zalavras, Charalampos; Zura, Robert

    2012-01-01

    Purpose This study measured observer variation in radiographic rating of elbow arthrosis. Methods Thirty-seven independent orthopedic surgeons graded the extent of elbow arthrosis in 20 consecutive sets of plain radiographs, according to the Broberg and Morrey rating system (grade 0, normal joint;

  13. Equipment for fully automatic radiographic pipe inspection

    International Nuclear Information System (INIS)

    Basler, G.; Sperl, H.; Weinschenk, K.

    1977-01-01

    The patent describes a device for fully automatic radiographic testing of large pipes with longitudinal welds. Furthermore the invention enables automatic marking of films in radiographic inspection with regard to a ticketing of the test piece and of that part of it where testing took place. (RW) [de

  14. Dental Radiographs Ordered by Dental Professionals: an ...

    African Journals Online (AJOL)

    Conclusions: Even in resource limited settings dental caries is still the regular indication for taking dental radiographs, and periapical views are the most frequent type of radiograph ordered. Maxillary central incisors and mandibular molars were types of teeth commonly x-rayed mainly due to the aesthetic importance of the ...

  15. Consultant breast radiographers: Where are we now?

    International Nuclear Information System (INIS)

    Rees, Zebby

    2014-01-01

    Introduction: The aim of this study is to: • Evaluate the current role of the consultant breast radiographer. • Compare current practice with the four key components for consultant practice. • Gauge the support of radiologist colleagues. • Determine the other professional commitments involved with the role. This study could be the precursor for a macro study of all consultant radiographer practice in other specialities. Methodology: Methodology used was a comparative ethnographic study. Questionnaires to the 24 consultant breast radiographers currently in post, and consultant breast radiologists, who work with them, were conducted. Data collection was a qualitative thematic approach. Conclusion: Consultant breast radiographers provide high quality care to patients through excellent clinical practice, leadership and good communication. However, this study shows hospital Trusts emphasis for non medical consultants is for clinical practice first. Some radiologists are still a barrier to progression for consultant breast radiographers, and radiologists have a big influence in recruitment decisions. Consultant breast radiographer posts are well established, their numbers are increasing through recognition of the role and of their abilities and performance. Consultant breast radiographers state that becoming a consultant is the major achievement of their career, proving the Society of Radiographers' vision of the four-tier career structure has been well received by the radiography profession

  16. Autoimmune polyglandular syndrome type 3 (APS-3) among patients with premature ovarian insufficiency (POI).

    Science.gov (United States)

    Szlendak-Sauer, Katarzyna; Jakubik, Daniel; Kunicki, Michał; Skórska, Jolanta; Smolarczyk, Roman

    2016-08-01

    Autoimmune polyglandular syndrome type 3 - (APS-3), is defined as the coexistence of autoimmune thyroiditis with other non-ovarian autoimmune diseases without primary adrenal insufficiency. Additionally the definition of APS-3 also includes primary ovarian insufficiency (POI) coexistence with autoimmune thyroiditis. The main goal of that study is to assess the prevalence of APS-3 defined as coexistence of autoimmune thyroiditis with POI in population of 46 XX karyotype women with primary ovarian insufficiency (POI). The second goal is to investigate hormonal profile and insulin sensitivity in women with POI and subgroups of women with APS-3 - POI/APS-3(+) and without APS 3 - POI/APS-3(-). Anthropometric measurements, coexistence of autoimmune diseases, androgens, fasting glucose and insulin, glucose and insulin at 60' and 120' of oral glucose tolerance test (OGTT) and homeostasis model for insulin resistance (HOMA-IR), were determine in 98 patients aged between 18 and 39 with spontaneous 46 XX primary ovarian insufficiency (POI), in 33 POI/APS-3(+), 65 POI/APS-3(-), and 75 healthy controls. Continuous data were summarized by the mean±standard deviation (SD), and categorical data by number (percentages). Data were checked for normality using Shapiro-Wilk test, the comparison between groups were performed using non-parametric Mann-Whitney or Kruskall-Wallis test. Pearson's correlation coefficient was used to assess the relationships between parameters. Statistical significance was defined as p values APS-3(+) and POI/APS-3(-) showed significantly lower serum androgens in comparison to controls. Additionally women with POI/APS-3(+) showed hyperinsulinemia after 1h of OGTT; No significant differences in serum fasting glucose, insulin and during 2h OGTT between groups were observed. The prevalence of APS-3 is 33.7% in patients with spontaneous 46 XX primary ovarian insufficiency. Women with POI, POI/APS-3(+) and POI/APS-3(-) feature lower testosterone, androstendione

  17. Radiographer-led discharge in accident and emergency - The results of a pilot project

    International Nuclear Information System (INIS)

    Snaith, Beverly A.

    2007-01-01

    Introduction: The radiographers role in trauma has been traditionally limited to image acquisition, but has evolved to include responsibility for image interpretation. The contribution to ongoing patient management has been limited, despite pressure on A and E systems to decrease any potential delays. Background: Three experienced reporting radiographers were trained to discharge patients with a normal radiology report or refer to A and E for further management, following a documented management plan by the examining clinician in A and E. Discharge included advice on the acute management of soft tissue injuries including analgesia and exercise. Methodology: Over a 4-month period in early 2004 all patients whose examinations received a report at the time of attendance (hot report) were included and data were collected in relation to those who were discharged including journey times and further A and E attendances. Data were also collected regarding patients recalled to the A and E department due to misinterpretation of radiographs during the study period. Results: The radiographers hot reported 1760 examinations, discharging 88 (5%) and referring a further 26 (2%) directly for treatment. The number of patients recalled due to misinterpretation of the radiographs was decreased by 52% when compared with the previous 3 years data. Conclusion: Radiographers can safely extend their roles outside of the radiology department and contribute to the management of patients whilst decreasing risk of radiographic misinterpretation by A and E

  18. Radiographic assessment of endodontic working length

    Directory of Open Access Journals (Sweden)

    Osama S Alothmani

    2013-01-01

    Full Text Available The use of radiographs for working length determination is usual practice in endodontics. Exposing radiographs following the principles of the paralleling technique allows more accurate length determination compared to the bisecting-angle method. However, it has been reported that up to 28.5% of cases can have the file tip extending beyond the confines of the root canals despite an acceptable radiographic appearance. The accuracy of radiographic working length determination could be affected by the location of the apical foramen, tooth type, canal curvature and superimposition of surrounding structures. Variations among observers by virtue of training and experience may also influence the accuracy of the procedure. The interpretation of radiographs could be affected by film speed and viewing conditions, with the superiority of digital imaging over conventional radiography for working length determination remaining debatable. The combination of several methods is recommended for acquiring the most accurate working length.

  19. Consultant radiographers: Profile of the first generation

    International Nuclear Information System (INIS)

    Forsyth, Lesley J.; Maehle, Valerie

    2010-01-01

    Aim: The aim of this research is to examine the profile of first generation consultant radiographers: their demographics, educational backgrounds, qualifications and training, career experience and progression, teaching, lecturing and research activities. Method: Participant recruitment was drawn from the Society and College of Radiographers consultant radiographer group. Data collection involved a self-administered paper based and web based questionnaire. Results: Participant response rate of 55% (n = 11). Conclusions: The profile of the first consultant radiographer cohort reflects a diverse and eclectic mix. While some aspects of their development such as educational background, clinical training and skills enhancement are comparable to nurse consultants, clinical experience and employment history show some differences. Commitment to development of expert clinical skills is evident within the profile of the first generation cohort of consultant radiographers however research and leadership training are not strong features.

  20. Validity of radiographic assessment of ankylosis

    International Nuclear Information System (INIS)

    Stenvik, A.; Beyer-Olsen, E.; Aabyholm, F.; Haanaes, H.R.; Gerner, N.W.

    1990-01-01

    The accuracy and sensitivity of radiographic assessments of reactive processes in dental tissues were evaluated by comparison of radiographs and histologic sections. Experimental lesions inflicted on the roots of 10 monkey incisors had been observed by means of serially obtained radiographs over a period of 315 to 370 days. The material was used for evaluation of radiographic assessment of ankylosis. For comparative purposes, assessment of the experimental lesion penetrating to the pulp and periapical radiolucency was added. True and falsely positive or negative recordings formed the basis for calculation of the accuracy and sensitivity of the radiographic assessment. The sensitivity, or the obsevers ability to detect the actual changes, was high for pulp penetration, intermediate for inflammation, and low for ankylosis. 6 refs., 3 figs., 2 tabs

  1. Chest radiographic findings in acute paraquat poisoning

    International Nuclear Information System (INIS)

    Na, Gyeong Gyun; Lee, Mi Sook; Kim, Hee Jun; Sun, In O

    2016-01-01

    To describe the chest radiographic findings of acute paraquat poisoning. 691 patients visited the emergency department of our hospital between January 2006 and October 2012 for paraquat poisoning. Of these 691, we identified 56 patients whose initial chest radiographs were normal but who developed radiographic abnormalities within one week. We evaluated their radiographic findings and the differences in imaging features based on mortality. The most common finding was diffuse consolidation (29/56, 52%), followed by consolidation with linear and nodular opacities (18/56, 32%), and combined consolidation and pneumomediastinum (7/56, 13%). Pleural effusion was noted in 17 patients (30%). The two survivors (4%) showed peripheral consolidations, while the 54 patients (96%) who died demonstrated bilateral (42/54, 78%) or unilateral (12/54, 22%) diffuse consolidations. Rapidly progressing diffuse pulmonary consolidation was observed within one week on follow-up radiographs after paraquat ingestion in the deceased, but the survivors demonstrated peripheral consolidation

  2. Chest radiographic findings in acute paraquat poisoning

    Energy Technology Data Exchange (ETDEWEB)

    Na, Gyeong Gyun; Lee, Mi Sook; Kim, Hee Jun; Sun, In O [Presbyterian Medical Center, Jeonju (Korea, Republic of)

    2016-01-15

    To describe the chest radiographic findings of acute paraquat poisoning. 691 patients visited the emergency department of our hospital between January 2006 and October 2012 for paraquat poisoning. Of these 691, we identified 56 patients whose initial chest radiographs were normal but who developed radiographic abnormalities within one week. We evaluated their radiographic findings and the differences in imaging features based on mortality. The most common finding was diffuse consolidation (29/56, 52%), followed by consolidation with linear and nodular opacities (18/56, 32%), and combined consolidation and pneumomediastinum (7/56, 13%). Pleural effusion was noted in 17 patients (30%). The two survivors (4%) showed peripheral consolidations, while the 54 patients (96%) who died demonstrated bilateral (42/54, 78%) or unilateral (12/54, 22%) diffuse consolidations. Rapidly progressing diffuse pulmonary consolidation was observed within one week on follow-up radiographs after paraquat ingestion in the deceased, but the survivors demonstrated peripheral consolidation.

  3. Tead and AP1 Coordinate Transcription and Motility.

    Science.gov (United States)

    Liu, Xiangfan; Li, Huapeng; Rajurkar, Mihir; Li, Qi; Cotton, Jennifer L; Ou, Jianhong; Zhu, Lihua J; Goel, Hira L; Mercurio, Arthur M; Park, Joo-Seop; Davis, Roger J; Mao, Junhao

    2016-02-09

    The Tead family transcription factors are the major intracellular mediators of the Hippo-Yap pathway. Despite the importance of Hippo signaling in tumorigenesis, Tead-dependent downstream oncogenic programs and target genes in cancer cells remain poorly understood. Here, we characterize Tead4-mediated transcriptional networks in a diverse range of cancer cells, including neuroblastoma, colorectal, lung, and endometrial carcinomas. By intersecting genome-wide chromatin occupancy analyses of Tead4, JunD, and Fra1/2, we find that Tead4 cooperates with AP1 transcription factors to coordinate target gene transcription. We find that Tead-AP1 interaction is JNK independent but engages the SRC1-3 co-activators to promote downstream transcription. Furthermore, we show that Tead-AP1 cooperation regulates the activity of the Dock-Rac/CDC42 module and drives the expression of a unique core set of target genes, thereby directing cell migration and invasion. Together, our data unveil a critical regulatory mechanism underlying Tead- and AP1-controlled transcriptional and functional outputs in cancer cells. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  4. Tead and AP1 Coordinate Transcription and Motility

    Directory of Open Access Journals (Sweden)

    Xiangfan Liu

    2016-02-01

    Full Text Available The Tead family transcription factors are the major intracellular mediators of the Hippo-Yap pathway. Despite the importance of Hippo signaling in tumorigenesis, Tead-dependent downstream oncogenic programs and target genes in cancer cells remain poorly understood. Here, we characterize Tead4-mediated transcriptional networks in a diverse range of cancer cells, including neuroblastoma, colorectal, lung, and endometrial carcinomas. By intersecting genome-wide chromatin occupancy analyses of Tead4, JunD, and Fra1/2, we find that Tead4 cooperates with AP1 transcription factors to coordinate target gene transcription. We find that Tead-AP1 interaction is JNK independent but engages the SRC1–3 co-activators to promote downstream transcription. Furthermore, we show that Tead-AP1 cooperation regulates the activity of the Dock-Rac/CDC42 module and drives the expression of a unique core set of target genes, thereby directing cell migration and invasion. Together, our data unveil a critical regulatory mechanism underlying Tead- and AP1-controlled transcriptional and functional outputs in cancer cells.

  5. Meet the APS Editors Coffee Break

    Science.gov (United States)

    2014-03-01

    The APS Journal Editors invite you to join them for conversation and light refreshments. The Editors will be available to answer questions, discuss your ideas, and listen to your comments about the journals. All are welcome to attend.

  6. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2018-02-21

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  7. AP1000 design and construction integration

    International Nuclear Information System (INIS)

    Winters, James W.; Clelland, Jill A.

    2004-01-01

    Construction costs of commercial nuclear generating plants must be reduced in order to expand the future use of nuclear energy. Two of the drivers of plant construction costs are the cost of financing during the construction duration and the substantial amount of skilled craft labor hours needed on site during construction. The application of information technology (IT) has been used to understand and reduce both of these drivers by establishing parallel construction paths using modules and integrating construction sequence review into the design process. In a program sponsored by EPRI, Westinghouse has modeled the construction of AP1000 in '4D' to show its viability, to improve its logic, to improve the plant design for constructibility and overall to reduce time and risk in the construction schedule. The design of most of AP1000 was constrained to be a duplicate of AP600 except where components required expansion for the higher power level. As a result, the construction schedule for AP1000 is as mature and as robust as that for AP600. Two areas important to the construction of AP1000 did require some design work because they could not remain the same as AP1000. First, the turbine building had to be redesigned to accommodate the larger turbine and its support systems. Again, as much of the AP600 design and philosophy as possible was retained. The building required enlargement and the basemat, foundations, steel structure and structural modules required modification. As concrete, steel, and equipment were defined by the designers, they were matched to the original AP600 turbine building schedule. This forced designers to assemble files to be consistent with building assembly activities and to think about constructibility as they defined the final design. Second, the reinforcement structure within the concrete under and supporting the containment vessel required detail design. Westinghouse was fortunate to have the constructor Obayashi of Japan recommend a detailed

  8. Mentoring assistant practitioners - The radiographer's perspective

    International Nuclear Information System (INIS)

    Colthart, Iain; McBride, Margot; Murray, Maria

    2010-01-01

    Purpose: The aim of this study was to evaluate the experiences of diagnostic and therapeutic radiographers as they mentored trainee assistant practitioners undertaking an educational programme. The evaluation study describes the challenges and benefits the radiographers experienced as mentors as well as giving their insights into the introduction of assistant practitioners in their departments. Method: The mentors' opinions were sought by a questionnaire which formed part of the evaluation of the respective diagnostic imaging and therapeutic educational programmes run by two colleges. Results: The response rate was 54% (22/41). Mentors described personal and professional benefits for themselves from undertaking this role. Although mentoring had provided a number of challenges including an increase in workload, the experience had also enhanced their teaching and mentoring skills and contributed to their Continuing Professional Development (CPD). Whilst the role was more time consuming than initially expected this had not impacted generally on their ability to undertake CPD or deliver patient care. In relation to the wider impact of the programmes some negative impact was reported on the speed of service delivery but not on the quality of practice. Mentors felt that the programmes had a positive effect on teamworking and had been beneficial for patient care. Some difficulties were noted in balancing the mentoring of trainee assistant practitioners and radiography undergraduates. Conclusion: The mentors strongly endorsed the educational programmes and their roles and responsibilities in their delivery. Protected time to carry out mentoring duties and establishing good communication with the colleges providing the theoretical teaching were identified as means of further improving the mentoring process.

  9. AP1000{sup TM} plant modularization

    Energy Technology Data Exchange (ETDEWEB)

    Cantarero L, C.; Demetri, K. J. [Westinghouse Electric Co., 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States); Quintero C, F. P., E-mail: cantarc@westinghouse.com [Westinghouse Electric Spain, Padilla 17, 28006 Madrid (Spain)

    2016-09-15

    The AP1000{sup TM} plant is an 1100 M We pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. Modules are used extensively in the design of the AP1000 plant nuclear island. The AP1000 plant uses modern, modular-construction techniques for plant construction. The design incorporates vendor-designed skids and equipment packages, as well as large, multi-ton structural modules and special equipment modules. Modularization allows traditionally sequential construction tasks to be completed simultaneously. Factory-built modules can be installed at the site in a planned construction schedule. The modularized AP1000 plant allows many more construction activities to proceed in parallel. This reduces plant construction calendar time, thus lowering the costs of plant financing. Furthermore, performing less work onsite significantly reduces the amount of skilled field-craft labor, which costs more than shop labor. In addition to labor cost savings, doing more welding and fabrication in a factory environment raises the quality of work, allowing more scheduling flexibility and reducing the amount of specialized tools required onsite. The site layout for the AP1000 plant has been established to support modular construction and efficient operations during construction. The plant layout is compact, using less space than previous conventional plant layouts. This paper provides and overview of the AP1000 plant modules with an emphasis on structural modules. Currently the Westinghouse AP1000 plant has four units under construction in China and four units under construction in the United States. All have shown successful fabrication and installation of various AP1000 plant modules. (Author)

  10. Digital subtraction radiographic evaluation of the standardize periapical intraoral radiographs

    International Nuclear Information System (INIS)

    Cho, Bong Hae; Nah, Kyung Soo

    1993-01-01

    The geometrically standardized intraoral radiographs using 5 occlusal registration material were taken serially from immediate, 1 day, 2, 4, 8, 12 and 16 weeks after making the bite blocks. The qualities of those subtracted images were evaluated to check the degree of reproducibility of each impression material. The results were as follows: 1. The standard deviations of the grey scales of the overall subtracted images were 4.9 for Exaflex, 7.2 for Pattern resin, 9.0 for Tooth Shade Acrylic, 12.2 for XCP only, 14.8 for Impregum. 2. The standard deviation of the grey scales of the overall subtracted images were grossly related to those of the localized horizontal line of interest. 3. Exaflex which showed the best subtracted image quality had 15 cases of straight, 14 cases of wave, 1 case of canyon shape. Impregum which showed the worst subtracted image quality had 4 cases of straight, 8 cases of wave, 18 cases of canyon shape respectively.

  11. Radiographic features of tuberculous osteitis in greater trochanter and lschium

    International Nuclear Information System (INIS)

    Hahm, So Hee; Lee, Ye Ri; Kim, Dong Jin; Sung, Ki Jun; Lim, Jong Nam

    1996-01-01

    To evaluate, if possible, the radiographic features of tuberculous osteitis in the greater trochanter and ischium, and to determine the cause of the lesions. We reterospectively reviewed the plain radiographic findings of 14 ptients with histologically proven tuberculous osteitis involving the greater trochanter and ischium. In each case, the following were analyzed:morphology of bone destruction, including cortical erosion;periosteal reaction;presence or abscence of calcific shadows in adjacent soft tissue. On the basis of an analysis of radiographic features and correlation of the anatomy with adjacent structures we attempted to determine causes. Of the 14 cases evaluated, 12 showed varrious degrees of extrinsic erosion on the outer cortical bone of the greater trochanter and ischium ; in two cases, bone destruction was so severe that the radiographic features of advanced perforated osteomyelitis were simulated. In addition to findings of bone destruction, in these twelve cases, the presence of sequestrum or calcific shadows was seen in adjacent soft tissue. Tuberculous osteitis in the greater trochanter and ischium showed the characteristic findings of chronic extrinsic erosion. On the basis of these findings we can suggest that these lesions result from an extrinsic pathophysiologic cause such as adjacent bursitis

  12. Radiographic features of tuberculous osteitis in greater trochanter and lschium

    Energy Technology Data Exchange (ETDEWEB)

    Hahm, So Hee; Lee, Ye Ri [Hanil Hospital Affiliated to KEPCO, Seoul (Korea, Republic of); Kim, Dong Jin; Sung, Ki Jun [Yonsei Univ. Wonju College of Medicine, Wonju (Korea, Republic of); Lim, Jong Nam [Konkuk Univ. College of Medicine, Seoul (Korea, Republic of)

    1996-11-01

    To evaluate, if possible, the radiographic features of tuberculous osteitis in the greater trochanter and ischium, and to determine the cause of the lesions. We reterospectively reviewed the plain radiographic findings of 14 ptients with histologically proven tuberculous osteitis involving the greater trochanter and ischium. In each case, the following were analyzed:morphology of bone destruction, including cortical erosion;periosteal reaction;presence or abscence of calcific shadows in adjacent soft tissue. On the basis of an analysis of radiographic features and correlation of the anatomy with adjacent structures we attempted to determine causes. Of the 14 cases evaluated, 12 showed varrious degrees of extrinsic erosion on the outer cortical bone of the greater trochanter and ischium ; in two cases, bone destruction was so severe that the radiographic features of advanced perforated osteomyelitis were simulated. In addition to findings of bone destruction, in these twelve cases, the presence of sequestrum or calcific shadows was seen in adjacent soft tissue. Tuberculous osteitis in the greater trochanter and ischium showed the characteristic findings of chronic extrinsic erosion. On the basis of these findings we can suggest that these lesions result from an extrinsic pathophysiologic cause such as adjacent bursitis.

  13. Para-acetabular peritendinitis calcarea; its radiographic manifestations

    International Nuclear Information System (INIS)

    Kawashima, Akira; Murayama, Sadayuki; Ohuchida, Toshiyuki; Russell, W.J.

    1987-02-01

    Peritendinitis calcarea and os acetabuli have long been confused during interpretations of hip-joint radiographs. Such confusion is reflected in the medical literature. The present study differentiated these two entities according to their interval radiographic progression and regression. There were 137 instances of para-acetabular calcifications among 110 subjects (59 men and 51 women), whose mean age was 46.8 years at the time of their initial detection. Twenty-six of the subjects had lumbago, which was probably unrelated. Other abnormalities including narrowed intervertebral spaces, scoliosis, and spondylolysis were observed in 21 of the subjects. These could have been responsible for any symptoms they had had, but none of the subjects complained of local hip-joint pain when the radiographs in question were made. Ninety-three of these instances of calcification were reviewed by means of serial radiographs. Interval changes in the sizes and shapes of the calcifications occurred among 90 of them, indicative of the latent type of peritendinitis calcarea. No interval changes were noted in the remaining three cases, indicating they were secondary ossification centers; namely, os acetabuli. This study showed that in asymptomatic adults, most para-acetabular calcifications were really not os acetabuli, but actually peritendinitis calcarea. (author)

  14. Radiographer Delivered Fluoroscopy Reduces Radiation Exposure During Endoscopic Urological Procedures.

    Science.gov (United States)

    Martin, J; Hennessey, D B; Young, M; Pahuja, A

    2016-01-01

    The 1999 Ionising Radiation Regulations recommend that medical professionals using ionising radiation should aim to keep exposure as 'low as reasonably practicable'. Urologists regularly use fluoroscopy during endoscopic surgical procedures. In some institutions, this is delivered by a radiographer whereas in others, it is delivered by the urological surgeon. To determine if radiographer-delivered fluoroscopy can reduce the exposure to ionising radiation during urological procedures. An analysis of 395 consecutive patients, who underwent endoscopic urological procedures requiring fluoroscopy, was performed simultaneously across two institutions, over a 4 month period. 321 patients were matched and included in the analysis. Radiographer delivered fluoroscopy was associated with reduced ionising radiation exposure for retrograde pyelography procedures ED 0.09626 vs. 1.323 mSev, p= 0.0003, and endoscopic stone surgeries ED 0.3066 Vs. 0.5416 mSev, p=0.0039, but not for ureterorenoscopic stone surgeries 0.4880 vs. 0.2213 mSev, p=0.8292. Radiographer delivered fluoroscopy could reduce the patient's exposure to ionising radiation for some urological procedures.

