WorldWideScience

Sample records for antimony 138

  1. Antimony Toxicity

    Directory of Open Access Journals (Sweden)

    Shyam Sundar

    2010-12-01

    Full Text Available Antimony toxicity occurs either due to occupational exposure or during therapy. Occupational exposure may cause respiratory irritation, pneumoconiosis, antimony spots on the skin and gastrointestinal symptoms. In addition antimony trioxide is possibly carcinogenic to humans. Improvements in working conditions have remarkably decreased the incidence of antimony toxicity in the workplace. As a therapeutic, antimony has been mostly used for the treatment of leishmaniasis and schistosomiasis. The major toxic side-effects of antimonials as a result of therapy are cardiotoxicity (~9% of patients and pancreatitis, which is seen commonly in HIV and visceral leishmaniasis co-infections. Quality control of each batch of drugs produced and regular monitoring for toxicity is required when antimonials are used therapeutically.

  2. 13.8

    CERN Document Server

    Gribbin, John

    2015-01-01

    The twentieth century gave us two great theories of physics. The general theory of relativity describes the behaviour of very large things; quantum theory the behaviour of very small things. In this landmark book, John Gribbin - one of the best-known writers of popular science over the past 30 years - presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified 'Theory of Everything' that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe and everything. With his inimitable mixture of science, history and biography, Gribbin shows how - despite scepticism among many physicists - these two great theories are indeed very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age of the Universe: 13.8 billion years.

  3. Pentavalent Antimonials: New Perspectives for Old Drugs

    OpenAIRE

    Ribeiro, Raul R.; Cynthia Demicheli; Frédéric Frézard

    2009-01-01

    Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent stud...

  4. Pentavalent Antimonials: New Perspectives for Old Drugs

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro

    2009-06-01

    Full Text Available Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent studies suggest that pentavalent antimony acts as a prodrug that is converted to active and more toxic trivalent antimony. Other works support the direct involvement of pentavalent antimony. Recent data suggest that the biomolecules, thiols and ribonucleosides, may mediate the actions of these drugs. This review will summarize the progress to date on the chemistry and biochemistry of pentavalent antimony. It will also present the most recent works being done to improve antimonial chemotherapy. These works include the development of simple synthetic methods for pentavalent antimonials, liposome-based formulations for targeting the Leishmania parasites responsible for visceral leishmaniasis and cyclodextrin-based formulations to promote the oral delivery of antimony.

  5. FIRST REPORT ON OTOTOXICITY OF MEGLUMINE ANTIMONIATE

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Valete-Rosalino

    2014-09-01

    Full Text Available Introduction: Pentavalent antimonials are the first drug of choice in the treatment of tegumentary leishmaniasis. Data on ototoxicity related with such drugs is scarcely available in literature, leading us to develop a study on cochleovestibular functions. Case Report: A case of a tegumentary leishmaniasis patient, a 78-year-old man who presented a substantial increase in auditory threshold with tinnitus and severe rotatory dizziness during the treatment with meglumine antimoniate, is reported. These symptoms worsened in two weeks after treatment was interrupted. Conclusion: Dizziness and tinnitus had already been related to meglumine antimoniate. However, this is the first well documented case of cochlear-vestibular toxicity related to meglumine antimoniate.

  6. Antimony bioavailability in mine soils

    International Nuclear Information System (INIS)

    Antimony has low bioavailability in mining and smelting contaminated soils and bacterial biosensors are not suitable for its detection. - Five British former mining and smelting sites were investigated and found to have levels of total Sb of up to 700 mg kg-1, indicating high levels of contamination which could be potentially harmful. However, this level of Sb was found to be biologically unavailable over a wide range of pH values, indicating that Sb is relatively unreactive and immobile in the surface layers of the soil, remaining where it is deposited rather than leaching into lower horizons and contaminating ground water. Sb, sparingly soluble in water, was unavailable to the bacterial biosensors tested. The bioluminescence responses were correlated to levels of co-contaminants such as arsenic and copper, rather than to Sb concentrations. This suggests that soil contamination by Sb due to mining and smelting operations is not a severe risk to the environment or human health provided that it is present as immobile species and contaminated sites are not used for purposes which increase the threat of