  15. Thalassemia: essential radiographic and clinical features of interest to dentistry

    Directory of Open Access Journals (Sweden)

    Luiz Roberto Coutinho Manhães Junior

    2008-01-01

    Full Text Available Thalassemia is a type of hereditary anemia that predominantly affects individuals born in or descendents of countries bathed by the Mediterranean Sea, such as Italy and Greece. Also known as Cooley’s anemia and Mediterranean anemia, the disease causes alterations in hemoglobin formation and malformations of the cranium, long bones, maxilla and mandible. It presents two distinct clinical conditions: one severe, called “major” thalassemia, and the other mild, denominated “minor” thassalemia. Hematologic exam diagnoses the two forms of the disease. Its clinical and radiographic manifestations include hepatosplenomegalia, lymphadenopathy, augmented mandible, increase in medullary spaces, thick bone trabeculae and in lower quantity, resembling a “spider web”, displacement of the mandibular canal, with loss of detail of its superior and inferior corticals and a radiographic aspect of “hair standing on end” at the surface of the cranium. Some of these manifestations are so characteristic and capable of being observed in radiographs that they form part of the dentist’s routine. This case report discusses the alterations observed in the panoramic radiograph of a patient with thalassemia diagnosed by means of hematologic exam.

  16. Herpes simplex virus 1 pneumonia: conventional chest radiograph pattern

    International Nuclear Information System (INIS)

    Umans, U.; Golding, R.P.; Duraku, S.; Manoliu, R.A.

    2001-01-01

    The aim of this study was to describe the findings on plain chest radiographs in patients with herpes simplex virus pneumonia (HSVP). The study was based on 17 patients who at a retrospective search have been found to have a monoinfection with herpes simplex virus. The diagnosis was established by isolation of the virus from material obtained during fiberoptic bronchoscopy (FOB) which also included broncho-alveolar lavage and tissue sampling. Fourteen patients had a chest radiograph performed within 24 h of the date of the FOB. Two radiographs showed no abnormalities of the lung parenchyma. The radiographs of the other 12 patients showed lung opacification, predominantly lobar or more extensive and always bilateral. Most patients presented with a mixed airspace and interstitial pattern of opacities, but 11 of 14 showed at least an airspace consolidation. Lobar, segmental, or subsegmental atelectasis was present in 7 patients, and unilateral or bilateral pleural effusion in 8 patients, but only in 1 patient was it a large amount. In contradiction to the literature which reports a high correlation between HSVP and acute respiratory distress syndrome (ARDS), 11 of 14 patients did not meet the pathophysiological criteria for ARDS. The radiologist may suggest the diagnosis of HSVP when bilateral airspace consolidation or mixed opacities appear in a susceptible group of patients who are not thought to have ARDS or pulmonary edema. The definite diagnosis of HSV pneumonia can be established only on the basis of culture of material obtained by broncho-alveolar lavage. (orig.)

  17. Radiographic findings of femoroacetabular impingement in capoeira players.

    Science.gov (United States)

    Mariconda, Massimo; Cozzolino, Andrea; Di Pietto, Francesco; Ribas, Manuel; Bellotti, Vittorio; Soldati, Alessandra

    2014-04-01

    Capoeira is a Brazilian martial art that requires extreme movements of the hip to perform jumps and kicks. This study evaluated a group of capoeira players to assess the prevalence of femoroacetabular impingement (FAI) in athletes practicing this martial art. Twenty-four experienced capoeira players (14 men, 10 women) underwent a diagnostic assessment, including clinical examination and standard radiographs of the pelvis and hips. The α-angle, head-neck offset, crossover sign, acetabular index, lateral centre-edge angle, and the Tönnis grade were assessed using the radiographs. Clinical relationships for any radiographic abnormalities indicating FAI were also evaluated. Four subjects (17 %) reported pain in their hips. Forty-four hips (91.7 %) had at least one radiographic sign of CAM impingement, and 22 (45.8 %) had an α-angle of more than 60°. Eighteen hips (37.5 %) had at least one sign of pincer impingement and 16 (33.3 %) a positive crossover sign. Sixteen hips (33.3 %) had mixed impingement. There was a significant positive association between having an α-angle of more than 60° and the presence of groin pain (P = 0.002). A reduced femoral head-neck offset (P capoeira players was found. In these subjects, a negative clinical correlation for an increased α-angle was also detected. Additional caution should be exercised whenever subjects with past or present hip pain engage in capoeira.

  18. Automatic selection of region of interest for radiographic texture analysis

    Science.gov (United States)

    Lan, Li; Giger, Maryellen L.; Wilkie, Joel R.; Vokes, Tamara J.; Chen, Weijie; Li, Hui; Lyons, Tracy; Chinander, Michael R.; Pham, Ann

    2007-03-01

    We have been developing radiographic texture analysis (RTA) for assessing osteoporosis and the related risk of fracture. Currently, analyses are performed on heel images obtained from a digital imaging device, the GE/Lunar PIXI, that yields both the bone mineral density (BMD) and digital images (0.2-mm pixels; 12-bit quantization). RTA is performed on the image data in a region-of-interest (ROI) placed just below the talus in order to include the trabecular structure in the analysis. We have found that variations occur from manually selecting this ROI for RTA. To reduce the variations, we present an automatic method involving an optimized Canny edge detection technique and parameterized bone segmentation, to define bone edges for the placement of an ROI within the predominantly calcaneus portion of the radiographic heel image. The technique was developed using 1158 heel images and then tested on an independent set of 176 heel images. Results from a subjective analysis noted that 87.5% of ROI placements were rated as "good". In addition, an objective overlap measure showed that 98.3% of images had successful ROI placements as compared to placement by an experienced observer at an overlap threshold of 0.4. In conclusion, our proposed method for automatic ROI selection on radiographic heel images yields promising results and the method has the potential to reduce intra- and inter-observer variations in selecting ROIs for radiographic texture analysis.

  19. Vascular Manifestations in Antiphospholipid Syndrome (APS): Is APS a Thrombophilia or a Vasculopathy?

    Science.gov (United States)

    Siddique, Salma; Risse, Jessie; Canaud, Guillaume; Zuily, Stéphane

    2017-09-04

    Antiphospholipid antibody syndrome (APS) is characterized primarily by thrombosis and pregnancy morbidity. Chronic vascular lesions can also occur. While the underlying mechanisms of these vascular lesions are not entirely known, there have been multiple theories describing the potential process of vasculopathy in APS and the various clinical manifestations associated with it. Recently, it has been demonstrated that endothelial proliferation in kidneys can be explained by the activation of the mammalian target of rapamycin complex (mTORC) pathway by antiphospholipid antibodies (aPL). These data support the existence of an APS-related vasculopathy in different locations which can explain-in part-the different manifestations of APS. This review focuses on the various manifestations of APS as a result of APS-related vasculopathy, as well as pathophysiology, current screening, and treatment options for clinicians to be aware of.

  20. Beyond image interpretation: Capturing the impact of radiographer advanced practice through activity diaries

    International Nuclear Information System (INIS)

    Snaith, B.; Milner, R.C.; Harris, M.A.

    2016-01-01

    Background: There is limited evidence of the impact of radiographers working in advanced roles beyond task substitution. This study reviews the contribution of advanced (and consultant) practitioner radiographers to service delivery whilst reporting radiographs and demonstrates the impact this has on patients and staff, both internal and external to the imaging department. Method: The study was a prospective exploratory study using activity diaries to allow interval sampling when individuals were rostered to report. Data was coded using a compiled list of activities and recorded in 15-min intervals over the period of one week. Thirteen radiographers who independently report radiographs participated across 6 locations in a busy multisite English National Health Service (NHS) Trust. Results: Radiographers reported the majority of the examinations during the study period (n = 4512/5671; 79.6%). The total number of coded activities recorded over the study period was 1527, equating to 380.5 relative hours. The majority of available time was spent reporting, including dictating and verifying the reports of colleagues or trainees, although 69.5% of reporting time was interrupted. Based upon the hours of reporting there was an average of 19.3 reports (patient episodes) produced per hour. Direct patient care tasks and support for staff in decision making were regularly documented. Supplementary tasks included administrative activity, amendments to rotas, preparing presentations and documenting incidents identified during reporting. Conclusion: This study has demonstrated the breadth and complexity of the activities performed by advanced practice radiographers. The findings confirm their role in supporting service delivery beyond image interpretation. - Highlights: • Radiographers can make a significant contribution to reporting workloads. • The range of activities undertaken when reporting is complex and varied. • Reporting radiographers impact on staff, patients

  1. Radiographers' opinions on radiography research in Norway – A national survey

    International Nuclear Information System (INIS)

    Vikestad, K.G.; Hafskjold, L.; Kjelle, E.; Sebuødegård, S.; Hofvind, S.

    2017-01-01

    Objective: The objective of the Norwegian Radiography Research Group is to establish a strategy for radiography research in Norway. A survey investigating radiographers' opinions on research was conducted to establish a basis for this strategy. Methods: A questionnaire was sent to all members of the Norwegian Society of Radiographers using the society's e-mail list from May 2014 (n = 2273). The respondents, 31% (n = 697), were divided into six groups; general radiographers (n = 392), specialised radiographers (n = 124), managers (n = 74), radiation therapists (n = 59), professors (n = 13), and others (n = 35). The questionnaire included four parts: introduction, participation in research, research performed at the respondent's work place, and opinions on radiography research. The first parts consisted of close-ended questions, while the fourth part also included a Likert scale. Results: Among all respondents, 63% respondents agreed that there is a need for radiography research and 50% agreed that general radiographers/radiation therapists should be the principal investigators of such research. However, only 19% reported participation in a research project during the last five years, and of those, 50% knew how the results of their research had been communicated. Conclusion: The majority of radiographers agreed that there was a need for radiography research and that radiographers/radiation therapists should take a leading role in such work. The results indicate that radiographers/radiation therapists would benefit from training in informal and formal research skills. - Highlights: • Two in ten radiographers took part in research activity in Norway. • Six in ten agreed that there is a need for radiographic related research in Norway. • Evidence-based practice, informal and formal research training represent the main aim to reach in the first strategy for radiography research in Norway.

  2. AP-2δ is a crucial transcriptional regulator of the posterior midbrain.

    Directory of Open Access Journals (Sweden)

    Katrin Hesse

    Full Text Available Ap-2 transcription factors comprise a family of 5 closely related sequence-specific DNA binding proteins that play pivotal and non-redundant roles in embryonic organogenesis. To investigate the function of Ap-2δ, wδe analyzed its expression during embryogenesis and generated Ap-2δ-deficient mice. In line with the specific expression pattern of Ap-2δ in the mesencephalic tectum and the dorsal midbrain, Ap-2δ-deficient mice failed to maintain the colliculus inferior, a derivative of the dorsal midbrain, as a consequence of increased apoptotic cell death. To identify specific Ap-2δ target genes in cells of the developing dorsal midbrain, we performed whole genome analysis of cDNA expression levels. This approach identified a set of 12 putative target genes being expressed in the developing midbrain, including the transcription factors Pitx2, Mef2c, Bhlhb4 and Pou4f3. Using chromatin immunoprecipitation (CHIP we showed that some of these genes are direct targets of Ap-2δ. Consistently, we demonstrate that Ap-2δ occupies and activates the Pou4f3 and Bhlhb4 promoters. In addition, known Pou4f3 target genes were downregulated in the posterior midbrain of Ap-2δ-deficient mice. Despite the absence of a central part of the auditory pathway, the presence of neuronal responses to sounds in the neocortex of Ap-2δ-deficient mice indicates that auditory information from the brainstem still reaches the neocortex. In summary, our data define Ap-2δ as an important transcription factor, specifying gene expression patterns required for the development of the posterior midbrain.

  3. AP-2δ Is a Crucial Transcriptional Regulator of the Posterior Midbrain

    Science.gov (United States)

    Kurt, Simone; Buettner, Reinhard; Kirfel, Jutta; Moser, Markus

    2011-01-01

    Ap-2 transcription factors comprise a family of 5 closely related sequence-specific DNA binding proteins that play pivotal and non-redundant roles in embryonic organogenesis. To investigate the function of Ap-2δ, wδe analyzed its expression during embryogenesis and generated Ap-2δ-deficient mice. In line with the specific expression pattern of Ap-2δ in the mesencephalic tectum and the dorsal midbrain, Ap-2δ-deficient mice failed to maintain the colliculus inferior, a derivative of the dorsal midbrain, as a consequence of increased apoptotic cell death. To identify specific Ap-2δ target genes in cells of the developing dorsal midbrain, we performed whole genome analysis of cDNA expression levels. This approach identified a set of 12 putative target genes being expressed in the developing midbrain, including the transcription factors Pitx2, Mef2c, Bhlhb4 and Pou4f3. Using chromatin immunoprecipitation (CHIP) we showed that some of these genes are direct targets of Ap-2δ. Consistently, we demonstrate that Ap-2δ occupies and activates the Pou4f3 and Bhlhb4 promoters. In addition, known Pou4f3 target genes were downregulated in the posterior midbrain of Ap-2δ-deficient mice. Despite the absence of a central part of the auditory pathway, the presence of neuronal responses to sounds in the neocortex of Ap-2δ-deficient mice indicates that auditory information from the brainstem still reaches the neocortex. In summary, our data define Ap-2δ as an important transcription factor, specifying gene expression patterns required for the development of the posterior midbrain. PMID:21858141

  4. High Pressure Reverse Flow APS Engine

    Science.gov (United States)

    Senneff, J. M.

    1972-01-01

    A design and test demonstration effort was undertaken to evaluate the concept of the reverse flow engine for the APS engine application. The 1500 lb (6672 N) thrust engine was designed to operate on gaseous hydrogen and gaseous oxygen propellants at a mixture ratio of 4 and to achieve the objective performance of 435 sec (4266 Nsec/kg) specific impulse. Superimposed durability requirements called for a million-cycle capability with 50 hours duration. The program was undertaken as a series of tasks including the initial preliminary design, design of critical test components and finally, the design and demonstration of an altitude engine which could be used interchangeably to examine operating parameters as well as to demonstrate the capability of the concept. The program results are reported with data to indicate that all of the program objectives were met or exceeded within the course of testing on the program. The analysis effort undertaken is also reported in detail and supplemented with test data in some cases where prior definitions could not be made. The results are contained of these analyses as well as the test results conducted throughout the course of the program. Finally, the test data and analytical results were combined to allow recommendations for a flight weight design. This preliminary design effort is also detailed.

  5. Thrombotic recurrences and bleeding events in APS vascular patients: a review from the literature and a comparison with the APS Piedmont Cohort.

    Science.gov (United States)

    Bazzan, M; Vaccarino, A; Stella, S; Bertero, M T; Carignola, R; Montaruli, B; Roccatello, D; Shoenfeld, Y

    2013-06-01

    In APS vascular patients, thrombotic recurrences are more frequent than in non-APS thrombotic patients. To better define this clinical setting, a systematic review of the literature after 1999 was performed: 8 cohort studies (including the recent APS Piedmont Cohort) and 6 intervention studies were selected and evaluated. Thrombotic recurrences, bleeding events, therapeutic strategies, antiphospholipid (aPL) profile, inherited and acquired risk factors (when present) were calculated and compared. Emerging risk factors for thrombotic recurrences include withdrawal of oral anticoagulant therapy (OAT), high intensity OAT (INR range 3-4), aPL profile (triple positivity, Miyakis types 1 and 2a profiles) and association with inherited or acquired pro-thrombotic risk factors. Moreover, there are evidences that high risk (mainly for aPL profile) APS vascular patients have a high recurrence rate in spite of correct OAT treatment. Clinical trials in this clinical setting are needed. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...... presence of both γ Dor and roAp pulsations and the unexpected detection of δ Sct and γ Dor pulsations in Ap stars present new opportunities and challenges for the interpretation of these stars. Since it is easy to confuse Am and Ap stars at classification dispersions, the nature of these Ap stars...

  7. Lobular carcinoma in situ and invasive lobular breast cancer are characterized by enhanced expression of transcription factor AP-2β.

    Science.gov (United States)

    Raap, Mieke; Gronewold, Malte; Christgen, Henriette; Glage, Silke; Bentires-Alj, Mohammad; Koren, Shany; Derksen, Patrick W; Boelens, Mirjam; Jonkers, Jos; Lehmann, Ulrich; Feuerhake, Friedrich; Kuehnle, Elna; Gluz, Oleg; Kates, Ronald; Nitz, Ulrike; Harbeck, Nadia; Kreipe, Hans H; Christgen, Matthias

    2018-01-01

    Transcription factor AP-2β (TFAP2B) regulates embryonic organ development and is overexpressed in alveolar rhabdomyosarcoma, a rare childhood malignancy. Gene expression profiling has implicated AP-2β in breast cancer (BC). This study characterizes AP-2β expression in the mammary gland and in BC. AP-2β protein expression was assessed in the normal mammary gland epithelium, in various reactive, metaplastic and pre-invasive neoplastic lesions and in two clinical BC cohorts comprising >2000 patients. BCs from various genetically engineered mouse (GEM) models were also evaluated. Human BC cell lines served as functional models to study siRNA-mediated inhibition of AP-2β. The normal mammary gland epithelium showed scattered AP-2β-positive cells in the luminal cell layer. Various reactive and pre-invasive neoplastic lesions, including apocrine metaplasia, usual ductal hyperplasia and lobular carcinoma in situ (LCIS) showed enhanced AP-2β expression. Cases of ductal carcinoma in situ (DCIS) were more often AP-2β-negative (Pinvasive BC cohorts, AP-2β-positivity was associated with the lobular BC subtype (Plobular BC cell lines in vitro. In summary, AP-2β is a new mammary epithelial differentiation marker. Its expression is preferentially retained and enhanced in LCIS and invasive lobular BC and has prognostic implications. Our findings indicate that AP-2β controls tumor cell proliferation in this slow-growing BC subtype.

  8. APS, an adaptor molecule containing PH and SH2 domains, has a negative regulatory role in B cell proliferation

    International Nuclear Information System (INIS)

    Iseki, Masanori; Kubo-Akashi, Chiyomi; Kwon, Sang-Mo; Yamaguchi, Akiko; Takatsu, Kiyoshi; Takaki, Satoshi

    2005-01-01

    Adaptor molecule containing PH and SH2 domains (APS) is an intracellular adaptor protein that forms part of an adaptor family along with Lnk and SH2-B. APS transcripts are expressed in various tissues including brain, kidney, and muscle, as well as in splenic B cells but not in T cells. We investigated the functions of APS in B cell development and activation by generating APS-transgenic (APS-Tg) mice that overexpressed APS in lymphocytes. The number of B-1 cells in the peritoneal cavity was reduced in APS-Tg mice, as were B-2 cells in the spleen. B cell development in the bone marrow was partially impaired at the transition stage from proliferating large pre-B to small pre-B cells. B cell proliferation induced by B cell receptor (BCR) crosslinking but not by other B cell mitogens was also impaired in APS-Tg mice. APS co-localized with BCR complexes and filamentous actin in activated APS-Tg B cells. Thus, APS appears to play novel negative regulatory roles in BCR signaling, actin reorganization pathways, and control of compartment sizes of B-lineage cells

  9. Westinghouse AP600 advanced nuclear plant design

    International Nuclear Information System (INIS)

    Gangloff, W.

    1999-01-01

    As part of the cooperative US Department of Energy (DOE) Advanced Light Water Reactor (ALWR) Program and the Electric Power Research Institute (EPRI), the Westinghouse AP600 team has developed a simplified, safe, and economic 600-megawatt plant to enter into a new era of nuclear power generation. Designed to satisfy the standards set by DOE and defined in the ALWR Utility Requirements Document (URD), the Westinghouse AP600 is an elegant combination of innovative safety systems that rely on dependable natural forces and proven technologies. The Westinghouse AP600 design simplifies plant systems and significant operation, inspections, maintenance, and quality assurance requirements by greatly reducing the amount of valves, pumps, piping, HVAC ducting, and other complex components. The AP600 safety systems are predominantly passive, depending on the reliable natural forces of gravity, circulation, convection, evaporation, and condensation, instead of AC power supplies and motor-driven components. The AP600 provides a high degree of public safety and licensing certainty. It draws upon 40 years of experience in light water reactor components and technology, so no demonstration plant is required. During the AP600 design program, a comprehensive test program was carried out to verify plant components, passive safety systems components, and containment behavior. When the test program was completed at the end of 1994, the AP600 became the most thoroughly tested advanced reactor design ever reviewed by the US Nuclear Regulatory Commission (NRC). The test results confirmed the exceptional behavior of the passive systems and have been instrumental in facilitating code validations. Westinghouse received Final Design Approval from the NRC in September 1998. (author)

  10. What do we know about the cardiac valve lesion in the antiphospholipid syndrome (APS)?

    Science.gov (United States)

    Amigo, M-C

    2014-10-01

    Heart valve disease (HVD) is the most common cardiac manifestation in the antiphospholipid syndrome (APS). Valve lesions should be described according to the established definition. HVD is progressive despite anticoagulant/antiplatelet treatments. Around 4-6% of patients with HVD in APS will require valve replacement surgery, which is considered a very high risk procedure in APS. Unfortunately, no recommendations regarding medical treatment of antiphospholipid antibodies-associated HVD can be made at this moment. There are evidence-based data and strong pathophysiologic rationale for considering HVD as a manifestation of APS. Thus, HVD should be included as a criterion of definite APS. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  11. Consultant radiographer leadership - A discussion

    International Nuclear Information System (INIS)

    Hogg, Peter; Hogg, Dianne; Henwood, Suzanne

    2008-01-01

    Effective leadership can be defined in many ways and is an essential element of successful organisations; poor leadership can result in problems such as low staff morale, high staff turnover and reduced productivity. Effective leadership behaviours are well documented in the literature and various leadership models have been proposed that illustrate these behaviours. This discussion paper does not focus on any particular model. Instead it considers the 'Leadership Qualities Framework' which was developed specifically for use within the UK National Health Service. This framework draws upon a range of leadership models and as such it gives a broad indication of leadership behaviours. The framework comprises three components - 'personal qualities', 'setting direction' and 'delivering the service'. This paper commences with an argument as to why effective leadership is important in organisations generally, and specifically within healthcare organisations. Various examples of leadership are illustrated from within and outside the NHS in order to demonstrate effective leadership behaviours. The Leadership Qualities Framework is then examined, along with scenarios to illustrate effective leadership behaviours in context (i.e. within a healthcare organisation). Subsequent reflections on the scenarios aim to identify leadership behaviours that are explained within the framework. The final element of this paper draws on [limited] published evidence of where consultant radiographers have demonstrated effective leadership behaviours. In this section the published evidence is examined and reflected upon. At the end of the article we indicate additional reading for those who wish to further develop their theoretical and practical leadership skills

  12. Role of the AP-5 adaptor protein complex in late endosome-to-Golgi retrieval.

    Science.gov (United States)

    Hirst, Jennifer; Itzhak, Daniel N; Antrobus, Robin; Borner, Georg H H; Robinson, Margaret S

    2018-01-01

    The AP-5 adaptor protein complex is presumed to function in membrane traffic, but so far nothing is known about its pathway or its cargo. We have used CRISPR-Cas9 to knock out the AP-5 ζ subunit gene, AP5Z1, in HeLa cells, and then analysed the phenotype by subcellular fractionation profiling and quantitative mass spectrometry. The retromer complex had an altered steady-state distribution in the knockout cells, and several Golgi proteins, including GOLIM4 and GOLM1, were depleted from vesicle-enriched fractions. Immunolocalisation showed that loss of AP-5 led to impaired retrieval of the cation-independent mannose 6-phosphate receptor (CIMPR), GOLIM4, and GOLM1 from endosomes back to the Golgi region. Knocking down the retromer complex exacerbated this phenotype. Both the CIMPR and sortilin interacted with the AP-5-associated protein SPG15 in pull-down assays, and we propose that sortilin may act as a link between Golgi proteins and the AP-5/SPG11/SPG15 complex. Together, our findings suggest that AP-5 functions in a novel sorting step out of late endosomes, acting as a backup pathway for retromer. This provides a mechanistic explanation for why mutations in AP-5/SPG11/SPG15 cause cells to accumulate aberrant endolysosomes, and highlights the role of endosome/lysosome dysfunction in the pathology of hereditary spastic paraplegia and other neurodegenerative disorders.

  13. In vivo monitoring of the recruitment and activation of AP-1 by Arf1.

    Science.gov (United States)

    Sauvageau, Etienne; McCormick, Peter J; Lefrancois, Stephane

    2017-08-02

    AP-1 is a clathrin adaptor recruited to the trans-Golgi Network where it can interact with specific signals found in the cytosolic tail of cargo proteins to incorporate them into clathrin-coated vesicles for trafficking. The small G protein Arf1 regulates the spatiotemporal recruitment of AP-1 and also drives a conformational change favoring an interaction with cargo proteins. A recent crystal structure and in vitro experiments highlighted potential residues mediating the AP-1/Arf1 interaction and the unlocking of the complex. We have used bioluminescence resonance energy transfer (BRET) to study the Arf1/AP-1 interaction and AP-1 conformational changes in vivo. We identified novel residues required for this interaction in addition to those predicted in the crystal structure. We also studied the conformational changes in AP-1 driven by Arf1 in live cells and found that opening of the complex is prerequisite for oligomerization. Using Arf1 knockout cells generated by CRISPR/Cas9, we demonstrated that residue 172 in Arf1 is necessary for AP-1 activation and is required for the efficient sorting of the lysosomal protein prosaposin. We have used BRET to study the in vivo activation of AP-1. The advantages of BRET include expressing full-length proteins in their native environment that have been fully post-translationally modified.

  14. Role of the AP-5 adaptor protein complex in late endosome-to-Golgi retrieval.

    Directory of Open Access Journals (Sweden)

    Jennifer Hirst

    2018-01-01

    Full Text Available The AP-5 adaptor protein complex is presumed to function in membrane traffic, but so far nothing is known about its pathway or its cargo. We have used CRISPR-Cas9 to knock out the AP-5 ζ subunit gene, AP5Z1, in HeLa cells, and then analysed the phenotype by subcellular fractionation profiling and quantitative mass spectrometry. The retromer complex had an altered steady-state distribution in the knockout cells, and several Golgi proteins, including GOLIM4 and GOLM1, were depleted from vesicle-enriched fractions. Immunolocalisation showed that loss of AP-5 led to impaired retrieval of the cation-independent mannose 6-phosphate receptor (CIMPR, GOLIM4, and GOLM1 from endosomes back to the Golgi region. Knocking down the retromer complex exacerbated this phenotype. Both the CIMPR and sortilin interacted with the AP-5-associated protein SPG15 in pull-down assays, and we propose that sortilin may act as a link between Golgi proteins and the AP-5/SPG11/SPG15 complex. Together, our findings suggest that AP-5 functions in a novel sorting step out of late endosomes, acting as a backup pathway for retromer. This provides a mechanistic explanation for why mutations in AP-5/SPG11/SPG15 cause cells to accumulate aberrant endolysosomes, and highlights the role of endosome/lysosome dysfunction in the pathology of hereditary spastic paraplegia and other neurodegenerative disorders.

  15. Utility of intraoperative and postoperative radiographs in pediatric cochlear implant surgery.

    Science.gov (United States)

    Anne, Samantha; Juarez, Jose Miguel; Shaffer, Amber; Eleff, David; Kitsko, Dennis; Sydlowski, Sarah; Woodson, Erika; Chi, David

    2017-08-01

    Routine plain film radiographs are often obtained to confirm proper placement of electrode after pediatric cochlear implant surgery. Objective is to evaluate necessity of routine radiographs in pediatric cochlear implant cases. Retrospective review. Two tertiary care academic centers. Review of all children that underwent cochlear implantation from January 2003 thru June 2015. Exclusions include patients without intraoperative evoked compound action potential (ECAP) data or radiographs and patients undergoing revision surgeries. 235 pediatric patients underwent 371 cochlear implants. ECAP measurements were not available in two cases and were excluded from study. Radiographs were obtained in 35/369 cases due to intraoperative concern and four had abnormal findings. All four cases underwent change in management. One other patient had an x-ray because of difficult insertion and abnormal ECAP. Radiograph was normal; however, incision was opened and electrodes inserted further. Overall, 5/369 cases had changes in management intraoperatively. In all five cases, abnormalities were suspected by clinician judgment or abnormal ECAP measurements. Routine radiographs were completed in 349/369 cases and one was abnormal. This patient had known partial insertion due to cochlear fibrosis from meningitis and abnormal radiograph did not result in change in management. Clinician suspicion and/or abnormal ECAP prompted suspicion for abnormal electrode placement prior to evaluation with radiograph in all cases in which change in management occurred. Intraoperative radiographs may be valuable in setting of clinical suspicion. Routine radiographs do not result in change in management and are, therefore, unnecessary. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Optimizing patient doses in radiographic examinations in the DRC: preliminary results

    International Nuclear Information System (INIS)

    Kazadi Kabuya, F.; Molua Aundu, A.; Ndombasi, Nzeza; Mbongo Tanzia, A.; Ngiulu Mazuka, B.; Kashiya Shiyapebe, S.; Muaka, M.J.; Musau, A.

    2008-01-01

    The aim of these investigations was to survey the quality of the radiographic images and the entrance air kerma (ESAK) to patients exposed to simple radiographic examinations and to perform comparisons with diagnostic reference levels (DRLs). Based on the working material provided by the IAEA under the framework of the Project RAF/9/033, in the form of a standardized questionnaire, image quality and patient dose levels were surveyed in 5 radiology departments in the city of Kinshasa. Film reject rate and film quality grading were carried out and causes for poor image quality investigated. Using x-ray tube output measurements and x-ray exposure parameters, the entrance surface doses to adult patients were determined in terms of ESAK. The resulting dose levels were compared with DRLs as an approach to the optimization and the potential for dose reduction. Poor quality images ranged 27% - 67% before implementation of QC tests. The image quality improvement up to 17% was achieved. Doses to Patients were below DRLs and varied by a factor of up to 8.2. The mean ESAK ranged 0.4 - 2.5 mGy (Chest PA), 2.5 - 9.5 mGy (Pelvis AP), 3 - 10.7 mGy (Lumbar Spine AP), and 2.6 - 9.6 mGy Abdomen AP) and. Reductions in Patient dose up to 47% were achieved. The patient doses are higher than doses in most countries participating to the Project although important reductions were recorded. Implementing QA programmes on a regular basis and specific training programme in medical imaging could increase the awareness on the quality of radiographic images and serve as an optimization tool. (author)

  17. A comparative analysis of magnetic resonance imaging and radiographic examinations of patients with atypical odontalgia.

    Science.gov (United States)

    Pigg, Maria; List, Thomas; Abul-Kasim, Kasim; Maly, Pavel; Petersson, Arne

    2014-01-01

    To examine (1) the occurrence of magnetic resonance imaging (MRI) signal changes in the painful regions of patients with atypical odontalgia (AO) and (2) the correlation of such findings to periapical bone defects detected with a comprehensive radiographic examination including cone beam computed tomography (CBCT). A total of 20 patients (mean age 52 years, range 34 to 65) diagnosed with AO participated. Mean pain intensity (± standard deviation) was 5.6 ± 1.8 on a 0-10 numerical rating scale, and mean pain duration was 4.3 ± 5.2 years. The inclusion criterion was chronic pain (> 6 months) located in a region with no clear pathologic cause identified clinically or in periapical radiographs. In addition to a clinical examination and a self-report questionnaire, the assessments included radiographic examinations (panoramic, periapical, and CBCT images), and an MRI examination. Changes in MRI signal in the painful region were recorded. Spearman's rank correlation between radiographic and MRI findings was calculated. Eight of the patients (40%) had MRI signal changes in the pain region. The correlation to radiographic periapical radiolucencies was 0.526 (P = .003). Of the eight teeth displaying changes in MRI signal, six showed periapical radiolucency in the radiographs. MRI examination revealed no changes in the painful region in a majority of patients with AO, suggesting that inflammation was not present. MRI findings were significantly correlated to radiographic findings.

  18. Building an AP Social Studies Program with Non-Traditional AP Students

    Science.gov (United States)

    Ashmead, Amanda; Blanchette, Sue

    2013-01-01

    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  19. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000...

  20. Visions of normality? Early experiences of radiographic reporting

    Energy Technology Data Exchange (ETDEWEB)

    Reeves, Pauline E-mail: pauline.reeves@whnt.nhs.uk

    2004-08-01

    This article reflects on my early [student] experiences in learning to undertake radiographic reporting and uses critical incidents to highlight two areas of error during this period. These errors include perceptual (optical illusions and, in particular, the Mach band effect) and lack of subject specific knowledge (specifically anatomical knowledge--especially of normal anatomical variants). These two errors are analysed in the wider context of radiological error and the difficulty in reaching consensus even between experienced reporters.

  1. Visions of normality? Early experiences of radiographic reporting

    International Nuclear Information System (INIS)

    Reeves, Pauline

    2004-01-01

    This article reflects on my early [student] experiences in learning to undertake radiographic reporting and uses critical incidents to highlight two areas of error during this period. These errors include perceptual (optical illusions and, in particular, the Mach band effect) and lack of subject specific knowledge (specifically anatomical knowledge--especially of normal anatomical variants). These two errors are analysed in the wider context of radiological error and the difficulty in reaching consensus even between experienced reporters

  2. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  3. Reflections on the role of consultant radiographers in the UK: what is a consultant radiographer?

    OpenAIRE

    Booth, Lisa; Henwood, Suzanne; Miller, Paul K.

    2016-01-01

    Context: This paper is the second paper from a two year in depth case study, exploring the role of consultant radiographers in the UK.\\ud \\ud Methods: A longitudinal case study approach was used to determine the role of consultant radiographers. Interviews were used to explore experiences of being a consultant, which were analysed using thematic analysis. Eight consultant radiographers participated (Note, two of the consultants withdrew after the first interview due to workload). Therefore tw...

  4. Radiation recommendation series: administratively required dental radiographs

    International Nuclear Information System (INIS)

    1981-09-01

    Administrative requirements for radiographs are found in many segments of the United States health care system. This document presents an FDA radiation recommendation on administratively required dental x-ray examinations. In general, such examinations are not requested to further the patient's dental health, but rather as a means of monitoring claims. However, the administrative use of radiographs that have been taken in the normal course of patient care is usually appropriate, as long as the patient's right to privacy is respected

  5. Modified Newman and Friedman Extraoral Radiographic Technique

    OpenAIRE

    Saberi, Eshagali; Hafezi, Ladan; Farhadmolashahi, Narges; Mokhtari, Manoochehr

    2012-01-01

    Introduction Good radiographs are required for endodontic therapy and because some patient’s are intolerant to intraoral films and/or sensors, this can cause complications in endodontic treatment. Extraoral film placement can be used to obtain clinically diagnostic and working radiographs. Materials and Methods The no. 2 receptor was placed against the model’s cheek and centered in the molar-premolar area. The central beam was directed toward this area from the opposite side. The vertical and...

  6. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    Energy Technology Data Exchange (ETDEWEB)

    Demetri, K. J.; Leipner, C. I.; Marshall, M. L., E-mail: demetrkj@westinghouse.com [Westinghouse Electric Company, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2015-09-15

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  7. The Westinghouse AP1000 plant design: a generation III+ reactor with unique proven passive safety technology

    International Nuclear Information System (INIS)

    Demetri, K. J.; Leipner, C. I.; Marshall, M. L.

    2015-09-01

    The AP1000 plant is an 1100-M We pressurized water reactor with passive safety features and extensive plant simplifications and standardization that simplify construction, operation, maintenance, safety, and cost. The AP1000 plant is based on proven pressurized water reactor (PWR) technology, with an emphasis on safety features that rely solely on natural forces. These passive safety features are combined with simple, active, defense-in-depth systems used during normal plant operations which also provide the first level of defense against more probable events. This paper focuses on specific safety and licensing topics: the AP1000 plant robustness to be prepared for extreme events that may lead to catastrophic loss of infrastructure, such as the Fukushima Dai-ichi event, and the AP1000 plant compliance with the safety objectives for new plants. The first deployment of the AP1000 plant formally began in July 2007 when Westinghouse Electric Company and its consortium partner, the Shaw Group, signed contracts for four AP1000 units on coastal sites of Sanmen and Haiyang, China. Both sites have the planned ability to accommodate at least six AP1000 units; construction is largely concurrent for all four units. Additionally, the United States (U.S.) Nuclear Regulatory Commission (NRC) issued combined licenses (COLs) to allow Southern Nuclear Operating Company (SNC) and South Carolina Electric and Gas Company (SCE and G) to construct and operate AP1000 plants. Within this paper, the various factors that contribute to an unparalleled level of design, construction, delivery, and licensing certainty for any new AP1000 plant projects are described. These include: 1) How the AP1000 plant design development and reviews undertaken in the United States, China and Europe increase licensing certainty. 2) How the AP1000 passive plant robustness against extreme events that result in large loss of infrastructure further contributes to the licensing certainty in a post

  8. Coverage of denture teeth with tin foil for radiographic guide fabrication.

    Science.gov (United States)

    Alhashim, Abdulmohsin; Chesla, Edward Robert

    2014-06-01

    A novel technique using the patient's existing complete dentures as a radiographic guide for diagnosis and treatment planning in implant dentistry is presented. Tin foil is used to cover the denture teeth before the radiographic scan is performed. Advantages of the described technique include its cost-effectiveness, simplicity, efficiency, and lack of need to modify or duplicate the patient's existing dentures. A disadvantage of the technique is that it serves only as a radiographic guide. © 2013 by the American College of Prosthodontists.

  9. Developing radiographer roles in the context of advanced and consultant practice.

    Science.gov (United States)

    Field, Lisa J; Snaith, Beverly A

    2013-03-01

    Skill-mix initiatives have provided opportunities for radiographers to develop roles and achieve their potential, thus contributing to radiographer retention rates and increased job satisfaction. This reflective article explores two radiographic roles within an interprofessional context including the implications for confidence, competence, and future sustainability. These were reporting roles which extended into two modalities, one into bone densitometry and another into ultrasound. This article discusses how successful skill mix can benefit the individual, their department, and NHS organization and that role expansion can develop a more dynamic and resourceful workforce with transferability of skills and attributes.

  10. Chesneys' radiographic imaging: revised and edited by John Ball and Tony Price. 5. ed.

    International Nuclear Information System (INIS)

    Chesney, D.N.

    1989-01-01

    This book (5th edition) reflects the change in emphasis in radiology from photographic processes towards electronic imaging methods. There is new material on image intensifiers and television imaging, digital imaging and digital subtractions. Analyses of the characteristics of, and defects in, images on radiographs, xeroradiographs and the television on screen are included. Methods, equipment and materials used to record the cathode ray tube image are described and there is new material on the principles of alternative diagnostic imaging techniques such as ultrasound, computed tomography and radionuclide imaging which provide cathode ray tube images. The book is primarily for student radiographers and radiographers studying for postdiplomate qualifications. (author)

  11. Developing radiographer roles in the context of advanced and consultant practice

    Energy Technology Data Exchange (ETDEWEB)

    Field, Lisa J; Snaith, Beverly A [Radiology Department, Mid Yorkshire Hospitals NHS Trust, Pinderfields Hospital, Aberford Road, Wakefield, WF1 4DG (United Kingdom)

    2013-03-15

    Skill-mix initiatives have provided opportunities for radiographers to develop roles and achieve their potential, thus contributing to radiographer retention rates and increased job satisfaction. This reflective article explores two radiographic roles within an interprofessional context including the implications for confidence, competence, and future sustainability. These were reporting roles which extended into two modalities, one into bone densitometry and another into ultrasound. This article discusses how successful skill mix can benefit the individual, their department, and NHS organization and that role expansion can develop a more dynamic and resourceful workforce with transferability of skills and attributes.

  12. Developing radiographer roles in the context of advanced and consultant practice

    International Nuclear Information System (INIS)

    Field, Lisa J; Snaith, Beverly A

    2013-01-01

    Skill-mix initiatives have provided opportunities for radiographers to develop roles and achieve their potential, thus contributing to radiographer retention rates and increased job satisfaction. This reflective article explores two radiographic roles within an interprofessional context including the implications for confidence, competence, and future sustainability. These were reporting roles which extended into two modalities, one into bone densitometry and another into ultrasound. This article discusses how successful skill mix can benefit the individual, their department, and NHS organization and that role expansion can develop a more dynamic and resourceful workforce with transferability of skills and attributes

  13. Normal xeroradiographic and radiographic anatomy of the bobwhite quail (Colinus virginianus), with reference to other galliform species

    International Nuclear Information System (INIS)

    Smith, B.J.; Smith, S.A.

    1991-01-01

    The purpose of this study was to provide a reference for xeroradiographic and conventional radiographic anatomy of the bobwhite quail (Colinus virginianus) as a representative of the avian order Galliformes. The heads, bodies, wings, and pelvic limbs of four adult birds were radiographed using xeroradiographic and conventional radiographic techniques. Nine xeroradiographs and their corresponding conventional radiographs were selected, and the xeroradiographs labeled to illustrate the normal anatomy of these regions. A xeroradiograph of the tarsometatarsus of the domestic peacock (Pavo cristatus) was also included to demonstrate the metatarsal spur, which is not present in the quail

  14. TinyCoAP: A Novel Constrained Application Protocol (CoAP Implementation for Embedding RESTful Web Services in Wireless Sensor Networks Based on TinyOS

    Directory of Open Access Journals (Sweden)

    Anna Calveras

    2013-05-01

    Full Text Available In this paper we present the design and implementation of the Constrained Application Protocol (CoAP for TinyOS, which we refer to as TinyCoAP. CoAP seeks to apply the same application transfer paradigm and basic features of HTTP to constrained networks, while maintaining a simple design and low overhead. The design constraints of Wireless Sensor Networks (WSNs require special attention in the design process of the CoAP implementation. We argue that better performance and minimal resource consumption can be achieved developing a native library for the operating system embedded in the network. TinyOS already includes in its distribution an implementation of CoAP called CoapBlip. However, this is based on a library not originally designed to meet the requirements of TinyOS. We demonstrate the effectiveness of our approach by a comprehensive performance evaluation. In particular, we test and evaluate TinyCoAP and CoapBlip in a real scenario, as well as solutions based on HTTP. The evaluation is performed in terms of latency, memory occupation, and energy consumption. Furthermore, we evaluate the reliability of each solution by measuring the goodput obtained in a channel affected by Rayleigh fading. We also include a study on the effects that high workloads have on a server.

  15. Radiographic signs and diagnosis of dental disease

    International Nuclear Information System (INIS)

    Bellows, J.

    1993-01-01

    Dental radiographs are critical for the complete assessment and treatment of dental diseases. Dental radiography is commonly used to evaluate congenital dental defects, periodontal disease, orthodontic manipulations, oral tumors, endodontic treatments, oral trauma, and any situation where an abnormality is suspected. Although standard radiographic equipment and film can be used to produce dental radiographs, dental X-ray equipment and film provide superior quality images and greater convenience of animal patient positioning. An understanding of normal dental radiographic anatomy is important when interpreting dental radiographs. Stage III periodontitis is the earliest stage of periodontal disease at which radiographic abnormalities become apparent. Bone loss associated with periodontal disease can be classified as either horizontal or vertical. Periapical radiolucencies can represent granulomas, cysts, or abscesses, whereas periapical radiodensities may represent sclerotic bone or condensing osteitis. Lytic lesions of the bone of the jaw often represent oral neoplasms. Neoplasms also can displace or disrupt teeth in the dental arch. Resorptive lesions can be external or internal and appear as radiolucent areas involving the external surface of the root or the pulp cavity, respectively. Feline dental resorptive lesions, also known as odontoclastic resorptions, are a specific form of dental resorptive lesions unique to cats

  16. An analysis of AP600 design features

    International Nuclear Information System (INIS)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author)

  17. Radiography of the knee joint: A comparative study of the standing partial flexion PA projection and the standing fully extended AP projection using visual grading characteristics (VGC)

    International Nuclear Information System (INIS)

    Farrugia Wismayer, E.; Zarb, F.

    2016-01-01

    Objectives: To compare the diagnostic information in detection and assessment of knee pathology from knee radiographs using either the PA standing with partial flexion projection or AP fully extended standing projection. Method: A set of 32 knee radiographs was retrospectively compiled from 16 adult patients imaged using both projections over a 2-year period (PA: n = 16 and AP: n = 16). Repeat radiographs (n = 6) were added to the image set facilitating inter and intra observer reliability. Image evaluation was performed by 5 orthopaedic surgeons performing Absolute Visual Grading Analysis assessing image quality based on 6 anatomical image quality criteria specifically developed to evaluate and compare the two projections. The resulting image quality scores were analysed using Visual Grading Characteristics. Results: Image quality scores were higher for the PA projection but variation between the two projections was not significant (p > 0.05). The PA projection was significantly (p < 0.05) better in the visualization of 2 anatomical image quality criteria involving the joint space width and tibial spines. Conclusion: Both projections can be used for general evaluation of the knee joint, however the PA partial flexion projection is preferred for the investigation of specific knee pathology. Recommendations for minimizing variations in radiographic positioning technique are also highlighted. - Highlights: • AP/PA radiographic knee projections are comparable for most clinical indications. • PA knee projection is better in visualizing joint space/tibial spines. • PA projection is more standardized if used with a positioning frame. • Use of anatomical criteria facilitates evaluation of quality of knee radiographs.

  18. First national study on patient exposure in radiographic procedure and references rates

    International Nuclear Information System (INIS)

    Vassileva, J.; Karadjov, A.; Ingilizova, H.; Dimov, A.; Slavchev, A.; Gfirtner, H.; Buchakliev, Z.; Ganchev, M.; Lichev, A.; Kostova, E.

    2003-01-01

    The results are presented from the first national study of the patient exposure in some common radiographic procedures of lungs, pelvis, lumbar vertebrae, skull, venous urography and mammography.The aim of the study is to obtain information about the patient doses in different hospitals in the country and to develop new reference levels for such procedures. Air chamber with thermoluminescent detector, fixed on the patient skin during the radiographic procedure has been used for the study except for the mammographic procedures, where a standard phantom has been used. The national reference levels has been determines using the methodology adopted in the European Union. The determined national referent level for air chamber in thoracic radiography is 0.9 mGy, which is 3 times greater than the European Union (0.3 mGy). The main cause of the difference is the use of 'soft' technique with anode voltage under 100 kV for the thoracic procedures, unlike the practice in the European Union (120-140 kV). For the rest of the procedures the reference levels coincide with those in european Union countries, which are: 10 mGy for pelvis /AP/, 10 mGy for lumbar vertebrae /AP/ and 30 for lumbar vertebrae /Lat/, 5 mGy for skull /AP/PA/ and 3 mGy for skull /Lat/, 10 mGy for venous urography /AP/, and 1.3 mGy for mammography. It is recommended the old film-folio combinations to be replaced by ones with a sensitivity class 100 or higher. For the optimization of the thoracic radiography anode voltage above 100kV are recommended

  19. Radiographic findings in the maxillary sinus: comparison of panoramic radiography with computed tomography.

    Science.gov (United States)

    Maestre-Ferrín, Laura; Galán-Gil, Sónnica; Carrillo-García, Celia; Peñarrocha-Diago, María

    2011-01-01

    To assess the prevalence of radiographic signs of maxillary sinus pathology in patients undergoing dental implant treatment and to compare the efficacy of panoramic radiography, computed tomography (CT), and three-dimensional (3D) CT with Implametric software in the diagnosis of sinus pathology. Thirty patients were selected at random from those being treatment-planned to receive implant-supported restorations in the maxilla and who had a panoramic radiograph, a conventional CT scan in acetate, and a 3D CT scan in digital format. The radiographic maxillary sinus findings were categorized as: (1) no sign of pathology, (2) mucosal thickening, (3) mucous cyst, or (4) occupation of the entire sinus. Seventeen women and 13 men were included, with a mean age of 50.9 years. There was a 38.3% prevalence of radiographic abnormalities (23.3% mucosal thickenings, 10% mucous cysts, and 5% occupation of the entire sinus). Of the 23 sinuses that displayed radiographic signs of pathology, only 1 (4.3%) was correctly diagnosed by the panoramic radiograph. The most common radiographic maxillary sinus finding was mucosal thickening, followed by mucous cysts and occupation of the whole sinus. Conventional CT can be considered a reliable method for the diagnosis of maxillary sinus pathology.

  20. Relationship between repository radiographic findings and subsequent performance of Quarter Horses competing in cutting events.

    Science.gov (United States)

    Barrett, Myra F; McIlwraith, C Wayne; Contino, Erin K; Park, Richard D; Kawcak, Christopher E; Frisbie, David D; zumBrunnen, James R

    2018-01-01

    OBJECTIVE To investigate potential associations between repository radiographic findings and subsequent performance of Quarter Horses competing in cutting events. DESIGN Retrospective cohort study. SAMPLE Repository radiographs (ie, radiographs obtained at the time of sale) for 343 client-owned horses. PROCEDURES Repository radiographic findings were compared with objective measures of performance, including the likelihood of competing; the likelihood of earning money as a 3-year-old, as a 4-year-old, and as a 3- and 4-year-old combined; and the amount of money earned as a 3-year-old, as a 4-year-old, and as a 3- and 4-year-old combined. RESULTS The presence of mild osteophytes involving the distal aspect of the tarsal joint was significantly associated with lower mean earnings as a 4-year-old. The presence of osteophytes on the dorsoproximal aspect of the middle phalanx of the hind limbs was significantly associated with an increased odds of earning money as a 4-year-old. Radiographic lesions of the medial femoral condyle of the stifle joint were not significantly associated with subsequent performance. CONCLUSIONS AND CLINICAL RELEVANCE Most abnormalities identified on repository radiographs were not significantly associated with subsequent performance. The significant association between mild tarsal osteophytosis and earnings was unexpected. Results of the present study indicated the need for further investigation of the relationship between radiographic findings and performance outcome in Western performance horses.

  1. The Value of Periapical Radiograph in the Diagnosis of Interproximal Caries

    International Nuclear Information System (INIS)

    KIm, Young Hee; Kang, Byung Chul

    2000-01-01

    To compare the diagnostic performance of clinical and radiologic examination for the interproximal caries on intraoral periapical radiographs and to evaluate the value of periapical radiographs. One hundred seven dental patients were examined clinically, with a mouth mirror and an explorer, by a dentist at the department of oral medicine, and the presence or absence of interproximal caries lesion was recorded. The patients were prescribed one or more dental periapical radiographs. Radiographs were assessed for the presence of interproximal caries by three radiologists independently. Two thousand sixty interproximal surfaces were included in this study. The diagnostic accuracies of clinical and radiologic examinations for interproximal caries were calculated. To assess the degree of agreement between clinical and radiologic examinations, Cohen's coefficient of agreement was computed. The specificity of clinical and radiologic examination was 0.991, 0.997 and the sensitivity was 0.279, 0.985 respectively. The diagnostic accuracy of radiologic examination was statistically significantly higher than that of clinical examination (P<0.05). Cohen's kappa value of clinical and radiologic examination was 0.335, 0.942 respectively. These results suggested that clinical examination show only fair agreement, whereas radiologic examination show perfect agreement. The diagnostic performance of the dental periapical radiographs on interproximal caries were higher than that of clinical examination, thus this study showed the validity of periapical radiographs for detecting interproximal caries lesion without bitewing radiograph.

  2. The Value of Periapical Radiograph in the Diagnosis of Interproximal Caries

    Energy Technology Data Exchange (ETDEWEB)

    KIm, Young Hee; Kang, Byung Chul [Dept. of Oral and Maxillofacial Radiology, College of Dentistry, Chonnam National University, Kwangju (Korea, Republic of)

    2000-03-15

    To compare the diagnostic performance of clinical and radiologic examination for the interproximal caries on intraoral periapical radiographs and to evaluate the value of periapical radiographs. One hundred seven dental patients were examined clinically, with a mouth mirror and an explorer, by a dentist at the department of oral medicine, and the presence or absence of interproximal caries lesion was recorded. The patients were prescribed one or more dental periapical radiographs. Radiographs were assessed for the presence of interproximal caries by three radiologists independently. Two thousand sixty interproximal surfaces were included in this study. The diagnostic accuracies of clinical and radiologic examinations for interproximal caries were calculated. To assess the degree of agreement between clinical and radiologic examinations, Cohen's coefficient of agreement was computed. The specificity of clinical and radiologic examination was 0.991, 0.997 and the sensitivity was 0.279, 0.985 respectively. The diagnostic accuracy of radiologic examination was statistically significantly higher than that of clinical examination (P<0.05). Cohen's kappa value of clinical and radiologic examination was 0.335, 0.942 respectively. These results suggested that clinical examination show only fair agreement, whereas radiologic examination show perfect agreement. The diagnostic performance of the dental periapical radiographs on interproximal caries were higher than that of clinical examination, thus this study showed the validity of periapical radiographs for detecting interproximal caries lesion without bitewing radiograph.

  3. Panel Discussion : Report of the APS Ad-Hoc Committee on LGBT Issues

    Science.gov (United States)

    Atherton, Tim; Barthelemy, Ramon; Garmon, Savannah; Reeves, Kyle; APS Ad-Hoc Committee on LGBT Issues Team

    Following the presentation of the findings and recommendations of the APS Ad-Hoc Committee on LGBT Issues (C-LGBT) by Committee Chair Michael Falk, a panel discussion will be held featuring several members of the committee. The discussion will focus on how APS can best ensure the recommendations of the committee are carried out in a timely fashion and other ideas on future APS efforts toward LGBT inclusion in physics. Discussion topics will also include the research and other input that shaped the committee's findings and recommendations.

  4. Characteristics and application study of AP1000 NPPs equipment reliability classification method

    International Nuclear Information System (INIS)

    Guan Gao

    2013-01-01

    AP1000 nuclear power plant applies an integrated approach to establish equipment reliability classification, which includes probabilistic risk assessment technique, maintenance rule administrative, power production reliability classification and functional equipment group bounding method, and eventually classify equipment reliability into 4 levels. This classification process and result are very different from classical RCM and streamlined RCM. It studied the characteristic of AP1000 equipment reliability classification approach, considered that equipment reliability classification should effectively support maintenance strategy development and work process control, recommended to use a combined RCM method to establish the future equipment reliability program of AP1000 nuclear power plants. (authors)

  5. Radiographic Predictors for Mechanical Failure After Adult Spinal Deformity Surgery

    DEFF Research Database (Denmark)

    Hallager, Dennis W; Karstensen, Sven; Bukhari, Naeem

    2017-01-01

    STUDY DESIGN: Retrospective cohort study at a single institution. OBJECTIVE: We aimed at estimating the rate of revision procedures and identify radiographic predictors of mechanical failure after adult spinal deformity surgery. SUMMARY OF BACKGROUND DATA: Mechanical failure rates after adult......°, the role of radiographic sagittal spine parameters and alignment targets as predictors for mechanical failure remains uncertain. METHODS: A consecutive cohort of adult spinal deformity patients who underwent corrective surgery with at least 5 levels of instrumentation between January 2008 and December 2012...... at a single tertiary spine unit were followed for at least 2 years. Time to death or failure was recorded and cause-specific Cox regressions were applied to evaluate predictors for mechanical failure or death. RESULTS: A total of 138 patients with median age of 61 years were included for analysis. Follow up...

  6. Stepped scanner radiographic imaging system using edge blending

    International Nuclear Information System (INIS)

    Lapidus, S.N.

    1984-01-01

    An imaging system is described which includes a radiographic camera, a bed for supporting a subject in view of the camera, and a display system. The camera provides X and Y coordinate signals for each radiographic event. The position of the bed relative to the camera is altered stepwise and a sequence of images is provided by the camera each image being positioned on a display system in correspondence with the location of the bed relative to the camera. The camera is electronically decoupled from the display by a gate during movement of the bed relative to the camera from one location to the next location to prevent any smearing effect within the composite image presented on the display. The edges of contiguous images making up the composite image are blended by electronically adjusting their boundary regions so as to provide overlapping or interlocking. (author)

  7. Post traumatic stress disorder and the forensic radiographer

    International Nuclear Information System (INIS)

    Glaysher, E.; Vallis, J.; Reeves, P.

    2016-01-01

    The term post traumatic stress disorder (PTSD) is used to describe the psychological issues resulting from any traumatic event. An individual's ability to function is impaired by experiencing emotional responses to a traumatic event. Forensic radiographers need to be aware of the potential debilitating effects of this condition and those writing forensic protocols must take the condition into account and build in safeguards and welfare strategies. This narrative review looks at the origins of the term PTSD and highlights those who may be at increased risk of developing the condition including, in particular, forensic radiographers involved in mass fatality work. Signs, symptoms and possible treatments are also reviewed. - Highlights: • Presents a summary of PTSD for those working in forensic radiography. • Outlines signs & symptoms of PTSD. • Discusses treatment & prognosis of PTSD. • Suggests ways of managing factors which may predispose to PTSD.

  8. Advanced radiographic practice - the legal aspects

    International Nuclear Information System (INIS)

    Alderson, C.J.; Hogg, P.

    2003-01-01

    Allied health and nursing professionals are continuing to expand their responsibilities into clinical areas outside their traditional spheres of interest; typically, many of these new responsibilities are found within the medical (doctor) domain. Such responsibilities are often at an advanced clinical level and consequently higher demands are placed upon the professionals, not least in terms of clinical updating, competence to practice and also legal liability. This article explores the legal implications of practising at an advanced clinical level with particular reference to legal claims. The first part of the article commences with an outline of pertinent law in England and Wales. The latter part of the article explores actual cases from which allied health professionals (eg radiographers) can gain valuable information. Throughout the article suggestions for good practice are indicated. Examples of good practice include: the need to base your practice on evidence and peer practice; the need to keep detailed records (protocols) of such practice; the need to know when you are at the limit of your ability; and as such when to ask for advice from a medical practitioner/radiologist

  9. Tank 241-AP-107 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107

  10. The Promise of AP World History

    Science.gov (United States)

    Saldaña, Cristóbal T.

    2013-01-01

    AP World History is the ideal history course. It introduces students to 10,000 years of world history, and demands critical reading, critical writing, and critical thinking skills on the part of both the teacher and the students. It requires students to build their expertise in reading their textbook, and places demands on the teacher to assign…

  11. Meet the Editors of APS Reception

    Science.gov (United States)

    The Editors of the APS journals invite you to join them for conversation on Tuesday, March 15, 4:30-6:00 pm. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  12. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  13. Asteroseismic Theory of Rapidly Oscillating Ap Stars

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 26; Issue 2-3. Asteroseismic Theory of Rapidly Oscillating Ap Stars. Margarida S. Cunha. Volume 26 Issue 2-3 June-September 2005 pp 213-221. Fulltext. Click here to view fulltext PDF. Permanent link:

  14. Radioactive air emissions notice of construction for installation and operation of a waste retrieval system and tanks 241-AP-102 and 241-AP-104 project

    International Nuclear Information System (INIS)

    DEXTER, M.L.

    1999-01-01

    This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246 247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61 07 for the installation and operation of one waste retrieval system in the 24 1 AP-102 Tank and one waste retrieval system in the 241 AP 104 Tank Pursuant to 40 CFR 61 09 (a)( 1) this application is also intended to provide anticipated initial start up notification Its is requested that EPA approval of this application will also constitute EPA acceptance of the initial start up notification Project W 211 Initial Tank Retrieval Systems (ITRS) is scoped to install a waste retrieval system in the following double-shell tanks 241-AP 102-AP 104 AN 102, AN 103, AN-104, AN 105, AY 102 AZ 102 and SY-102 between now and the year 2011. Because of the extended installation schedules and unknowns about specific activities/designs at each tank, it was decided to submit NOCs as that information became available This NOC covers the installation and operation of a waste retrieval system in tanks 241 AP-102 and 241 AP 104 Generally this includes removal of existing equipment installation of new equipment and construction of new ancillary equipment and buildings Tanks 241 AP 102 and 241 AP 104 will provide waste feed for immobilization into a low activity waste (LAW) product (i.e. glass logs) The total effective dose equivalent (TEDE) to the offsite maximally exposed individual (MEI) from the construction activities is 0 045 millirem per year The unabated TEDE to the offsite ME1 from operation of the mixer pumps is 0 042 millirem per year

  15. Retreatment or radiographic monitoring in endodontics.

    Science.gov (United States)

    Van Nieuwenhuysen, J P; Aouar, M; D'Hoore, W

    1994-03-01

    The aim of this clinical study was to assess 1032 endodontically treated roots in relation to: (i) the success rate of retreatment (612 roots)--only cases that had recall examinations of 6 months or longer were evaluated; (ii) the influence of various factors on the technical and clinical results of the retreatment; and (iii) the consequences of radiographic monitoring of 420 asymptomatic roots when the root filling was radiographically deficient (short, overextended and/or permeable root fillings). Technical assessment of the retreatment showed that the root was adequately sealed in 52.3% of cases, the root filling was improved in 33.8%, was identical with the initial treatment in 11.1% and was worse than the first treatment in 2.8% of the canals. Clinical assessment of the retreatment of symptomatic roots showed that 71.8% of the retreatments were judged successful, 18.9% showed some healing and 9.3% had failed. The initial size of the periapical lesion, the use of rubber dam, the root filling technique and the apical level of the root filling had a statistically significant influence on the result of the retreatment. Monitoring radiographically (median time span 6 years) led to maintenance of the status quo in 94.8% of cases, healing in 2.4% and failure in 2.8% of the canals. Retreatment is clearly indicated when periapical radiolucency, clinical signs and/or symptoms are present with relative success of up to 91%. When no or little radiographic evidence of periapical pathology was present, when clinical signs and symptoms were absent or when the root filling was radiographically deficient, radiographic monitoring led to complications in only a limited number of cases. clinical decision, endodontic retreatment, radiographic evaluation.

  16. Knowledge of practising radiographers of the supraspinatus outlet projection for shoulder impingement syndrome in the Eastern Cape, South Africa

    International Nuclear Information System (INIS)

    Williams, R.; Morton, D.G.

    2016-01-01

    Background/Aim: There are many projections in plain film imaging to demonstrate the specific aspects of the anatomy of the shoulder. However, reproducing the required projections can be challenging especially if radiographers are not familiar with the projections and their evaluation criteria. The aim of the study was to explore and describe the knowledge of practising radiographers regarding the supraspinatus outlet projection for shoulder impingement syndrome. Method: A quantitative, exploratory and descriptive design was followed. The population served as the sample and included all the practising radiographers in the public and private hospitals of a metropolitan municipality in the Eastern Cape, South Africa. A total of 84 respondents completed the structured, self-administered questionnaire. Results: The data revealed that in many cases, the majority of radiographers in the study, due to inadequate knowledge levels would not be able to produce an optimal radiographic image of the supraspinatus outlet. The results of the chi-squares indicated statistically significant differences (p < 0.05) between public and private hospitals regarding certain aspects of the scapular Y projection and SOP. Conclusion: It was found that the radiographers in the study had inadequate knowledge of scapular Y projections and SOPs in relation to SIS. Therefore, it is essential to ensure that radiographers are updated on their knowledge of radiographic practice on a continuous basis. - Highlights: • Many radiographers unable to produce an optimal image of the supraspinatus outlet. • Radiographers had poor knowledge of scapular Y and supraspinatus outlet projections. • It is essential that radiographers update their knowledge of radiographic practice.

  17. Core competencies of radiographers working in rural hospitals of KwaZulu-Natal, South Africa

    Directory of Open Access Journals (Sweden)

    Bernard Mung'omba

    2017-01-01

    Full Text Available Introduction: Rural radiographers require, over and above traditional radiographic expertise, additional competencies which to a certain degree are unique however not limited to rural practice. Previous studies, however, have focused more attention primarily on other rural health professionals such as doctors and nurses leaving a research need in this field. This article focuses on the additional competencies that may be required for rural radiographers.Aim: To investigate and identify additional core competencies required by radiographers working in rural hospitals of KwaZulu-Natal in order to propose a continuous professional development strategy aimed at rural radiographers.Methods: An exploratory sequential design was utilised with qualitative (Phase I and quantitative (Phase II strands involving seven participants and 109 respondents, respectively. Only radiographers working in rural KwaZulu-Natal hospitals were included in the study. The four major themes and categories identified in Phase I were used to develop data collection instrument for Phase II of the study.Results: Collectively, the results revealed that there were a number of additional core competencies such as, but not limited to, teamwork, ability to do basic obstetric ultrasound scans, leadership, management and reporting on plain radiographs, all of which are required by rural radiographers. In 2014 when these competencies were checked against a single curriculum, it was found that majority of them were either partially covered or not at all covered.Conclusion: The study provides additional information on context specific core competencies and, therefore, may act as a catalyst to influence the future of radiographers working in rural areas of South Africa.

  18. The Reliability of the Symax Method of Measuring the Radiographic Femoral Varus Angle

    OpenAIRE

    Allpass, Maja; Miles, James Edward; Schmökel, Hugo

    2014-01-01

    Objective: To determine the practicability of curved osteotomy to correct femoral varus in small breed dogs, and to assess the reliability of the Symax method of measuring the radiographic femoral varus angle (FVA). Methods: Eleven cadaveric femora plus one clinical case were included in this study. The FVA was measured using the Symax method on craniocaudal femoral radiographs. CORA principles were used to plan the curved osteotomy. Following osteotomy and planned correction of the FVA to 0º...

  19. Work plan, AP-102 mixer pump removal and pump replacement

    International Nuclear Information System (INIS)

    Jimenez, R.F.

    1994-01-01

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  20. Chest Radiographic Findings of Novel Swine-Origin Influenza A (H1N1) Virus Infection in Children

    Energy Technology Data Exchange (ETDEWEB)

    Bae, So Young; Hong, Eun Sook; Paik, Sang Hyun; Park, Seong Jin; Cha, Jang Gyu; Lee, Hae Kyung [Dept. of Radiology, Soonchunhyang University Bucheon Hospital, Bucheon (Korea, Republic of); Jang, Yun Woo [Dept. of Radiology, Soonchunhyang University Hospital, Seoul (Korea, Republic of)

    2011-06-15

    To analyze chest radiographic findings in children infected with laboratory confirmed novel swine-origin influenza A (H1N1) virus. Three hundred seventy-two out of 2,014 children with laboratory confirmed H1N1 infection and who also underwent a chest radiograph from September to November 2009 were enrolled in this study. Patients were divided into in-patients, out-patients, and patients with co-infections and further subdivided into with underlying disease and without underlying disease as well as age (<2 years old, 2-5 years, 5-10 years, 10-18 years old). The initial radiographs were evaluated for radiographic findings and the anatomic distribution of abnormalities. The initial radiographs were abnormal in 154 (41.39%) patients. The predominant radiographic findings were peribronchial wall opacity found in 85 (22.84%) patients and hyperinflation observed in 69 (18.54%) patients. Further, 75 (71.42%) patients exhibited central predominance and the right lower lung zone was also commonly involved. There were statistically significant differences in the radiological findings between in-patient and out-patient groups. However, there were no significant differences in the radiographic findings between in-patients and the co-infection group with respect the presence of underlying disease and age. Initial radiographs of children with laboratory confirmed H1N1 virus were abnormal in 41.39% of cases. The common radiographic findings included peribronchial opacities, hyperinflation, lower lung zonal distribution, and central predominance

  1. Chest Radiographic Findings of Novel Swine-Origin Influenza A (H1N1) Virus Infection in Children

    International Nuclear Information System (INIS)

    Bae, So Young; Hong, Eun Sook; Paik, Sang Hyun; Park, Seong Jin; Cha, Jang Gyu; Lee, Hae Kyung; Jang, Yun Woo

    2011-01-01

    To analyze chest radiographic findings in children infected with laboratory confirmed novel swine-origin influenza A (H1N1) virus. Three hundred seventy-two out of 2,014 children with laboratory confirmed H1N1 infection and who also underwent a chest radiograph from September to November 2009 were enrolled in this study. Patients were divided into in-patients, out-patients, and patients with co-infections and further subdivided into with underlying disease and without underlying disease as well as age (<2 years old, 2-5 years, 5-10 years, 10-18 years old). The initial radiographs were evaluated for radiographic findings and the anatomic distribution of abnormalities. The initial radiographs were abnormal in 154 (41.39%) patients. The predominant radiographic findings were peribronchial wall opacity found in 85 (22.84%) patients and hyperinflation observed in 69 (18.54%) patients. Further, 75 (71.42%) patients exhibited central predominance and the right lower lung zone was also commonly involved. There were statistically significant differences in the radiological findings between in-patient and out-patient groups. However, there were no significant differences in the radiographic findings between in-patients and the co-infection group with respect the presence of underlying disease and age. Initial radiographs of children with laboratory confirmed H1N1 virus were abnormal in 41.39% of cases. The common radiographic findings included peribronchial opacities, hyperinflation, lower lung zonal distribution, and central predominance

  2. AP1000{sup R} licensing and deployment in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, R. P.; Russ, P. A.; Filiak, P. P.; Castiglione, L. L. [Westinghouse Electric Company LLC, 1000 Westinghouse Drive, Cranberry Township, PA 16066 (United States)

    2012-07-01

    actions directed towards deployment. AP1000 Design Certification and COL deployment, and management of the plant construction in accordance with the conditions within these approvals, remain as significant site and corporate responsibilities. These licensing-construction integrated activities must now focus on identifying and resolving 'as-built' departures from the standardized design as assessed against the certified AP1000 technical and licensing basis. Within this paper, significant aspects of the AP1000 U.S. licensing will be discussed, including identifying systems and processes used in ensuring compliance while deploying the standardized design. Critical licensing steps, licensing deployment actions as plant construction progresses and defining the road forward to a successful completion of licensing actions will be addressed. (authors)

  3. Radiographic testing - optimum radiographs of plastics and composite materials with dosimeter control

    International Nuclear Information System (INIS)

    Kuster, J.

    1978-01-01

    In view of great differencies in X-ray transmission it is more difficult to get optimum radiographs of plastics and especially of reinforced plastics than for example of metals. A procedure will be reported how to get with little effort optimum radiographs especially also in the range of long wavelength radiation corresponding 10 to 25 kV.P. (orig.) [de

  4. Australian rural radiographers' perspectives on disclosure of their radiographic opinion to patients

    International Nuclear Information System (INIS)

    Squibb, Kathryn; Bull, Rosalind M.; Smith, Anthony; Dalton, Lisa

    2015-01-01

    The role of Australian rural radiographers in radiographic interpretation, communication and disclosure of their radiographic opinion with a specific focus on plain film radiography was examined in a two phase, exploratory interpretive study. Data were collected using questionnaires and interviews and analysed thematically. This reports one of the key themes identified in the thematic data analysis. ‘Disclosure of Radiographic Opinion to Patients’ comprises the three interrelated sub-themes Acting Ethically, Selective Disclosure and Filtered Truth. It is wholly concerned with the ways in which rural radiographers choose to disclose their radiographic opinion to patients. Without a clear picture of where they stand medico-legally, rural radiographers draw on experience and a strong ethical framework as the basis for these complex decisions. Rural radiographers frame their disclosures to patients in a manner that is governed by the diagnostic, therapeutic and emotional impact the information disclosed may have on the patient. Disclosure to patients was found to be selective, often diagnostically vague and ethically filtered

  5. The Role of the Clathrin Adaptor AP-1: Polarized Sorting and Beyond

    Directory of Open Access Journals (Sweden)

    Fubito Nakatsu

    2014-11-01

    Full Text Available The selective transport of proteins or lipids by vesicular transport is a fundamental process supporting cellular physiology. The budding process involves cargo sorting and vesicle formation at the donor membrane and constitutes an important process in vesicular transport. This process is particularly important for the polarized sorting in epithelial cells, in which the cargo molecules need to be selectively sorted and transported to two distinct destinations, the apical or basolateral plasma membrane. Adaptor protein (AP-1, a member of the AP complex family, which includes the ubiquitously expressed AP-1A and the epithelium-specific AP-1B, regulates polarized sorting at the trans-Golgi network and/or at the recycling endosomes. A growing body of evidence, especially from studies using model organisms and animals, demonstrates that the AP-1-mediated polarized sorting supports the development and physiology of multi-cellular units as functional organs and tissues (e.g., cell fate determination, inflammation and gut immune homeostasis. Furthermore, a possible involvement of AP-1B in the pathogenesis of human diseases, such as Crohn’s disease and cancer, is now becoming evident. These data highlight the significant contribution of AP-1 complexes to the physiology of multicellular organisms, as master regulators of polarized sorting in epithelial cells.

  6. Enhancing AP1000 reactor accident management capabilities for long term accidents

    International Nuclear Information System (INIS)

    Jiang Pingting; Liu Mengying; Duan Chengjie; Liao Yehong

    2015-01-01

    Passive safety actions are considered as main measures under severe accident in AP1000 power plant. However, risk is still existed. According to PSA, several probable scenarios for AP1000 nuclear power plant are analyzed in this paper with MAAP the severe accident analysis code. According to the analysis results, several deficiencies of AP1000 severe accident management are found. The long term cooling and containment depressurization capability for AP1000 power plant appear to be most important factors under such accidents. Then, several temporary strategies for AP1000 power plant are suggested, including PCCWST temporary water supply strategy after 72h, temporary injection strategy for IRWST, hydrogen relief action in fuel building, which would improve the safety of AP1000 power plant. At last, assessments of effectiveness for these strategies are performed, and the results are compared with analysis without these strategies. The comparisons showed that correct actions of these strategies would effectively prevent the accident process of AP1000 power plant. (author)

  7. Postural tachycardia syndrome (POTS) and other autonomic disorders in antiphospholipid (Hughes) syndrome (APS).

    Science.gov (United States)

    Schofield, J R; Blitshteyn, S; Shoenfeld, Y; Hughes, G R V

    2014-06-01

    Antiphospholipid syndrome (APS) is an autoimmune hypercoagulable disorder that has been shown to cause a large number of cardiac and neurological manifestations. Two recent studies have demonstrated abnormalities in cardiovascular autonomic function testing in APS patients without other cardiovascular or autoimmune disease. However, an association between autonomic disorders such as postural tachycardia syndrome and APS has not previously been described. Data were obtained by retrospective chart review. We identified 15 patients who have been diagnosed with APS and an autonomic disorder. The median age of the patients at the time of data analysis was 39 years. The autonomic disorders seen in these patients included postural tachycardia syndrome, neurocardiogenic syncope and orthostatic hypotension. The majority of patients (14/15) were female and the majority (14/15) had non-thrombotic neurological manifestations of APS, most commonly migraine, memory loss and balance disorder. Many also had livedo reticularis (11/15) and Raynaud's phenomenon (nine of 15). In some patients, the autonomic manifestations improved with anticoagulation and/or anti-platelet therapy; in others they did not. Two patients with postural tachycardia syndrome who failed to improve with the usual treatment of APS have been treated with intravenous immunoglobulin with significant improvement in their autonomic symptoms. We believe that autonomic disorders in APS may represent an important clinical association with significant implications for treatment. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  8. Radiographic study on temporomandibular joint Arthrosis

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Dong Soo [Dept. of Radiology, College of Dentistry, Seoul National University , Seoul (Korea, Republic of)

    1980-11-15

    The author analysed the routine radiographic changes and clinical symptoms of 205 cases of temporomandibular joint arthrosis. The clinical symptoms of the patients were classified and the morphological changes of condylar head, articular eminence, and articular fossa were analyzed and discussed from radiographic view point. The positional change of condylar head and articular fossa relation in TMJ arthrosis were observed. The frequencies of coincidence between the site of complaints and the site of the abnormal images which could be detected were examined. The results were obtained as follows; 1. Bone erosion, deformity, marginal proliferation and sclerosis were selected from many abnormal images as the radiographic diagnostic criteria of TMJ arthritic lesions. 2. Abnormal radiographic findings were revealed in 150 cases (73.9%) of 205 total TMJ arthrosis cases and site with abnormal findings coincided with the site of complaints in 105 cases (70.7%) of 150 cases and coincidence rates were higher above fourth decades than below third decades. 3. Sclerosis of the abnormal radiographic findings could be found more often below third decades than above fourth decades. 4. The positional changes of condylar head were revealed in 176 cases (85.9%) of 205 total cases. 5. Pain complaints were revealed in 170 cases(82.9%) and clicking sounds were revealed in 120 cases (58.6%) of clinical symptoms of TMJ arthrosis. 6. No tendency was found so far the differential diagnosis between pain dysfunction syndrome and osteoarthrosis of TMJ.

  9. Radiographic study on temporomandibular joint Arthrosis

    International Nuclear Information System (INIS)

    Yoo, Dong Soo

    1980-01-01

    The author analysed the routine radiographic changes and clinical symptoms of 205 cases of temporomandibular joint arthrosis. The clinical symptoms of the patients were classified and the morphological changes of condylar head, articular eminence, and articular fossa were analyzed and discussed from radiographic view point. The positional change of condylar head and articular fossa relation in TMJ arthrosis were observed. The frequencies of coincidence between the site of complaints and the site of the abnormal images which could be detected were examined. The results were obtained as follows; 1. Bone erosion, deformity, marginal proliferation and sclerosis were selected from many abnormal images as the radiographic diagnostic criteria of TMJ arthritic lesions. 2. Abnormal radiographic findings were revealed in 150 cases (73.9%) of 205 total TMJ arthrosis cases and site with abnormal findings coincided with the site of complaints in 105 cases (70.7%) of 150 cases and coincidence rates were higher above fourth decades than below third decades. 3. Sclerosis of the abnormal radiographic findings could be found more often below third decades than above fourth decades. 4. The positional changes of condylar head were revealed in 176 cases (85.9%) of 205 total cases. 5. Pain complaints were revealed in 170 cases(82.9%) and clicking sounds were revealed in 120 cases (58.6%) of clinical symptoms of TMJ arthrosis. 6. No tendency was found so far the differential diagnosis between pain dysfunction syndrome and osteoarthrosis of TMJ.

  10. Radiographers' preconditions for evidence-based radiography

    International Nuclear Information System (INIS)

    Ahonen, Sanna-Mari; Liikanen, Eeva

    2010-01-01

    Evidence-based practice (EBP) is essential in today's health care, but its establishment requires several preconditions from individuals and organizations (e.g. knowledge, understanding, attitudes, abilities, self-confidence, support, and resources). Previous studies suggest that radiographers do generate and use evidence in their work, but evidence-based radiography (EBR) is not yet used routinely as established practice, especially in terms of research utilization. This paper aims to describe radiographers' preconditions for EBR, and their participation in research activities. Main focus is on research utilization. Using an electronic questionnaire developed for this study, a survey was conducted: data collected from Finnish radiographers and radiotherapists (N = 438) were analysed both statistically and qualitatively. The final response rate was 39%. The results suggest radiographers' preconditions for EBR to consist of knowledge of research, significance of research activities, research-orientated way of working, and support. In addition, adequate resourcing is essential. Reading scientific journals, participation in research activities, a higher degree of education, and senior post seem to be significant promoters of EBR and research utilization. The results support the notion that EBR, and especially research utilization, are not yet well-established in Finland, and radiographers' viewpoints concerning the role and significance of research evidence and research activities still seem to vary.

  11. Radiographic anatomy of juvenile bovine limbs.

    Science.gov (United States)

    Hoey, S E; Biedrzycki, A H; Livesey, M J; Drees, R

    2016-11-26

    Juvenile bovine patients who present with clinical signs of lameness are commonly evaluated using radiographic techniques both within a hospital setting and in a farm environment. The radiographic development of the juvenile bovine skeleton is currently poorly documented. In this study, the limbs of four heifer calves were sequentially radiographed to assess development of the juvenile bovine appendicular skeleton in the first 12 months of life. Images were acquired at three weeks, three months, six months, nine months and one year of age. The normal radiographic anatomy of the fore limbs and hindlimbs and the changes over the first 12 months are described. The majority of physes remain open throughout this period, with the exception of the proximal physes of the proximal and middle phalanges, the proximal radial physis, and the proximal humeral physis which close radiographically between 9 months and 12 months of age, and fusion of the fourth and central tarsal bones occurs between 9 months and 12 months of age. The results of this study may aid in differentiating normal and abnormal anatomy in the juvenile bovine limb. British Veterinary Association.

  12. Diagnosis of hydrostatic versus increased permeability pulmonary edema with chest radiographic criteria in critically ILL patients

    International Nuclear Information System (INIS)

    Aberle, D.R.; Wiener-Kronish, J.P.; Webb, W.R.; Matthay, M.A.

    1987-01-01

    To evaluate chest radiographic criteria in distinguishing mechanisms of pulmonary edema, the authors studied 45 intubated patients with extensive edema. Edema type was clinically classified by the ratio of alveolar edema-to-plasma protein concentration in association with compatible clinical/hemodynamic parameters. Chest films were scored as hydrostatic, permeability, or mixed by three readers in blinded fashion based on cardiac size, vascular pedicle width, distribution of edema, effusions, peribronchial cuffs, septal lines, or air bronchograms. Overall radiographic score accurately identified 87% of patients with hydrostatic edema but only 60% of those with permeability edema. Edema distribution was most discriminating, with a patchy peripheral pattern relatively specific for clinical permeability edema. Hydrostatic features on chest radiograph were common with permeability edema, including effusions (36%), widened pedicle (56%), cuffs (72%), or septa (40%). The authors conclude that the chest radiograph is limited in distinguishing edema mechanism in the face of extensive pulmonary edema

  13. TNF blockers inhibit spinal radiographic progression in ankylosing spondylitis by reducing disease activity

    DEFF Research Database (Denmark)

    Molnar, Christoph; Scherer, Almut; Baraliakos, Xenofon

    2018-01-01

    OBJECTIVES: To analyse the impact of tumour necrosis factor inhibitors (TNFis) on spinal radiographic progression in ankylosing spondylitis (AS). METHODS: Patients with AS in the Swiss Clinical Quality Management cohort with up to 10 years of follow-up and radiographic assessments every 2 years...... were included. Radiographs were scored by two readers according to the modified Stoke Ankylosing Spondylitis Spine Score (mSASSS) with known chronology. The relationship between TNFi use before a 2-year radiographic interval and progression within the interval was investigated using binomial...... generalised estimating equation models with adjustment for potential confounding and multiple imputation of missing values. Ankylosing Spondylitis Disease Activity Score (ASDAS) was regarded as mediating the effect of TNFi on progression and added to the model in a sensitivity analysis. RESULTS: A total...

  14. An Algorithm for Data Hiding in Radiographic Images and ePHI/R Application

    Directory of Open Access Journals (Sweden)

    Aqsa Rashid

    2018-01-01

    Full Text Available Telemedicine is the use of Information and Communication Technology (ICT for clinical health care from a distance. The exchange of radiographic images and electronic patient health information/records (ePHI/R for diagnostic purposes has the risk of confidentiality, ownership identity, and authenticity. In this paper, a data hiding technique for ePHI/R is proposed. The color information in the cover image is used for key generation, and stego-images are produced with ideal case. As a result, the whole stego-system is perfectly secure. This method includes the features of watermarking and steganography techniques. The method is applied to radiographic images. For the radiographic images, this method resembles watermarking, which is an ePHI/R data system. Experiments show promising results for the application of this method to radiographic images in ePHI/R for both transmission and storage purpose.

  15. Clinical and radiographic indications for aortography in blunt chest trauma.

    Science.gov (United States)

    Kram, H B; Wohlmuth, D A; Appel, P L; Shoemaker, W C

    1987-08-01

    To determine which clinical and radiographic findings are valuable in selecting patients with blunt chest trauma for aortography, we analyzed the medical records and admission chest radiographs of 76 consecutive victims of blunt chest trauma with suspected thoracic aortic rupture during the past 7 years. All patients were evaluated by history, physical examination, chest radiography, and aortography; a total of 70 clinical and radiographic findings were independently assessed in each patient. The following occurred with significantly greater frequency in patients with thoracic aortic rupture than in those without: history of significant hypotension (mean arterial pressure less than 80 mm Hg) (p less than 0.04); the presence of upper extremity hypertension, bilateral lower extremity pulse pulse deficits, or an initial chest tube output greater than 750 ml of blood (p less than 0.05); and greater incidence of myocardial contusions, intra-abdominal injuries, and pelvic fractures compared with patients without thoracic aortic rupture (p less than 0.05). Mediastinal widening (equal to or greater than 8 cm) shown on anteroposterior chest radiography occurred in all patients with thoracic aortic rupture; however, its specificity was only 10.6%. Radiographic signs that were helpful in indicating the presence of thoracic aortic rupture included paratracheal stripe greater than 5 mm, rightward deviation of the nasogastric tube or central venous pressure line, blurring of the aortic knob, and an abnormal or absent paraspinous stripe. Upper rib fractures and mediastinal to thoracic cage width ratios at any level did not increase diagnostic accuracy for thoracic aortic rupture in the present series. Six patients in the series died, two of whom had thoracic aortic rupture.(ABSTRACT TRUNCATED AT 250 WORDS)

  16. Are routine pelvic radiographs in major pediatric blunt trauma necessary?

    Energy Technology Data Exchange (ETDEWEB)

    Lagisetty, Jyothi [Memorial Hermann Medical Center, Emergency Medicine Department, Houston, TX (United States); Slovis, Thomas [Wayne State University School of Medicine, Department of Radiology, Pediatric Imaging, Children' s Hospital of Michigan, Detroit, MI (United States); Thomas, Ronald [Children' s Hospital of Michigan, Wayne State University of Medicine, Department of Pediatrics, Detroit, MI (United States); Knazik, Stephen; Stankovic, Curt [Wayne State University of Medicine, Division of Emergency Medicine, Children' s Hospital of Michigan, Detroit, MI (United States)

    2012-07-15

    Screening pelvic radiographs to rule out pelvic fractures are routinely used for the initial evaluation of pediatric blunt trauma. Recently, the utility of routine pelvic radiographs in certain subsets of patients with blunt trauma has been questioned. There is a growing amount of evidence that shows the clinical exam is reliable enough to obviate the need for routine screening pelvic radiographs in children. To identify variables that help predict the presence or absence of pelvic fractures in pediatric blunt trauma. We conducted a retrospective study from January 2005 to January 2010 using the trauma registry at a level 1 pediatric trauma center. We analyzed all level 1 and level 2 trauma victims, evaluating history, exam and mechanism of injury for association with the presence or absence of a pelvic fracture. Of 553 level 1 and 2 trauma patients who presented during the study period, 504 were included in the study. Most of these children, 486/504 (96.4%), showed no evidence of a pelvic fracture while 18/504 (3.6%) had a pelvic fracture. No factors were found to be predictive of a pelvic fracture. However, we developed a pelvic fracture screening tool that accurately rules out the presence of a pelvic fracture P = 0.008, NPV 99, sensitivity 96, 8.98 (1.52-52.8). This screening tool combines eight high-risk clinical findings (pelvic tenderness, laceration, ecchymosis, abrasion, GCS <14, positive urinalysis, abdominal pain/tenderness, femur fracture) and five high-risk mechanisms of injury (unrestrained motor vehicle collision [MVC], MVC with ejection, MVC rollover, auto vs. pedestrian, auto vs. bicycle). Pelvic fractures in pediatric major blunt trauma can reliably be ruled out by using our pelvic trauma screening tool. Although no findings accurately identified the presence of a pelvic fracture, the screening tool accurately identified the absence of a fracture, suggesting that pelvic radiographs are not warranted in this subset of patients. (orig.)

  17. Radiographic abnormalities in tricyclic acid overdose

    International Nuclear Information System (INIS)

    Varnell, R.M.; Richardson, M.L.; Vincent, J.M.; Godwin, J.D.

    1987-01-01

    Several case reports have described adult respiratory distress syndrome (ARDS) secondary to tricyclic acid (TCA) overdose. During a 1-year period 83 patients requiring intubation secondary to drug overdose were evaluated. Abnormalities on chest radiographs occurred in 26 (50%) of the 54 patients with TCA overdose, compared to six (21%) of the 29 patients overdosed with other drugs. In addition, five (9%) of the patients with TCA overdose subsequently had radiographic and clinical abnormalities meeting the criteria for ARDS. Only one (3%) of the patients with non-TCA overdose subsequently had change suggesting ARDS. TCAs should be added to the list of drugs associated with ARDS, and TCA overdose should be considered a major risk factor in the development of radiographically evident abnormalities

  18. The review on radiographic inspection in 1978

    International Nuclear Information System (INIS)

    Furuta, Junichiro

    1979-01-01

    This is a review paper on the activities of radiographic inspection performed in 1978. The state of safety management in 1978 is reported. The JIS standards for the radiographic inspection were investigated. Problems concerning the measurement of the height of defects by non-destructive test were studied. The radiographic method with narrow irradiation field was developed. Radiography of the welded parts at corners, fiber reinforced plastics, offshore structures, nozzles, pipes and so on was investigated. Scattering ratio, contrast, and beam quality affect on identification, and these effects were studied. Defect-like patterns seen in X-ray graphs of cast metals and welded parts are due to X-ray diffraction. The relation between exposure and density of pictures was obtained as linear relation. The property of scattering ratio and an empirical formula were deduced. Development of instruments and films have been made. (Kato, T.)

  19. A patient image-based technique to assess the image quality of clinical chest radiographs

    Science.gov (United States)

    Lin, Yuan; Samei, Ehsan; Luo, Hui; Dobbins, James T., III; McAdams, H. Page; Wang, Xiaohui; Sehnert, William J.; Barski, Lori; Foos, David H.

    2011-03-01

    Current clinical image quality assessment techniques mainly analyze image quality for the imaging system in terms of factors such as the capture system DQE and MTF, the exposure technique, and the particular image processing method and processing parameters. However, when assessing a clinical image, radiologists seldom refer to these factors, but rather examine several specific regions of the image to see whether the image is suitable for diagnosis. In this work, we developed a new strategy to learn and simulate radiologists' evaluation process on actual clinical chest images. Based on this strategy, a preliminary study was conducted on 254 digital chest radiographs (38 AP without grids, 35 AP with 6:1 ratio grids and 151 PA with 10:1 ratio grids). First, ten regional based perceptual qualities were summarized through an observer study. Each quality was characterized in terms of a physical quantity measured from the image, and as a first step, the three physical quantities in lung region were then implemented algorithmically. A pilot observer study was performed to verify the correlation between image perceptual qualities and physical quantitative qualities. The results demonstrated that our regional based metrics have promising performance for grading perceptual properties of chest radiographs.

  20. Caries status in young Colombian children expressed by the ICCMS™ visual/radiographic combined caries staging system

    DEFF Research Database (Denmark)

    Cortes, Andrea; Ekstrand, Kim Rud; Gamboa, Luis Fernando

    2017-01-01

    OBJECTIVE: To report (1) the caries experience prevalence and mean, and the caries severity and distribution patterns, expressed clinically and combined with radiographs with the conventional and ICCMS™ systems in young children from Bogotá, Colombia; (2) the contribution of including radiographs...... to the clinical caries scoring and (3) in which surfaces the radiograph adds to the clinical caries registration. MATERIAL AND METHODS: Six hundred children from kindergartens/schools were enrolled: Cohort A: 2-year (n = 200), Cohort B: 4-year (n = 200) and Cohort C: 6-year (n = 200) olds. Radiographs were taken...... of the 4- and 6- year olds. Children were examined clinically using the Clinical (C) and Radiographic (R) ICCMS™-epi Caries Scoring Systems, staging caries lesions (d) as: Initial (Cepi/RA), Moderate (CM/RB) or Extensive (CE/RC). Caries experience including missing (m) and filled (f) surfaces was expressed...

  1. Optimizing radiation exposure for CT localizer radiographs

    Energy Technology Data Exchange (ETDEWEB)

    Bohrer, Evelyn; Maeder, Ulf; Fiebich, Martin [Univ. of Applied Sciences, Giessen (Germany). Inst. of Medical Physics and Radiation Protection-IMPS; Schaefer, Stefan; Krombach, Gabriele A. [Univ. Hospital Giessen (Germany). Dept. of Radiology; Noel, Peter B. [Technische Univ. Muenchen (Germany). Dept. of Diagnostic and Interventional Radiology

    2017-08-01

    The trend towards submillisievert CT scans leads to a higher dose fraction of localizer radiographs in CT examinations. The already existing technical capabilities make dose optimization of localizer radiographs worthwhile. Modern CT scanners apply automatic exposure control (AEC) based on attenuation data in such a localizer. Therefore not only this aspect but also the detectability of anatomical landmarks in the localizer for the desired CT scan range adjustment needs to be considered. The effective dose of a head, chest, and abdomen-pelvis localizer radiograph with standard factory settings and user-optimized settings was determined using Monte Carlo simulations. CT examinations of an anthropomorphic phantom were performed using multiple sets of acquisition parameters for the localizer radiograph and the AEC for the subsequent helical CT scan. Anatomical landmarks were defined to assess the image quality of the localizer. CTDI{sub vol} and effective mAs per slice of the helical CT scan were recorded to examine the impact of localizer settings on a helical CT scan. The dose of the localizer radiograph could be decreased by more than 90% while the image quality remained sufficient when selecting the lowest available settings (80 kVp, 20 mA, pa tube position). The tube position during localizer acquisition had a greater impact on the AEC than the reduction of tube voltage and tube current. Except for the use of a pa tube position, all changes of acquisition parameters for the localizer resulted in a decreased total radiation exposure. A dose reduction of CT localizer radiograph is necessary and possible. In the examined CT system there was no negative impact on the modulated helical CT scan when the lowest tube voltage and tube current were used for the localizer.

  2. Accuracy of chest radiographs in the emergency diagnosis of heart failure

    International Nuclear Information System (INIS)

    Studler, Ueli; Kretzschmar, Martin; Steinbrich, Wolfgang; Christ, Michael; Breidthardt, Tobias; Noveanu, Markus; Perruchoud, Andre P.; Mueller, Christian; Schoetzau, Andreas

    2008-01-01

    The purpose of this study was to determine the diagnostic accuracy of chest radiographic findings of heart failure (HF) in current patients presenting with dyspnea in the emergency department. In a secondary analysis of the BASEL study, initial chest radiographs of 277 patients with acute dyspnea were evaluated by two radiologists blinded to the adjudicated diagnosis (56% had the final diagnosis of HF). Predefined radiographic criteria of HF were used. Statistical analysis included receiver-operating characteristic (ROC) analysis and calculation of a logistic regression model including B-type natriuretic peptide (BNP) levels. The reader's overall impression showed the highest area under the ROC curve for the diagnosis of HF in both supine and erect patient positions (0.855 and 0.857). Among individual radiographic findings, peribronchial cuffing in the supine position (0.829) showed the highest accuracies. The lowest accuracy was found for the vascular pedicle width in the supine position (0.461). Logistic regression analysis showed no significant differences between the reader's overall impression, the radiographic model, and BNP testing. In our study, the combination of radiographic features provided valuable information and was of comparable accuracy as BNP-testing for the diagnosis of HF. (orig.)

  3. CLEARING MAGNET DESIGN FOR APS-U

    Energy Technology Data Exchange (ETDEWEB)

    Abliz, M.; Grimmer, J.; Jaski, Y.; Westferro, F.; Ramanathan, M.

    2017-06-25

    The Advanced Photon Source is in the process of developing an upgrade (APS-U) of the storage ring. The upgrade will be converting the current double bend achromat (DBA) lattice to a multi-bend achromat (MBA) lattice. In addition, the storage ring will be operated at 6 GeV and 200 mA with regular swap-out injection to keep the stored beam current constant [1]. The swap-out injection will take place with beamline shutters open. For radiation safety to ensure that no electrons can exit the storage ring, a passive method of protecting the beamline and containing the electrons inside the storage ring is proposed. A clearing magnet will be located in all beamline front ends inside the storage ring tunnel. This article will discuss the features and design of the clearing magnet scheme for APS-U.

  4. Radiographic Hip Anatomy Correlates With Range of Motion and Symptoms in National Hockey League Players.

    Science.gov (United States)

    Larson, Christopher M; Ross, James R; Kuhn, Andrew W; Fuller, Donnie; Rowley, David M; Giveans, M Russell; Stone, Rebecca M; Bedi, Asheesh

    2017-06-01

    Hip disorders in athletes have been increasingly recognized. To characterize radiographic hip anatomy for National Hockey League (NHL) players and correlate it with hip range of motion and hip symptoms and/or surgery. Cross-sectional study; Level of evidence, 3. Fifty-nine professional hockey players (118 hips) with 1 NHL organization (mean age, 24.2 years; range, 18-36) prospectively underwent history and physician examination by 2 independent orthopaedic surgeons. Current or previous groin and/or hip pain or surgery was noted. Anteroposterior (AP) pelvis and bilateral Dunn lateral radiographs were obtained for all players with assessment of hip morphology by 2 blinded independent orthopaedic surgeons. Good to very good reliability of radiographic assessments was noted (intraclass correlation coefficients = 0.749-0.958). Sixty-four percent of athletes had a positive crossover sign, while 86% and 60% had a positive posterior wall sign and a prominent ischial spine sign, respectively. Twenty-one percent of hips demonstrated dysplastic acetabular features (lateral center edge angle 50° Dunn lateral) and head-neck offset, respectively. Good to very good reliability was noted for ROM assessments (intraclass correlation coefficient >0.69). Mean hip flexion was 107.4º ± 6.7º, and mean hip internal rotation was 26.1º ± 6.6º. Thirty-one percent of hips had a history of hip-related pain and/or surgery. Higher AP, Dunn lateral, and maximal alpha angles correlated with decreased hip internal rotation ( P = .004). Greater AP alpha angle correlated with decreased hip extension/abduction ( P = .025), and greater Dunn lateral and maximal alpha angle correlated with decreased hip flexion/abduction ( P = .001). A positive posterior wall sign correlated with increased straight hip abduction, while other radiographic acetabular parameters were not predictive of range of motion. Only decreased hip external rotation and total arc of motion correlated with an increased risk for

  5. Pelvic radiograph in skeletal dysplasias: An approach

    Directory of Open Access Journals (Sweden)

    Manisha Jana

    2017-01-01

    Full Text Available The bony pelvis is constituted by the ilium, ischium, pubis, and sacrum. The pelvic radiograph is an important component of the skeletal survey performed in suspected skeletal dysplasia. Most of the common skeletal dysplasias have either minor or major radiological abnormalities; hence, knowledge of the normal radiological appearance of bony pelvis is vital for recognizing the early signs of various skeletal dysplasias. This article discusses many common and some uncommon radiological findings on pelvic radiographs along with the specific dysplasia in which they are seen; common differential diagnostic considerations are also discussed.

  6. Pseudoprominent aorta: Radiographic findings and CT correlation

    International Nuclear Information System (INIS)

    Brown, K.T.; Shepard, J.A.O.; Stewart, W.J.

    1985-01-01

    The presence of a persistent left-sided superior vena cava (LSVC) in the absence of a right-sided superior vena cava (RSVC) may be suspected on a posteroanterior (PA) chest radiograph because of a prominent-appearing ascending aorta, which results from the absence of the RSVC. In the absence of an RSVC, the right upper lobe abuts and outlines the course of the ascending aorta, allowing better demonstration of its profile. This report describes a patient with this finding on a PA chest radiograph. Computed tomographic correlation is presented

  7. Pseudoprominent aorta: Radiographic findings and CT correlation

    Energy Technology Data Exchange (ETDEWEB)

    Brown, K.T.; Shepard, J.A.O.; Stewart, W.J.

    1985-05-01

    The presence of a persistent left-sided superior vena cava (LSVC) in the absence of a right-sided superior vena cava (RSVC) may be suspected on a posteroanterior (PA) chest radiograph because of a prominent-appearing ascending aorta, which results from the absence of the RSVC. In the absence of an RSVC, the right upper lobe abuts and outlines the course of the ascending aorta, allowing better demonstration of its profile. This report describes a patient with this finding on a PA chest radiograph. Computed tomographic correlation is presented.

  8. [Assessment of radiographic investigation in discopathy diagnosis].

    Science.gov (United States)

    Samojedny, A; Guz, W

    1995-01-01

    Based on 262 radiographic examinations done during two years the authors have analyzed the compatibility of the radiographic image with the clinical examinations and with the operation results. In the analysis the most frequently occurring lesion level having the character of hernia of the nucleus pulposus, age, sex, and the duration of the disease symptoms were taken into account. The effectiveness of the method, which was verified by surgery was 86.3%. The result is in good agreement with literature data. Therefore, the method can be still recommended, particularly for the x-ray laboratories, which have no possibility to apply non-invasive techniques.

  9. Children born to SLE and APS mothers.

    Science.gov (United States)

    Nalli, C; Iodice, A; Andreoli, L; Lojacono, A; Motta, M; Fazzi, E; Tincani, A

    2014-10-01

    Systemic lupus erythematosus (SLE) and antiphospholipid antibody syndrome (APS) are autoimmune diseases that affect women of childbearing age. Pregnancies in these patients carry several complications such as prematurity. Maternal IgG antiphospholipid antibodies (aPL) can cross the placenta but they don't generally cause any neonatal thrombotic event. Because of the incompleteness of the fetal blood-brain barrier, aPL could theoretically reach the fetal brain. Whether this can have an effect on brain development is still under investigation. Some studies performed in children of patients with SLE and/or APS showed an increased number of learning disabilities without impairment in intelligence level. The objectives of this article are to evaluate the neurodevelopment outcome in 30 children (median age 9 years) born to mothers with SLE and/or APS with IgG anti-beta2-glycoprotein I during the third trimester of pregnancy and found positive for the same antibodies at birth. A neurological physical exam was performed in all children. We submitted some questionnaires to the mothers: the Child Behavior CheckList (CBCL) and a homemade set of questions obtained by a team composed of rheumatologists and pediatric neurologists. Intellectual functioning was determined by the Wechsler scale for corrected age. In all children neurological physical exam and intelligence levels were found to be normal but mild behavior disorders and history of neurological manifestations were shown in three children. Offspring of patients with SLE and/or APS are generally healthy. We and others observed the occurrence of minor neurological disorders that might be related to maternal disease or to prematurity. The limited number of the available data on this sensitive issue supports the need for further studies. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  10. Computer-assisted instruction and diagnosis of radiographic findings.

    Science.gov (United States)

    Harper, D; Butler, C; Hodder, R; Allman, R; Woods, J; Riordan, D

    1984-04-01

    Recent advances in computer technology, including high bit-density storage, digital imaging, and the ability to interface microprocessors with videodisk, create enormous opportunities in the field of medical education. This program, utilizing a personal computer, videodisk, BASIC language, a linked textfile system, and a triangulation approach to the interpretation of radiographs developed by Dr. W. L. Thompson, can enable the user to engage in a user-friendly, dynamic teaching program in radiology, applicable to various levels of expertise. Advantages include a relatively more compact and inexpensive system with rapid access and ease of revision which requires little instruction to the user.

  11. APS - Diagnostics and challenges for the future.

    Science.gov (United States)

    Pengo, V; Bison, E; Zoppellaro, G; Padayattil Jose, S; Denas, G; Hoxha, A; Ruffatti, A; Banzato, A

    2016-11-01

    Diagnosis of antiphospholipid syndrome (APS) is essentially based on the detection of circulating antiphospholipid (aPL) antibodies. Progress have been made on the standardization of tests exploring the presence of aPL as guidelines on coagulation and immunological tests were recently published in the literature. Clinical relevance of aPL profile has come from prospective cohort studies in populations with a homogeneous antibody profile supporting the view that triple positivity is a high risk pattern in patients and carriers. In addition to the classic ones, several other tests have been proposed for the diagnosis of APS. The detection of antibodies directed to domain 1 and 4/5 of β2-Glycoprotein I (β2GP1) were found to be particularly sound. Several issues remain to be addressed. We do not yet know what is the physiological function of β2GP1 and the pathophysiology of thrombosis and pregnancy loss in these patients. Moreover, treatment is poorly defined especially in the case of feared catastrophic APS. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. A patient dose survey for femoral arteriogram diagnostic radiographic examinations using a dose-area product meter

    International Nuclear Information System (INIS)

    Thwaites, J.H.; Rafferty, M.W.; Gray, N.; Black, J.; Stock, B.

    1996-01-01

    A patient dose survey was carried out for femoral arteriogram procedures at the Sir Charles Gairdner Hospital. The procedure involves fluoroscopy to the pelvic region to locate a guide wire and catheter, followed by a series of radiographs extending from the pelvic area to the feet to form a collage image of the entire arterial system. Radiographs are taken whilst a bolus of contrast media is injected into the arterial system. A dose-area product meter was used to determine the dose-area product delivered to patients. Radiographic and patient details were logged with dose-area product for each part of each procedure. Mean energy imparted, mean effective dose and effective dose equivalent are calculated for the examinations. Calculated effective doses are shown to produce results consistent with those of other authors. We present a method for dealing with a complex radiographic procedure including multiple radiographs and fluoroscopy in an attempt to provide a simple way of calculating effective dose from which a general risk factor can be determined. The effective dose varies considerably from examination to examination due to the large range in the number of radiographs taken in any one procedure. A useful index can be obtained by logging the number of radiographs in each region, and fluoroscopy time, from which the effective dose may be easily calculated. These measurements extend a continuing survey of doses for common diagnostic radiographic examinations which previously included the simple examinations: lumbar spine, abdoment and pelvis. (author)

  13. On the periodic variations of geomagnetic activity indices Ap and ap

    Directory of Open Access Journals (Sweden)

    H. Schreiber

    1998-05-01

    Full Text Available Yearly averages of geomagnetic activity indices Ap for the years 1967–1984 are compared to the respective averages of ν2·Bs, where v is the solar wind velocity and Bs is the southward interplanetary magnetic field (IMF component. The correlation of both quantities is known to be rather good. Comparing the averages of Ap with ν2 and Bs separately we find that, during the declining phase of the solar cycle, ν2 and during the ascending phase Bs have more influence on Ap. According to this observation (using Fourier spectral analysis the semiannual and 27 days, Ap variations for the years 1932–1993 were analysed separately for years before and after sunspot minima. Only those time-intervals before sunspot minima with a significant 27-day recurrent period of the IMF sector structure and those intervals after sunspot minima with a significant 28-28.5-day recurrent period of the sector structure were used. The averaged spectra of the two Ap data sets clearly show a period of 27 days before and a period of 28–29 days after sunspot minimum. Moreover, the phase of the average semiannual wave of Ap is significantly different for the two groups of data: the Ap variation maximizes near the equinoxes during the declining phase of the sunspot cycle and near the beginning of April and October during the ascending phase of the sunspot cycle, as predicted by the Russell-McPherron (R-M mechanism. Analysing the daily variation of ap in an analogue manner, the same equinoctial and R-M mechanisms are seen, suggesting that during phases of the solar cycle, when ap depends more on the IMF-Bs component, the R-M mechanism is predominant, whereas during phases when ap increases as v increases the equinoctial mechanism is more likely to be effective.Key words. Interplanetary physics · Magnetic fields · Solar wind plasma · Solar wind · magnetosphere interaction

  14. A radiographic study of the position and shape of mental foramen in panoramic radiographs

    International Nuclear Information System (INIS)

    Choi, Karp Shik; Kim, Dong Youn; Sohn, Jeong Ick; Bae, Yong Chul

    1997-01-01

    The purpose of this study was to evaluate the position and shape of mental foramen in panoramic radiographs. For this study, panoramic radiographs were obtained from the 200 adults and evaluated the position and shape of mental foramen. According to various positional changes in panoramic radiographs of the patients, the author also obtained panoramic radiographs from the 100 adults and then evaluated the positional and shape changes of mental foramen. The following results were obtained : 1. Shapes of mental foramen were observed elliptical (43.3%), round or oval (42.5%), unidentified (7.5%) and diffuse (6.7%) type in descending order of frequency. 2. Horizontal position of mental foramen were most frequently observed at the 2nd premolar area (54.2%), and area between the 1st premolar and 2nd premolar (43.1%), area between the 2nd premolar and 1st molar (2.7%), and at apex (9.7%), overlap with apex (1.9%), superior of apex (0.2%) in descending order of frequency. 4. According to various positional changes in panoramic radiographs of the patients, shape changes of mental foramen were more obviously observed at the forward 10 mm and chin down 10 degree positioned panoramic radiographs, And changes of horizontal and vertical position were observed in similar to compared with normal positioned panoramic radiographs.

  15. A comparison of radiographer and radiologist reports on radiographer conducted barium enemas

    International Nuclear Information System (INIS)

    Murphy, M.; Loughran, C.F.; Birchenough, H.; Savage, J.; Sutcliffe, C.

    2002-01-01

    Purpose: To compare radiographer and radiologist reports on radiographer conducted barium enemas. Method: Two specially trained, experienced radiographers performed barium enemas and prepared provisional reports without consulting radiologists. Later, formal radiologist reports were issued. The reports of each were compared and correlated with clinical findings derived from case note review. Results:Seven hundred and eighty eight patients had barium enemas. Males numbered 295 (37.5%) and females 493 (62.5%). Patients ages ranged from 17 to 95 years (mean 62). The radiologist reported 244 as normal, 432 as diverticular change, 70 with polyps (31 of which had co-existent diverticular disease), 31 with carcinomas and 12 with colitis (three of which had co-existent diverticular disease). Taking the radiologist reports as gold-standard radiographer reports were concordant in 753 (95.5%). There were 35 (4.5%) discordant radiographer reports of these 19 were false-positive diagnoses of polyps and six false positive diagnoses of diverticular change. There were seven false-negative diagnoses of polyps (only one of these was found to have a polyp at follow-up endoscopy). There was one false-negative diagnosis of colitis and two false-negative reports of diverticular change. On follow up there were no false negative diagnoses of carcinoma by either radiographer or radiologist. There was one concordant false-positive diagnosis of carcinoma. Conclusion:Radiographers with specialized training can report barium enemas to a high standard

  16. A comparison of radiographer and radiologist reports on radiographer conducted barium enemas

    Energy Technology Data Exchange (ETDEWEB)

    Murphy, M.; Loughran, C.F.; Birchenough, H.; Savage, J.; Sutcliffe, C

    2002-11-01

    Purpose: To compare radiographer and radiologist reports on radiographer conducted barium enemas. Method: Two specially trained, experienced radiographers performed barium enemas and prepared provisional reports without consulting radiologists. Later, formal radiologist reports were issued. The reports of each were compared and correlated with clinical findings derived from case note review. Results:Seven hundred and eighty eight patients had barium enemas. Males numbered 295 (37.5%) and females 493 (62.5%). Patients ages ranged from 17 to 95 years (mean 62). The radiologist reported 244 as normal, 432 as diverticular change, 70 with polyps (31 of which had co-existent diverticular disease), 31 with carcinomas and 12 with colitis (three of which had co-existent diverticular disease). Taking the radiologist reports as gold-standard radiographer reports were concordant in 753 (95.5%). There were 35 (4.5%) discordant radiographer reports of these 19 were false-positive diagnoses of polyps and six false positive diagnoses of diverticular change. There were seven false-negative diagnoses of polyps (only one of these was found to have a polyp at follow-up endoscopy). There was one false-negative diagnosis of colitis and two false-negative reports of diverticular change. On follow up there were no false negative diagnoses of carcinoma by either radiographer or radiologist. There was one concordant false-positive diagnosis of carcinoma. Conclusion:Radiographers with specialized training can report barium enemas to a high standard.

  17. A radiographic study of the position and shape of mental foramen in panoramic radiographs

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Karp Shik; Kim, Dong Youn; Sohn, Jeong Ick [Dept. of Dental Radiology, College of Dentistry, Kyungpook National University, Daegu (Korea, Republic of); Bae, Yong Chul [Dept. of Oral Anatomy, College of Dentistry, Kyungpook National University, Daegu (Korea, Republic of)

    1997-02-15

    The purpose of this study was to evaluate the position and shape of mental foramen in panoramic radiographs. For this study, panoramic radiographs were obtained from the 200 adults and evaluated the position and shape of mental foramen. According to various positional changes in panoramic radiographs of the patients, the author also obtained panoramic radiographs from the 100 adults and then evaluated the positional and shape changes of mental foramen. The following results were obtained : 1. Shapes of mental foramen were observed elliptical (43.3%), round or oval (42.5%), unidentified (7.5%) and diffuse (6.7%) type in descending order of frequency. 2. Horizontal position of mental foramen were most frequently observed at the 2nd premolar area (54.2%), and area between the 1st premolar and 2nd premolar (43.1%), area between the 2nd premolar and 1st molar (2.7%), and at apex (9.7%), overlap with apex (1.9%), superior of apex (0.2%) in descending order of frequency. 4. According to various positional changes in panoramic radiographs of the patients, shape changes of mental foramen were more obviously observed at the forward 10 mm and chin down 10 degree positioned panoramic radiographs, And changes of horizontal and vertical position were observed in similar to compared with normal positioned panoramic radiographs.

  18. The radiographer's role in child protection: Comparison of radiographers perceptions by use of focus groups

    International Nuclear Information System (INIS)

    Davis, Michaela; Reeves, Pauline

    2006-01-01

    The research presented in this paper is taken from a larger study whose aims were to devise a holistic picture of how diagnostic radiographers approach child protection issues and to explore how radiographers and other professionals see the role of radiographers in the chain of evidence in relation to child protection as this applies to children who present at the Imaging Department with suspected non-accidental injuries (NAI). A focus group methodology was used with focus groups being conducted in the United Kingdom and Republic of Ireland. The results indicated that both United Kingdom and Republic of Ireland radiographers agreed that they had a role in child protection; however, they identified a wide interpretation as to the extent of that role. Although radiographers in the United Kingdom and Republic of Ireland work within different legal systems there were themes identified which were common to both countries. Although radiographers referred to a duty to the child as to all patients, no radiographer specifically mentioned the system and child care law under which it is assumed they operate. This research revealed an area which would benefit from more detailed research using a wider audience. However, the study revealed a need for training in relation to possible NAI indicators and the correct procedure for documenting their suspicions and initiating an NAI referral

  19. Common Variation in the NOS1AP Gene Is Associated With Drug-Induced QT Prolongation and Ventricular Arrhythmia

    NARCIS (Netherlands)

    Jamshidi, Yalda; Nolte, Ilja M.; Dalageorgou, Chrysoula; Zheng, Dongling; Johnson, Toby; Bastiaenen, Rachel; Ruddy, Suzanne; Talbott, Daniel; Norris, Kris J.; Snieder, Harold; George, Alfred L.; Marshall, Vanessa; Shakir, Saad; Kannankeril, Prince J.; Munroe, Patricia B.; Camm, A. John; Jeffery, Steve; Roden, Dan M.; Behr, Elijah R.

    2012-01-01

    Objectives This study sought to determine whether variations in NOS1AP affect drug-induced long QT syndrome (LQTS). Background Use of antiarrhythmic drugs is limited by the high incidence of serious adverse events including QT prolongation and torsades de pointes. NOS1AP gene variants play a role in

  20. Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations (II): thrombocytopenia and skin manifestations.

    Science.gov (United States)

    Cervera, R; Tektonidou, M G; Espinosa, G; Cabral, A R; González, E B; Erkan, D; Vadya, S; Adrogué, H E; Solomon, M; Zandman-Goddard, G; Shoenfeld, Y

    2011-02-01

    The objectives of the 'Task Force on Catastrophic Antiphospholipid Syndrome (APS) and Non-criteria APS Manifestations' were to assess the clinical utility of the international consensus statement on classification criteria and treatment guidelines for the catastrophic APS, to identify and grade the studies that analyze the relationship between the antiphospholipid antibodies and the non-criteria APS manifestations, and to present the current evidence regarding the accuracy of these non-criteria APS manifestations for the detection of patients with APS. This article summarizes the studies analyzed on thrombocytopenia and skin manifestations, and presents the recommendations elaborated by the Task Force after this analysis.

  1. Three-dimensional hindfoot alignment measurements based on biplanar radiographs: comparison with standard radiographic measurements

    Energy Technology Data Exchange (ETDEWEB)

    Sutter, Reto; Pfirrmann, Christian W.A.; Buck, Florian M. [University Hospital Balgrist, Department of Radiology, Zurich (Switzerland); University of Zurich, Zurich (Switzerland); Espinosa, Norman [University Hospital Balgrist, Department of Orthopedic Surgery, Zurich (Switzerland); University of Zurich, Zurich (Switzerland)

    2013-04-15

    To establish a hindfoot alignment measurement technique based on low-dose biplanar radiographs and compare with hindfoot alignment measurements on long axial view radiographs, which is the current reference standard. Long axial view radiographs and low-dose biplanar radiographs of a phantom consisting of a human foot skeleton embedded in acrylic glass (phantom A) and a plastic model of a human foot in three different hindfoot positions (phantoms B1-B3) were imaged in different foot positions (20 internal to 20 external rotation). Two independent readers measured hindfoot alignment on long axial view radiographs and performed 3D hindfoot alignment measurements based on biplanar radiographs on two different occasions. Time for three-dimensional (3D) measurements was determined. Intraclass correlation coefficients (ICC) were calculated. Hindfoot alignment measurements on long axial view radiographs were characterized by a large positional variation, with a range of 14 /13 valgus to 22 /27 varus (reader 1/2 for phantom A), whereas the range of 3D hindfoot alignment measurements was 7.3 /6.0 to 9.0 /10.5 varus (reader 1/2 for phantom A), with a mean and standard deviation of 8.1 {+-} 0.6/8.7 {+-} 1.4 respectively. Interobserver agreement was high (ICC = 0.926 for phantom A, and ICC = 0.886 for phantoms B1-B3), and agreement between different readouts was high (ICC = 0.895-0.995 for reader 1, and ICC = 0.987-0.994 for reader 2) for 3D measurements. Mean duration of 3D measurements was 84 {+-} 15/113 {+-} 15 s for reader 1/2. Three-dimensional hindfoot alignment measurements based on biplanar radiographs were independent of foot positioning during image acquisition and reader independent. In this phantom study, the 3D measurements were substantially more precise than the standard radiographic measurements. (orig.)

  2. COMPARISON OF NONLINEAR DYNAMICS OPTIMIZATION METHODS FOR APS-U

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Y.; Borland, Michael

    2017-06-25

    Many different objectives and genetic algorithms have been proposed for storage ring nonlinear dynamics performance optimization. These optimization objectives include nonlinear chromaticities and driving/detuning terms, on-momentum and off-momentum dynamic acceptance, chromatic detuning, local momentum acceptance, variation of transverse invariant, Touschek lifetime, etc. In this paper, the effectiveness of several different optimization methods and objectives are compared for the nonlinear beam dynamics optimization of the Advanced Photon Source upgrade (APS-U) lattice. The optimized solutions from these different methods are preliminarily compared in terms of the dynamic acceptance, local momentum acceptance, chromatic detuning, and other performance measures.

  3. Growing teratoma syndrome: clinical and radiographic characteristics.

    Science.gov (United States)

    Lee, Dennis J; Djaladat, Hooman; Tadros, Nicholas N; Movassaghi, Mehran; Tejura, Tapas; Duddalwar, Vinay; Daneshmand, Siamak

    2014-09-01

    To present an overview of our surgical experience in the management of growing teratoma syndrome. A retrospective analysis of all patients undergoing post-chemotherapy retroperitoneal lymphadenectomy between November 2005 and February 2012 revealed 15 patients who met the criteria for growing teratoma syndrome. Their clinical data, imaging characteristics, and surgical and oncological outcomes were reviewed. The median age at diagnosis was 23 years. Primary testis tumors included non-seminomatous germ cell tumor in 12 of 15 patients, seminoma in two of 15 patients and hemorrhagic mass in one patient. Mature teratoma was present in just six (40%) of the orchiectomy specimens. All patients received preoperative chemotherapy. On imaging, the median size of the largest retroperitoneal mass was 7 cm (range 3.9-24.5 cm). The median rate of linear growth was 0.5 cm/month (range 0.03-2.9), and the increase in volume was 9.2 cm(3) /month. All tumors were found to have cystic and necrotic components. Median operative time was 6.2 h (range 4.2-15.2 h). Estimated blood loss was 600 mL (range 100-7000 mL), and median length of stay was 5 days (range 3-19 days). Four patients required resection of non-retroperitoneal growing teratoma masses after post-chemotherapy retroperitoneal lymphadenectomy to achieve tumor-free status. There were two minor (Clavien I-II) and two major postoperative complications (Clavien ≥III). All patients are alive and disease free with a median duration of follow-up of 8 months (range 1-64 months). Growing teratoma syndrome tumors vary in their growth rate, but they all appear to have cystic features with necrosis elements on radiographic evaluation. Aggressive surgical excision is associated with excellent outcomes. © 2014 The Japanese Urological Association.

  4. Westinghouse AP1000® PWR: Meeting Customer Commitments and Market Needs

    International Nuclear Information System (INIS)

    Shulyak, Nick

    2014-01-01

    Westinghouse Electric Company once again sets a new industry standard with the AP1000 reactor. Historically, Westinghouse plant designs and technology have forged the cutting edge of worldwide nuclear technology. Today, about 50 percent of the world's 440 nuclear plants are based on Westinghouse technology. The AP1000 is the safest and most economical nuclear power plant available in the worldwide commercial marketplace, and is the only Generation III+ reactor to receive Design Certification from the U.S. Nuclear Regulatory Commission (NRC). The AP1000 features proven technology, innovative passive safety systems and offers: Unequalled safety, Economic competitiveness, Improved and more efficient operations. The AP1000 builds and improves upon the established technology of major components used in current Westinghouse-designed plants with proven, reliable operating experience over the past 50 years. These components include: Steam generators, Digital instrumentation and controls, Fuel, Pressurizers, Reactor vessels. Simplification was a major design objective for the AP1000. The simplified plant design includes overall safely systems, normal operating systems, the control room, construction techniques, and instrumentation and control systems. The result is a plant that is easier and less expensive to build, operate and maintain. The AP1000 design saves money and time with an accelerated construction time period of approximately 36 months, from the pouring of first concrete to the loading of fuel. Also, the innovative AP1000 features: 50% fewer safety-related valves, 80% less safety-related piping, 85% less control cable, 35% fewer pumps , 45% less seismic building volume. Eight AP1000 units under construction worldwide-Four units in China-Four units in the United States. (author)

  5. Radiographer and radiologist perception error in reporting double contrast barium enemas: A pilot study

    International Nuclear Information System (INIS)

    Booth, Alison M.; Mannion, Richard A.J.

    2005-01-01

    Purpose: The practice of radiographers performing double contrast barium enemas (DCBE) is now widespread and in many centres the radiographer's opinion is, at least, contributing to a dual reporting system [Bewell J, Chapman AH. Radiographer performed barium enemas - results of a survey to assess progress. Radiography 1996;2:199-205; Leslie A, Virjee JP. Detection of colorectal carcinoma on double contrast barium enema when double reporting is routinely performed: an audit of current practice. Clin Radiol 2001;57:184-7; Culpan DG, Mitchell AJ, Hughes S, Nutman M, Chapman AH. Double contrast barium enema sensitivity: a comparison of studies by radiographers and radiologists. Clin Radiol 2002;57:604-7]. To ensure this change in practice does not lead to an increase in reporting errors, this study aimed to compare the perception abilities of radiographers with those of radiologists. Methods: Three gastro-intestinal (GI) radiographers and three consultant radiologists independently reported on a selection of 50 DCBE examinations, including the level of certainty in their comments for each examination. A blinded comparison of the results with an independent 'standard report' was recorded. Results: The results demonstrate there was no significant difference in perception error for any of the levels of certainty, for single reporting, for double reading by a radiographer/radiologist or by two radiologists. Conclusions: The study shows that radiographers can perceive abnormalities on DCBE at similar sensitivities and specificities as radiologists. While the participants in the study may be typical of a district general hospital, the nature of the study gives it limited external validity. As a pilot, the results demonstrate that, with slight modification, the methodology could be used for a larger study

  6. Factors associated with radiographic lesions in early axial spondyloarthritis. Results from the DESIR cohort.

    Science.gov (United States)

    Blachier, Martin; Canouï-Poitrine, Florence; Dougados, Maxime; Lethuaut, Aurélie; Fautrel, Bruno; Ferkal, Salah; Le Corvoisier, Philippe; Farrenq, Valérie; Poulain, Cécile; Ghaleh, Bijan; Bastuji-Garin, Sylvie; Claudepierre, Pascal

    2013-09-01

    To assess whether factors such as inflammation by laboratory tests and MRI differ between early axial SpA with and without radiographic lesions. Cross-sectional analysis of baseline data from Devenir des Spondylarthropathies Indifferenciées Récentes (DESIR) cohort patients having recent-onset inflammatory back pain and meeting Assessment of SpondyloArthritis international Society criteria. The baseline evaluation included radiographs and MRI of the SI joints (SIJs) and spine. Patients were classified as having radiographic lesions if they had at least one obvious sacroiliitis, grade 2 for at least one vertebral corner or grade 1 for at least two vertebral corners (at the cervical or lumbar level, according to the modified Stoke Ankylosing Spondylitis Spine Score). Associations between baseline characteristics and the presence of radiographic lesions were evaluated by estimating multi-adjusted odd ratios (aORs) and their 95% CIs using a logistic regression model. Of 475 patients, 180 (37.9%) had radiographic lesions. Factors positively associated with radiographic lesions were alcohol use (aOR 2.42; 95% CI 1.31, 4.44; P = 0.005), CRP level (aOR 1.44; 95% CI 1.13, 1.84; P = 0.003) and SIJ inflammation by MRI (aOR 2.25; 95% CI 1.40, 3.60; P = 0.001); negative associations occurred with good NSAID responsiveness (aOR 0.44; 95% CI 0.24, 0.81; P = 0.008); spinal MRI inflammation was associated with radiographic lesions only in smokers (aOR 1.99; 95% CI 1.01, 3.92; P = 0.048). Alcohol use, poor responsiveness to NSAIDs, CRP elevation, SIJ MRI inflammation and spinal MRI inflammation in smokers were independently associated with radiographic lesions in early axial SpA.

  7. Radiographic Recurrence of Deformity After Hallux Valgus Surgery in Patients With Metatarsus Adductus.

    Science.gov (United States)

    Aiyer, Amiethab; Shub, Jeffery; Shariff, Raheel; Ying, Li; Myerson, Mark

    2016-02-01

    Metatarsus adductus (MA) is a congenital condition that may lead to the development of hallux valgus (HV). The associated anatomic deformities may lead to recurrence of the HV in patients with MA. The goals of the study were to identify radiographic rates of recurrence of HV following surgery for HV in patients with MA. Between 2002 and 2013, 587 patients who underwent HV surgery were retrospectively identified. The radiographic parameters recorded included the hallux valgus angle (HVA), the intermetatarsal angle (IMA), and the metatarsus adductus angle (MAA) obtained from initial radiographs and at final follow-up. The MAA was considered abnormal if the value was greater than 20 degrees. Radiographic recurrence was defined as HV deformity >20 degrees. The rate of radiographic recurrence of HV was 15% in patients without MA and 29.6% in patients with MA (P 31 degrees) were found to have a recurrence rate of 18%, whereas those with less severe MA (MAA < 31 degrees) were found to have a recurrence rate of 82%. Of the patients with severe MA who did not have radiographic recurrence of HV, 60% had undergone a Lapidus arthrodesis and realignment arthrodesis of the second/third tarsometatarsal joints. The rate of radiographic recurrence for patients with MA undergoing HV correction was ~30%. This finding was consistent with our hypothesis that MA increases the risk of radiographic recurrence of HV deformity irrespective of the procedure performed. We believe the lower rate of recurrence of HV among patients with severe MA deformities is suggestive that more complete management of the deformity is warranted. Level III, retrospective comparative series. © The Author(s) 2015.

  8. Filmless versus film-based systems in radiographic examination costs: an activity-based costing method.

    Science.gov (United States)

    Muto, Hiroshi; Tani, Yuji; Suzuki, Shigemasa; Yokooka, Yuki; Abe, Tamotsu; Sase, Yuji; Terashita, Takayoshi; Ogasawara, Katsuhiko

    2011-09-30

    Since the shift from a radiographic film-based system to that of a filmless system, the change in radiographic examination costs and costs structure have been undetermined. The activity-based costing (ABC) method measures the cost and performance of activities, resources, and cost objects. The purpose of this study is to identify the cost structure of a radiographic examination comparing a filmless system to that of a film-based system using the ABC method. We calculated the costs of radiographic examinations for both a filmless and a film-based system, and assessed the costs or cost components by simulating radiographic examinations in a health clinic. The cost objects of the radiographic examinations included lumbar (six views), knee (three views), wrist (two views), and other. Indirect costs were allocated to cost objects using the ABC method. The costs of a radiographic examination using a filmless system are as follows: lumbar 2,085 yen; knee 1,599 yen; wrist 1,165 yen; and other 1,641 yen. The costs for a film-based system are: lumbar 3,407 yen; knee 2,257 yen; wrist 1,602 yen; and other 2,521 yen. The primary activities were "calling patient," "explanation of scan," "take photographs," and "aftercare" for both filmless and film-based systems. The cost of these activities cost represented 36.0% of the total cost for a filmless system and 23.6% of a film-based system. The costs of radiographic examinations using a filmless system and a film-based system were calculated using the ABC method. Our results provide clear evidence that the filmless system is more effective than the film-based system in providing greater value services directly to patients.

  9. Knowledge of correct prescription of radiographs among dentists in Yazd, Iran

    Directory of Open Access Journals (Sweden)

    Fatemeh Ezoddini Ardakani

    2008-07-01

    Full Text Available Background and aims. While the use of X-ray is increasing, professional responsibility of dentists entitles them to have sufficient and correct knowledge of using radiographs. The aim of this study was to assess the level of knowledge of correct prescription of radiographs among dentists in Yazd, Iran. Materials and methods. This was a descriptive cross-sectional study including 134 general dentists and dental specialists. A self-administered questionnaire was used to assess their level of knowledge in various sections pertaining to prescription of radiographs. Their level of knowledge was compared in each section on the basis of gender and educational status. Results. Participants showed a high level of awareness in prescription of panoramic, periapical radiographs, and computerized tomography, whereas it was moderate in the field of occlusal radiographs, susceptible patients to caries, patients with periodontal diseases, evaluation of growth condition and dental crypts and weak in the fields of bitewing radiographs and insusceptible patients to caries. There was no difference in level of knowledge between genders. The level of knowledge in specialists was higher than general dentists except for using X-ray for susceptible patients to caries where no significant difference was observed. Conclusion. Specialist dentists were more knowledgeable than general dentists in prescribing radiological examinations.

  10. Radiographic studies on morphological anomalies in artificially ...

    African Journals Online (AJOL)

    Radiographic examination revealed anomalies such as hypoplasia and hyperplasia of fins, supernumeracry and agenesis of fins, fin cleft, and fusion of fins, scoliosis and kyphosis. The phenotypic lateral body curvatures and stump body trait were basically due to varying degrees and positions of scoliosis and thus, ...

  11. Algorithms for boundary detection in radiographic images

    International Nuclear Information System (INIS)

    Gonzaga, Adilson; Franca, Celso Aparecido de

    1996-01-01

    Edge detecting techniques applied to radiographic digital images are discussed. Some algorithms have been implemented and the results are displayed to enhance boundary or hide details. An algorithm applied in a pre processed image with contrast enhanced is proposed and the results are discussed

  12. Radiographic analysis of pasteurized autologous bone graft

    International Nuclear Information System (INIS)

    Ahmed, Adel Refaat; Manabe, Jun; Kawaguchi, Noriyoshi; Matsumoto, Seiichi; Matsushita, Yasushi

    2003-01-01

    Local malignant bone tumor excision followed by pasteurization and subsequent reimplantation is a unique technique for reconstruction after resection of primary bone sarcomas. The purpose of this investigation was to assess the normal and abnormal long-term radiographic findings of intercalary and osteo-chondral pasteurized bone graft/implant composite. The long-term radiographic findings of pasteurized bone grafts used in reconstruction after resection of bone and soft tissue sarcomas in relation to patients' clinical data were reviewed retrospectively. Thirty-one patients (18 females, 13 males; age range 7-77 years, mean 30 years) who underwent surgery between April 1990 and January 1997 at the authors' institute constituted the material of this study. They were followed up for at least 3 years or until the patient's death (mean 69 months). The International Society of Limb Salvage graft evaluation method that assesses the fusion, resorption, fracture, graft shortening, fixation, subluxation, joint narrowing and subchondral bone was used for evaluation of the radiographs. Twenty-one patients (68%) showed complete incorporation of graft and eight patients (26%) had partial incorporation. The overall radiographic evaluation rate was 81%. Fracture (10%) and infection (16%) were the main complications. No local recurrence was detected. These results indicate that pasteurization of bone is a useful option for reconstruction after resection of malignant bone tumors. (orig.)

  13. Radiographic analysis of pasteurized autologous bone graft.

    Science.gov (United States)

    Ahmed, Adel Refaat; Manabe, Jun; Kawaguchi, Noriyoshi; Matsumoto, Seiichi; Matsushita, Yasushi

    2003-08-01

    Local malignant bone tumor excision followed by pasteurization and subsequent reimplantation is a unique technique for reconstruction after resection of primary bone sarcomas. The purpose of this investigation was to assess the normal and abnormal long-term radiographic findings of intercalary and osteo-chondral pasteurized bone graft/implant composite. The long-term radiographic findings of pasteurized bone grafts used in reconstruction after resection of bone and soft tissue sarcomas in relation to patients' clinical data were reviewed retrospectively. Thirty-one patients (18 females, 13 males; age range 7-77 years, mean 30 years) who underwent surgery between April 1990 and January 1997 at the authors' institute constituted the material of this study. They were followed up for at least 3 years or until the patient's death (mean 69 months). The International Society of Limb Salvage graft evaluation method that assesses the fusion, resorption, fracture, graft shortening, fixation, subluxation, joint narrowing and subchondral bone was used for evaluation of the radiographs. Twenty-one patients (68%) showed complete incorporation of graft and eight patients (26%) had partial incorporation. The overall radiographic evaluation rate was 81%. Fracture (10%) and infection (16%) were the main complications. No local recurrence was detected. These results indicate that pasteurization of bone is a useful option for reconstruction after resection of malignant bone tumors.

  14. Radiographic analysis of pasteurized autologous bone graft

    Energy Technology Data Exchange (ETDEWEB)

    Ahmed, Adel Refaat [Department of Orthopedic Surgery, Cancer Institute Hospital, Japanese Foundation for Cancer Research, Kamiikebukuro 1-37-1, Toshima-ku, 170-0012, Tokyo (Japan); Department of Orthopedic Surgery, Alexandria University, Alexandria (Egypt); Manabe, Jun; Kawaguchi, Noriyoshi; Matsumoto, Seiichi; Matsushita, Yasushi [Department of Orthopedic Surgery, Cancer Institute Hospital, Japanese Foundation for Cancer Research, Kamiikebukuro 1-37-1, Toshima-ku, 170-0012, Tokyo (Japan)

    2003-08-01

    Local malignant bone tumor excision followed by pasteurization and subsequent reimplantation is a unique technique for reconstruction after resection of primary bone sarcomas. The purpose of this investigation was to assess the normal and abnormal long-term radiographic findings of intercalary and osteo-chondral pasteurized bone graft/implant composite. The long-term radiographic findings of pasteurized bone grafts used in reconstruction after resection of bone and soft tissue sarcomas in relation to patients' clinical data were reviewed retrospectively. Thirty-one patients (18 females, 13 males; age range 7-77 years, mean 30 years) who underwent surgery between April 1990 and January 1997 at the authors' institute constituted the material of this study. They were followed up for at least 3 years or until the patient's death (mean 69 months). The International Society of Limb Salvage graft evaluation method that assesses the fusion, resorption, fracture, graft shortening, fixation, subluxation, joint narrowing and subchondral bone was used for evaluation of the radiographs. Twenty-one patients (68%) showed complete incorporation of graft and eight patients (26%) had partial incorporation. The overall radiographic evaluation rate was 81%. Fracture (10%) and infection (16%) were the main complications. No local recurrence was detected. These results indicate that pasteurization of bone is a useful option for reconstruction after resection of malignant bone tumors. (orig.)

  15. Cold neutron radiographic apparatus and method

    International Nuclear Information System (INIS)

    Larsen, J.E.

    1979-01-01

    An improved cold neutron radiographic apparatus and method are disclosed wherein neutron temperature is matched to the specific material to be examined. This can be done, in one embodiment, by placing a radioactive source of neutrons, such as californium-252, in a moderator such as solid methane and using a cryogenic refrigeration system to cool the moderator to any preselected cryogenic temperature

  16. Radiographic analysis of ameloblastoma: A retrospective study

    Directory of Open Access Journals (Sweden)

    Chandramani More

    2012-01-01

    Conclusion: Radiographs are an important aid for the diagnosis of oral lesions of various types, especially those that involve bone. It is important for the practicing clinicians to know the salient features of ameloblastoma which are peculiar to the local population.

  17. Assessment of radiation protection practices among radiographers ...

    African Journals Online (AJOL)

    Background: Use of ionising radiation in diagnostic radiography could lead to hazards such as somatic and genetic damages. Compliance to safe work and radiation protection practices could mitigate such risks. The aim of the study was to assess the knowledge and radiation protection practices among radiographers in ...

  18. Unusual radiographic changes of a gout patient

    International Nuclear Information System (INIS)

    Markota, J.

    2004-01-01

    Background. Gout is a metabolic disorder that results in hyperuricemia and accumulation of uric acid crystals (urats) in tissues, especially joint cartilage. The gouty arthritis presents as acute attacks of arthritis leading eventually to chronic gouty arthritis. In 80% of cases it first occurs in the matatarsophalangeal (MTP) joint of the great toe and is more frequent in male population. Case report. We present a case of unusual radiographic changes accompanying gouty arthritis. A 63 year old female complained about swelling of the first MTP joint on the right, right knee, about stiffness of feet and hands' digits and about backache. First symptoms started to appear 30 years ago. In the time of examination radiographs displayed degenerative changes of the majority of presented joints, bilateral sacroiliitis and osseous ankylosis of both insteps. Microscopic examination showed urate crystals in the samples of the synovial fluid aspirated from the knee. The histological findings of the synovial tissue after the synovectomy were also in favour of gouty arthritis. Conclusions. Radiographs are the most important imaging modality in the diagnostic process of gout. However, radiographic differential diagnosis can be difficult, since the findings overlap with other conditions which cause arthritis and osteoarthritis especially in longstanding gout, elderly patients and females. The diagnosis must be often confirmed with the help of laboratory and histological findings. (author)

  19. Comparison of radiographic technique by computer simulation

    International Nuclear Information System (INIS)

    Brochi, M.A.C.; Ghilardi Neto, T.

    1989-01-01

    A computational algorithm to compare radiographic techniques (KVp, mAs and filters) is developed based in the fixation of parameters that defines the images, such as optical density and constrast. Before the experience, the results were used in a radiography of thorax. (author) [pt

  20. Radiographic and radionuclide findings in Rhizopus osteomyelitis

    Energy Technology Data Exchange (ETDEWEB)

    Moore, P.H. Jr.; McKinney, R.G.; Mettler, F.A. Jr.

    1978-06-01

    A case of Rhizopus osteromyelitis is described. The radionuclide and radiographic findings differ from those of osteomyelitis secondary to common pathogens: low-level radionuclide activity is observed, while soft-tissue swelling, periosteal reaction, and loss of fascial margins are absent.

  1. A Tutorial for Performing a Radiographic Examination

    Science.gov (United States)

    2017-03-01

    process in setting up, developing, documenting, and performing industrial radiography . The examples provided within this report are specific to the...equipment selection, (4) developing a technique , (5) verifying image quality, and (6) organizing proper documentation. Each section will provide...SUBJECT TERMS Radiography Munitions X-ray Nondestructive testing (NDT) Radiographic testing (RT) 16. SECURITY CLASSIFICATION

  2. Detecting objects in radiographs for homeland security

    Science.gov (United States)

    Prasad, Lakshman; Snyder, Hans

    2005-05-01

    We present a general scheme for segmenting a radiographic image into polygons that correspond to visual features. This decomposition provides a vectorized representation that is a high-level description of the image. The polygons correspond to objects or object parts present in the image. This characterization of radiographs allows the direct application of several shape recognition algorithms to identify objects. In this paper we describe the use of constrained Delaunay triangulations as a uniform foundational tool to achieve multiple visual tasks, namely image segmentation, shape decomposition, and parts-based shape matching. Shape decomposition yields parts that serve as tokens representing local shape characteristics. Parts-based shape matching enables the recognition of objects in the presence of occlusions, which commonly occur in radiographs. The polygonal representation of image features affords the efficient design and application of sophisticated geometric filtering methods to detect large-scale structural properties of objects in images. Finally, the representation of radiographs via polygons results in significant reduction of image file sizes and permits the scalable graphical representation of images, along with annotations of detected objects, in the SVG (scalable vector graphics) format that is proposed by the world wide web consortium (W3C). This is a textual representation that can be compressed and encrypted for efficient and secure transmission of information over wireless channels and on the Internet. In particular, our methods described here provide an algorithmic framework for developing image analysis tools for screening cargo at ports of entry for homeland security.

  3. Identifying murder victims with endodontic radiographs

    Science.gov (United States)

    Silva, Rhonan Ferreira; Franco, Ademir; Mendes, Solon Diego Santos Carvalho; Picoli, Fernando Fortes; Nunes, Fernando Gomes; Estrela, Carlos

    2016-01-01

    Endodontics is a special branch of dentistry constantly guided by imaging examinations. From a forensic scope, endodontics plays a valuable role providing solid antemortem (AM) radiographic evidence for comparison with postmortem findings in human identifications. This study illustrates the interface between endodontics and forensic odontology describing three cases of human identification based on radiographic endodontic records. From 2009 to 2012, three unknown male victims of murder were examined in a local Brazilian medico-legal institute to retrieve identity and potential cause of death. Specifically, when asked for AM data, a relative of the three victims provided periapical radiographs of endodontic treatments. Based on that, forensic dentists reproduced the same imaging acquisition techniques obtaining similar periapical radiographs, enabling a comparative dental identification. All the victims were positively identified based on patterns of dental morphology and treatment intervention. This study draws the attention of general and forensic dentists highlight the importance of properly recording dental treatments and searching for evidence in AM endodontic data, respectively. PMID:28123272

  4. Correlation Of Radiographic Patterns Of Pulmonary Tuberculosis ...

    African Journals Online (AJOL)

    Patients with higher CD4+ counts often present in \\"classic\\" fashion (upper zone infiltrates cavities) whereas those with low CD4+ counts are more likely to present atypically. The chest radiographic appearances of HIV-seropositive patients presenting with pulmonary tuberculosis (PTB) are diverse, creating difficulty in ...

  5. incidence of occupational stress among medical radiographers

    African Journals Online (AJOL)

    Summary: Biomechanical and Psychosocial stresses are capable of destabilizing any health care professional. The current health sector reform in Nigeria, which lays emphasis on service delivery on a background of very few radiographers, may lead to an increase in stress level. This study investigated the incidence of ...

  6. Effects of rotation radiographic dimensions of metacarpals

    International Nuclear Information System (INIS)

    Armes, F.M.; Horsman, A.; Bentley, H.B.

    1979-01-01

    An experiment is described which shows that small rotations of metacarpals about their long axis produce small systematic changes in the cortical dimensions as measured by radiographic morphometry. The effect is of no significance in cross-sectional studies but is an important source of error in sequential studies. (author)

  7. Thoracic radiographic anatomy in goats | Makungu | Tanzania ...

    African Journals Online (AJOL)

    . The aorta was not clearly visible on lateral views. The mean ratio of the CVC diameter to the height of the fourth thoracic vertebral body (T4) was 1.08 ± 0.07. Speciesspecific differences exist in the normal radiographic anatomy of the thorax.

  8. The Reliability of Assessing Radiographic Healing of Osteochondritis Dissecans of the Knee.

    Science.gov (United States)

    Wall, Eric J; Milewski, Matthew D; Carey, James L; Shea, Kevin G; Ganley, Theodore J; Polousky, John D; Grimm, Nathan L; Eismann, Emily A; Jacobs, Jake C; Murnaghan, Lucas; Nissen, Carl W; Myer, Gregory D; Weiss, Jennifer; Edmonds, Eric W; Anderson, Allen F; Lyon, Roger M; Heyworth, Benton E; Fabricant, Peter D; Zbojniewicz, Andy

    2017-05-01

    The reliability of assessing healing on plain radiographs has not been well-established for knee osteochondritis dissecans (OCD). To determine the inter- and intrarater reliability of specific radiographic criteria in judging healing of femoral condyle OCD. Cohort study (Diagnosis); Level of evidence, 3. Ten orthopedic sports surgeons rated the radiographic healing of 30 knee OCD lesions at 2 time points, a minimum of 1 month apart. First, raters compared pretreatment and 2-year follow-up radiographs on "overall healing" and on 5 subfeatures of healing, including OCD boundary, sclerosis, size, shape, and ossification using a continuous slider scale. "Overall healing" was also rated using a 7-tier ordinal scale. Raters then compared the same 30 pretreatment knee radiographs in a stepwise progression to the 2-, 4-, 7-, 12-, and 24-month follow-up radiographs on "overall healing" using a continuous slider scale. Interrater and intrarater reliability were assessed using intraclass correlations (ICC) derived from a 2-way mixed effects analysis of variance for absolute agreement. Overall healing of the OCD lesions from pretreatment to 2-year follow-up radiographs was rated with excellent interrater reliability (ICC = 0.94) and intrarater reliability (ICC = 0.84) when using a continuous scale. The reliability of the 5 subfeatures of healing was also excellent (interrater ICCs of 0.87-0.89; intrarater ICCs of 0.74-0.84). The 7-tier ordinal scale rating of overall healing had lower interrater (ICC = 0.61) and intrarater (ICC = 0.68) reliability. The overall healing of OCD lesions at the 5 time points up to 24 months had interrater ICCs of 0.81-0.88 and intrarater ICCs of 0.65-0.70. Interrater reliability was excellent when judging the overall healing of OCD femoral condyle lesions on radiographs as well as on 5 specific features of healing on 2-year follow-up radiographs. Continuous scale rating of OCD radiographic healing yielded higher reliability than the ordinal scale

  9. A new radiographic method for evaluating the degree of sliding in devices used in hip-fracture surgery

    International Nuclear Information System (INIS)

    Lunsjoe, K.; Ceder, L.; Aastroem, K.; Sparr, G.; Heyden, A.; Spanne, S.; Stigsson, L.; Hauggaard, A.

    1997-01-01

    Purpose: To find a practical method for estimating the degree of sliding that occurs in screw-plate devices used in hip-fracture surgery. Greater understanding of the sliding mechanisms in different fracture types should improve surgical technique and reduce the failure rate. Methods and Results: In dynamic screw-plate devices, the lag screw slides inside the barrel of the plate. A recent innovation allows the barrel-plate to slide inside a side-plate, thus making possible a combined fracture compression along the neck and the shaft of femur. The lengths of the different parts and the angle of a device in vivo, measured on a radiograph, depend on the position of the femur relative to the photographic film and the roentgen source. We obtained these measurements with a ruler and a protractor from sequential a.p. radiographs of the hip and implemented them in a special computerized program that used the principles of the scaled orthographic and the central projection models. These calculations provided the correct amount of sliding by the lag screw and by the barrel-plate within the side-plate. Conclusion: The method presented here can establish the real degree of sliding in screw-plate devices from standard a.p. radiographs independently of the position of the hip. (orig.)

  10. The glenohumeral offset ratio: A radiographic study.

    Science.gov (United States)

    Jacobson, S R; Mallon, W J

    1993-05-01

    A systematic method of component selection for total shoulder arthroplasty is needed. The method must take into account the soft-tissue constraints of a degenerative joint and optimize joint biomechanics by placing the joint line in the best possible position. The purpose of our study was to determine radiographically the normal glenohumeral joint line position based on a ratio of distances between the joint line and fixed landmarks on the humerus and scapula. We studied modified anteroposterior radiographs of the glenohumeral joint in 86 volunteers (51 men and 35 women; ages ranging from 21 to 47 years). Two measurements were made on each radiograph: (1) the perpendicular distance from the most medial portion of the glenoid to the inferior base of the coracoid process at its attachment to the scapular blade, and (2) the perpendicular distance from the midline of the humeral shaft to the most medial point on the humeral head. The joint line position was described as the ratio of the glenoid measurement to the sum of the two measurements (i.e., the glenohumeral offset ratio). The validity and reliability of glenoid offset measurements were determined by comparing radiographic and anatomic measurements of glenoid offset in cadaveric human scapulae. Radiographs were made with rotational error to determine its effects on the measurement of humeral offset. Humeral offsets and glenoid thicknesses of five different total shoulder systems were then determined from template overlays. The mean glenohumeral offset ratio was 0.31 (range 0.18 to 0.39). We detected no significant difference in the ratio between men and women volunteers. There was close agreement between radiographie and direct (anatomic) measurements of glenoid offset in cadaveric scapulae. Values for humeral offset were not significantly affected by radiographic rotational error. The evidence indicates that a fairly constant glenohumeral offset ratio in normal shoulders can be reliably calculated from a single

  11. AIRE variations in Addison's disease and autoimmune polyendocrine syndromes (APS)

    DEFF Research Database (Denmark)

    Bøe Wolff, A S; Oftedal, B; Johansson, S

    2008-01-01

    Autoimmune Addison's disease (AAD) is often associated with other components in autoimmune polyendocrine syndromes (APS). Whereas APS I is caused by mutations in the AIRE gene, the susceptibility genes for AAD and APS II are unclear. In the present study, we investigated whether polymorphisms...

  12. Teaching Materials and Strategies for the AP Music Theory Exam

    Science.gov (United States)

    Lively, Michael T.

    2017-01-01

    Each year, many students take the Advanced Placement (AP) Music Theory Exam, and the majority of these students enroll in specialized AP music theory classes as part of the preparation process. For the teachers of these AP music theory classes, a number of challenges are presented by the difficulty and complexity of the exam subject material as…

  13. Image rejects/retakes--radiographic challenges.

    Science.gov (United States)

    Waaler, D; Hofmann, B

    2010-01-01

    A general held position among radiological personnel prior to digitalisation was that the problem of image rejects/retakes should more or less vanish. However, rejects/retakes still impose several challenges within radiographic imaging; they occupy unnecessary resources, expose patients to unnecessary ionizing radiation and may also indicate suboptimal quality management. The latter is the main objective of this paper, which is based on a survey of international papers published both for screen/film and digital technology. The digital revolution in imaging seems to have reduced the percentage of image rejects/retakes from 10-15 to 3-5 %. The major contribution to the decrease appears to be the dramatic reduction of incorrect exposures. At the same time, rejects/retakes due to lack of operator competence (positioning, etc.) are almost unchanged, or perhaps slightly increased (due to lack of proper technical competence, incorrect organ coding, etc.). However, the causes of rejects/retakes are in many cases defined and reported with reference to radiographers' subjective evaluations. Thus, unless radiographers share common views on image quality and acceptance criteria, objective measurements and assessments of reject/retake rates are challenging tasks. Interestingly, none of the investigated papers employs image quality parameters such as 'too much noise' as categories for rejects/retakes. Surprisingly, no reject/retake analysis seems yet to have been conducted for direct digital radiography departments. An increased percentage of rejects/retakes is related to 'digital skills' of radiographers and therefore points to areas for extended education and training. Furthermore, there is a need to investigate the inter-subjectivity of radiographers' perception of, and attitude towards, both technical and clinical image quality criteria. Finally, there may be a need to validate whether reject/retake rate analysis is such an effective quality indicator as has been asserted.

  14. Image rejects/retakes-radiographic challenges

    International Nuclear Information System (INIS)

    Waaler, D.; Hofmann, B.

    2010-01-01

    A general held position among radiological personnel prior to digitalisation was that the problem of image rejects/retakes should more or less vanish. However, rejects/retakes still impose several challenges within radiographic imaging; they occupy unnecessary resources, expose patients to unnecessary ionizing radiation and may also indicate suboptimal quality management. The latter is the main objective of this paper, which is based on a survey of international papers published both for screen/film and digital technology. The digital revolution in imaging seems to have reduced the percentage of image rejects/retakes from 10-15 to 3-5%. The major contribution to the decrease appears to be the dramatic reduction of incorrect exposures. At the same time, rejects/retakes due to lack of operator competence (positioning, etc.) are almost unchanged, or perhaps slightly increased (due to lack of proper technical competence, incorrect organ coding, etc.). However, the causes of rejects/retakes are in many cases defined and reported with reference to radiographers' subjective evaluations. Thus, unless radiographers share common views on image quality and acceptance criteria, objective measurements and assessments of reject/retake rates are challenging tasks. Interestingly, none of the investigated papers employs image quality parameters such as 'too much noise' as categories for rejects/retakes. Surprisingly, no reject/retake analysis seems yet to have been conducted for direct digital radiography departments. An increased percentage of rejects/retakes is related to 'digital skills' of radiographers and therefore points to areas for extended education and training. Furthermore, there is a need to investigate the inter subjectivity of radiographers' perception of, and attitude towards, both technical and clinical image quality criteria. Finally, there may be a need to validate whether reject/retake rate analysis is such an effective quality indicator as has been asserted

  15. Radiographic patterns of osteoporotic proximal humerus fractures.

    Science.gov (United States)

    Carbone, Stefano; Mezzoprete, Riccardo; Papalia, Matteo; Arceri, Valerio; Carbone, Andrea; Gumina, Stefano

    2018-03-01

    The objectives of the study were: a) to identify osteoporotic proximal humerus fractures in a large consecutive series of patients; b) to identify radiographic fracture patterns among osteoporotic and non-osteoporotic proximal humerus fractures; and c) to calculate intra- and inter-observer reliability of assessment of osteoporosis and of radiographic fracture patterns. This was a prospective observational study of patients admitted to the emergency department affected by a proximal humerus fracture between June 2014 and June 2016. Three researchers evaluated demographic data and comorbidities, x-rays and CT-scans. A new evaluation method for assessment of osteoporosis was proposed; 7 radiographic fracture patterns were studied. Reliabilities between intra- and inter-tester evaluations, and correlations between the presence of osteoporosis and the 7 radiologic fracture patterns were calculated. Two hundred twenty-five patients with a humeral fracture were recruited. Their mean (26-95, 32) age was 58. Of those, 163 (72.4%) were identified as osteoporotic. Among the three raters, the intra- and inter-observer agreement using the proposed methods were high or excellent. Significant correlations with diagnosis of osteoporosis were found with Codman-Lego type 12(p = 0.041), metaphyseal comminution(p patterns were high. Osteoporosis of the proximal humerus was identified in 72% of patients during a two year period; most of these patients were elderly females sustaining low energy trauma. These fractures showed to have specific radiographic patterns, as comminution of metaphysis and tuberosities, impaction of fragments, and inferior subluxation of the humeral head. These patterns can be assessed with the simple observation of a 2-plan view of a radiograph, without the use of specific software. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Predicting lower third molar eruption on panoramic radiographs after cephalometric comparison of profile and panoramic radiographs

    DEFF Research Database (Denmark)

    Begtrup, Anders; Grønastøð, Halldis Á; Christensen, Ib Jarle

    2012-01-01

    and to find a simple and reliable method for predicting the eruption of the mandibular third molar by measurements on panoramic radiographs. The material consisted of profile and panoramic radiographs, taken before orthodontic treatment, of 30 males and 23 females (median age 22, range 18-48 years......Previous studies have suggested methods for predicting third molar tooth eruption radiographically. Still, this prediction is associated with uncertainty. The aim of the present study was to elucidate the association between cephalometric measurements on profile and panoramic radiographs...... the length from the ramus to the incisors (olr-id) showed a statistically significant correlation. By combining this length with the mesiodistal width of the lower second molar, the prediction of eruption of the lower third molar was strengthened. A new formula for calculating the probability of eruption...

  17. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  18. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  19. Recognizing the radiographic features of some common bovine foot problems

    International Nuclear Information System (INIS)

    Ebeid, M.; Steiner, A.

    1996-01-01

    Radiographs of an injured or infected bovine foot can be tricky to interpret - the anatomy is complex, and the signs may be subtle. This guide leads you through the classic radiographic features of several common foot conditions

  20. CsAP3: a cucumber homolog to Arabidopsis APETALA3 with novel characteristics

    Directory of Open Access Journals (Sweden)

    Jinjing Sun

    2016-08-01

    Full Text Available In our previous efforts to understand the regulatory mechanisms of cucumber unisexual flower development, we observed a stamen-specific down-regulation of the ethylene receptor CsETR1 in stage 6 female flowers of cucumber (Cucumis sativus L. This down-regulation is correlated with the primordial anther-specific DNA damage that characterizes inappropriate stamen development in cucumber female flowers. To understand how CsETR1 is down regulated in the stamen, we characterized a cucumber MADS box gene homologous to Arabidopsis AP3, CsAP3. We demonstrated that CsAP3 is functionally equivalent to the Arabidopsis B-class MADS gene AP3. However, three novel characteristics of CsAP3 were found. These include firstly, binding and activating CsETR1 promoter in vitro and in vivo; secondly, containing a GV repeat in its C-terminus, which is conserved in cucurbits and required for the transcription activation; and thirdly, decreased expression as the node number increases, which is similar to that found for CsETR1. These findings revealed not only the conserved function of CsAP3 as a B-class floral identity gene, but also its unique functions in regulation of female flower development in cucumber.

  1. Comparing traditional AP classes to portfolio AP classes in effectiveness of measuring knowledge.

    Directory of Open Access Journals (Sweden)

    Olona, L.

    2017-07-01

    Full Text Available High school students across the United States and internationally take Advanced Placement exams in May each year. These students also spend their school year enrolled in an Advanced Placement (AP class in preparation for the exam. There is a lack of research on any correlation between a student’s performance in class and performance on the exam. This study aims to compare the difference in correlation between traditional AP classes and portfolio AP classes. Second-semester grades and exam scores were collected from 2015 and 2016 from Norman High School students. Traditional classes had weak, if any, correlation, and portfolio classes presented no correlation. This lack of a relationship between class grade and exam score implies that students are unable to gauge their future exam performance based on class performance. Future researchers should compare data for a greater sample of students as well as regional samples.

  2. Radiographically visualized skeletal changes associated with mucopolysaccharidosis VI in cats

    International Nuclear Information System (INIS)

    Konde, L.J.; Thrall, M.A.; Gasper, P.; Dial, S.M.; McBiles, K.; Colgan, S.; Haskins, M.

    1987-01-01

    The radiographic skeletal form and structure of all cats with mucopolysaccharidosis VI is described. Common manifestations included epiphyseal dysplasia, generalized osteoporosis, abnormal nasal turbinate development, his subluxation, impaired development of skeletal growth, pectus excavatum, hyoid hypoplasia, aplasia, hypoplasia and fragmentation or abnormal ossification of the dens, and aplasia or hypoplasia of frontal and sphenoid sinuses. The skeletal measurements of two affected cats were compared with those of normal, sex-matched littermates, and the measurements of two affected female cats were compared with those of a normal male littermate

  3. Errors in radiographic recognition in the emergency room

    International Nuclear Information System (INIS)

    Britton, C.A.; Cooperstein, L.A.

    1986-01-01

    For 6 months we monitored the frequency and type of errors in radiographic recognition made by radiology residents on call in our emergency room. A relatively low error rate was observed, probably because the authors evaluated cognitive errors only, rather than include those of interpretation. The most common missed finding was a small fracture, particularly on the hands or feet. First-year residents were most likely to make an error, but, interestingly, our survey revealed a small subset of upper-level residents who made a disproportionate number of errors

  4. Diabetic Mastopathy as a Radiographically Occult Palpable Breast Mass

    Directory of Open Access Journals (Sweden)

    Uma Thanarajasingam

    2011-01-01

    Full Text Available Diabetic mastopathy is an uncommon, benign disease of the breast that can occur in women with diabetes and clinically mimic breast cancer. We describe a patient with long-standing type 1 diabetes who presented with a palpable breast mass with negative imaging findings on mammography, ultrasonography, and breast MRI. Surgical biopsy and histopathology confirmed diabetic mastopathy. We use this case to highlight the recognition, radiographic features, pathology, and management of this benign breast condition and emphasize that, in diabetic patients, the differential diagnosis of a new breast mass should include diabetic mastopathy.

  5. Gold-wire artifacts on diagnostic radiographs: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Keestra, Johan Anton Jochum; Jacobs, Reinhilde; Quirynen, Marc [Dept. of Oral Health Sciences, KU Leuven and Dentistry, University Hospitals, KU Leuven, Leuven (Belgium)

    2014-03-15

    This report described a case in which diagnostic radiographs showed irregular dense radiopaque strings and curved lines in the head and neck area. These artifacts could lead to misinterpretation since they may obscure anatomical structures and/or mask critical structures/pathologies. A more detailed history of the patient indicated that these strings originated from a facelift procedure in which a gold-wire technique was used. Considering that such intervention may cause a radiodiagnostic burden, it should be included in the anamnesis prior to radiography.

  6. Gold-wire artifacts on diagnostic radiographs: A case report

    International Nuclear Information System (INIS)

    Keestra, Johan Anton Jochum; Jacobs, Reinhilde; Quirynen, Marc

    2014-01-01

    This report described a case in which diagnostic radiographs showed irregular dense radiopaque strings and curved lines in the head and neck area. These artifacts could lead to misinterpretation since they may obscure anatomical structures and/or mask critical structures/pathologies. A more detailed history of the patient indicated that these strings originated from a facelift procedure in which a gold-wire technique was used. Considering that such intervention may cause a radiodiagnostic burden, it should be included in the anamnesis prior to radiography.

  7. Dyslipidemia and its relationship with antiphospholipid antibodies in APS patients in North Kerala.

    Science.gov (United States)

    Sadanand, Shajit; Paul, Binoy J; Thachil, Emil J; Meletath, Rejadheesh

    2016-12-01

    Antiphospholipid antibody syndrome (APS) is one of the most common acquired thrombophilic disorders resulting in arterial and venous thromboses. APS is a major cause for cerebrovascular accidents or stokes, myocardial infarction, venous thromboembolism and recurrent abortions/pregnancy losses especially in young patients. APS patients have an increased risk of atherosclerotic cardiovascular events. There are only two studies on lipid abnormalities in APS patients. None of them have studied the relationship between individual laboratory tests for APS and lipid profile abnormalities. Here we describe the significance of the relationship between various APS tests and lipid profile abnormalities in a subset of APS patients who presented with arterial thrombosis in a tertiary care hospital. The study was conducted at Government Medical College, which is a tertiary care referral hospital. All patients who presented to the medicine department with APS during a two-year period were studied. A patient was considered to be positive for anticardiolipin (aCL) antibody or anti-β2 glycoprotein (anti-β2G) if the titer was more than 15 IU/mL, and a high titer was considered to be more than 40 IU/mL for Immunoglobulin (lg) IgG and IgM isotypes. The fasting lipid profile was measured in all patients, and lipid profile abnormalities were defined with cutoffs of low-density lipoprotein (LDL) levels of >150 mg/dL, triglyceride (TG) levels of >150 mg/dL, and high-density lipoprotein (HDL) levels of APS, aCL IgG and IgM and anti-β2G IgG and IgM, were determined by statistical analysis. The study population included 77 APS patients, with 53% of patients between 20 and 40 years. The commonest abnormality in the lipid profile test was elevated TG levels of >150 mg/dL in 51.9% of the patients, followed by low HDL levels (150 mg/dL) in 40.2% of the patients. There was a statistically significant relationship between anti-β2G IgG levels and HDL and LDL levels, but not TG levels. Only LDL

  8. The APS thin pulsed septum magnets

    International Nuclear Information System (INIS)

    Lopez, F.; Mills, F.; Milton, S.; Reeves, S.; Sheynin, S.; Thompson, K.; Turner, L.

    1994-01-01

    A thin (2-mm) eddy-current pulsed septum magnet was developed for use in the Advanced Photon Source (APS) machines. A number of different configurations of the magnet were assembled and tested in an effort to minimize the undesired leakage field in the stored-beam region. However, because of measured excessive leakage fields, an alternative direct-drive septum magnet was also constructed and tested. We present here the design specifications and acceptable performance criteria along with results of magnetic field measurements

  9. Tumores de apéndice cecal

    Directory of Open Access Journals (Sweden)

    Rubén Bembilbre Taboada

    1998-08-01

    Full Text Available Se realizó un estudio descriptivo-retrospectivo de 8 pacientes con tumores de apéndice cecal, en el período comprendido entre el 1 de enero de 1990 y el 1 de enero de 1997, los cuales fueron intervenidos quirúrgicamente en el Hospital Provincial Clinicoquirúrgico Docente "Dr. Gustavo Aldereguía". Se revisaron todos los libros de biopsias del Departamento de Anatomía Patológica correspondientes al período analizado, para obtener aquellos casos con diagnóstico de afección tumoral de apéndice. Se estudiaron las historias clínicas y se recogieron datos de interés como sexo, manifestaciones clínicas, diagnóstico presuntivo, diagnóstico anatomopatológico y tipo de intervención. La afección tumoral de apéndice cecal es infrecuente y constituyó el 0,38% del total de 20057 apéndices examinadas. No se hallaron diferencias respecto al sexo. Hubo un ligero predominio en pacientes con edades de más de 60 años. Los hallazgos clínicos más frecuentes fueron dolor agudo en fosa inguinal derecha y fiebre, con predominio del adenocarcinoma. Los principales resultados se exponen en tablasA retrospective-descriptive study of 8 patients with appendix ceci tumors attending the hospital from January 1st, 1990 to January 1st 1997 was made. These patients were operated at "Dr. Gustavo Aldereguía" clinical surgical teaching hospital in Cienfuegos. All the biopsy records of the analyzed period were checked in the Pathological Anatomy Department so as to collect those cases diagnosed with appendix ceci tumors. Medical records were examined and interesting data were collected as follows: sex, clinical symptoms, presumptive diagnosis, anatomopathological diagnosis and type of surgery. Tumors in appendix ceci are unusual and represented 0.38 % of 20 057 analyzed appendixes. Sex was not a determining factor. The disease was slightly predominant in patients over 60. The most frequent clinical findings were: nagging pain in the right inguinal fosa and

  10. Radiographic visualization of magma dynamics in an erupting volcano

    OpenAIRE

    Tanaka, Hiroyuki K. M.; Kusagaya, Taro; Shinohara, Hiroshi

    2014-01-01

    Radiographic imaging of magma dynamics in a volcanic conduit provides detailed information about ascent and descent of magma, the magma flow rate, the conduit diameter and inflation and deflation of magma due to volatile expansion and release. Here we report the first radiographic observation of the ascent and descent of magma along a conduit utilizing atmospheric (cosmic ray) muons (muography) with dynamic radiographic imaging. Time sequential radiographic images show that the top of the mag...

  11. Development of a valid and reliable test to assess trauma radiograph interpretation performance

    International Nuclear Information System (INIS)

    Neep, M.J.; Steffens, T.; Riley, V.; Eastgate, P.; McPhail, S.M.

    2017-01-01

    Objectives: The purpose of this investigation was to develop and examine the preliminary validity and reliability among radiographers of a test to assess trauma radiograph interpretation performance suitable for use among health professionals. Methods: Stage 1 examined 14,159 consecutive appendicular and axial examinations from a hospital emergency department over a 12 month period to quantify a typical anatomical region case-mix of trauma radiographs. A sample of radiographic cases representative of affected anatomical regions was then developed into the Image Interpretation Test (IIT). Stage 2 involved prospective investigations of the IIT's reliability (inter-rater, intra-rater, internal consistency) and validity (concurrent) among 41 radiographers. Results: The IIT included 60 cases. The median (interquartile range) clinical experience of participants was 5 (2–10) years. Case scores were internally consistent (Cronbach's alpha = 0.90). Favourable inter-rater reliability (kappa > 0.70 for 58/60 cases, Intra-class correlation coefficient (ICC) > 0.99 for total score) and intra-rater reliability (kappa > 0.90 for 60/60 cases, ICC > 0.99 for total score) was observed. There was a positive association between radiographers' confidence in image interpretation and IIT score (coefficient = 1.52, r-squared = 0.60, p < 0.001). Conclusions: The IIT developed during this investigation included a selection of radiographic cases consistent with anatomical regions represented in an adult trauma case-mix. This study has also provided foundational preliminary evidence to support the reliability and validity of the IIT among radiographers. The findings suggest that it is possible to assess image interpretation performance of adult trauma radiographs with this test. - Highlights: • Development of an Image Interpretation Test (IIT). • Cases consistent with anatomical regions represented in a typical adult trauma case-mix. • Development of a

  12. Studies of microparticles in patients with the antiphospholipid syndrome (APS).

    Science.gov (United States)

    Vikerfors, A; Mobarrez, F; Bremme, K; Holmström, M; Ågren, A; Eelde, A; Bruzelius, M; Antovic, A; Wallén, H; Svenungsson, E

    2012-06-01

    To study circulating platelet, monocyte and endothelial microparticles (PMPs, MMPs and EMPs) in patients with antiphospholipid syndrome (APS) in comparison with healthy controls. Fifty-two patients with APS and 52 healthy controls were investigated. MPs were measured on a flow cytometer (Beckman Gallios) and defined as particles sized APS patients versus controls (p APS patients. We observed a high number of EMPs expressing TF in APS patients. The numbers of MMPs and total EMPs were also higher as compared with healthy controls but in contrast to previous reports, the number of PMPs did not differ between groups.

  13. The radiographic evaluation of endobronchial tuberculosis

    International Nuclear Information System (INIS)

    Choe, Kyu Ok

    1984-01-01

    Endobronchial tuberculosis is the tuberculous affection of bronchial wall during the process od sloughing of parenchymal necrotic material through airway. When the lesion results in complete obstruction, it resembles the features of central type endobronchial tumor. On the other hand, in the cases of incomplete obstruction very minimal parenchymal change, not corresponding with clinical symptoms, delays the correct diagnosis. This is the summary of 35 cases of endobronchial tuberculosis, diagnosed by bronchofiberscopy and biopsy of the lesion from 1982 to 1984 June in Yonsei University Medical Center. 1. 35 patients included 9 children and 26 adults. All children were less than 5 years old. In adults women occupied the majority and especially prevalent in 3rd decade. 2. The findings of plain chest showed lobar collapse and/or overinflation 8 (88.9%) in children group, but lobar collapse 13 (50%), minimal pulmonary tbc 9 (34.5%) and moderately advanced pulmonary tbc 4 (15.5%) in adults group. 3. In 20 patients the bronchial lesion itself was evaluated by bronchotomogram or bronchogram. The incidence of right and left affection was same, the each side included 10 patients. But the most frequent affected site was left main bronchus (10). In right side 6 patients showed main lesion only on lobar and/or segmental bronchi. 4. The lesion site of bronchus showed complete obstruction in 12, among which symmetric V-shape obstruction in 8, abrupt amputation in 2 and nodular protruding mass in 2. In remaining 8 incomplete obstruction 2 showed diffuse irregular nodularity 3 smooth long concentric narrowing and 3 concentric focal narrowing. 5. Proximal to the lesion, gradual and symmetric narrowing of bronchial lumen fairly long distance was noted in 5, which corresponded with typical bronchoscope finding. The other 2 showed the extension of tuberculous lesion to the ipsilateral wall of distal trachea. 6. Distal to the lesion 12 patients showed patency of bronchial lumen, of

  14. Appearance of the mandibular incisive canal on panoramic radiographs

    NARCIS (Netherlands)

    Jacobs, R.; Mraiwa, N.; van Steenberghe, D.; Sanderink, G.C.H.; Quirynen, M.

    2004-01-01

    Panoramic radiographs are routinely used in the dental office for various diagnostic purposes. This study aimed to evaluate the visibility of neurovascular structures in the mandibular interforaminal region on such radiographs. Panoramic radiographs were obtained with a Cranex Tome (Soredex) from

  15. 21 CFR 892.1970 - Radiographic ECG/respirator synchronizer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Radiographic ECG/respirator synchronizer. 892.1970... (CONTINUED) MEDICAL DEVICES RADIOLOGY DEVICES Diagnostic Devices § 892.1970 Radiographic ECG/respirator synchronizer. (a) Identification. A radiographic ECG/respirator synchronizer is a device intended to be used to...

  16. The palmar metric: A novel radiographic assessment of the equine ...

    African Journals Online (AJOL)

    Digital radiographs are often used to subjectively assess the equine digit. Recently, quantitative and objective radiographic measurements have been reported that give new insight into the form and function of the equine digit. We investigated a radio-dense curvilinear profile along the distal phalanx on lateral radiographs ...

  17. 21 CFR 892.1960 - Radiographic intensifying screen.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Radiographic intensifying screen. 892.1960 Section... (CONTINUED) MEDICAL DEVICES RADIOLOGY DEVICES Diagnostic Devices § 892.1960 Radiographic intensifying screen. (a) Identification. A radiographic intensifying screen is a device that is a thin radiolucent sheet...

  18. Radiographic findings in Marfan's syndrome

    International Nuclear Information System (INIS)

    Watanabe, Yasutaka; Tanaka, Osamu; Koyama, Shinichiro

    2010-01-01

    Spontaneous pneumothorax and apical bulla are included in minor criteria of the diagnosis of Marfan's syndrome. We evaluated the frequency of radiological abnormal findings of the lung in Marfan's syndrome. Lungs could be assessed with CT in 38 cases that were selected from 50 cases in Marfan's syndrome with a cardiovascular disease or the valvular disease. Eleven cases (22%) in 50 cases had the past history of spontaneous pneumothorax. Chest CT scan in 38 cases showed emphysematous bullae in 12 cases, apical scar in eight cases, centrilobular emphysema in three cases, and bronchiectasis in one case. CT manifestations of the lung in Marfan's syndrome were mainly spontaneous pneumothorax and apical bullae as were previously reported. (author)

  19. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  20. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE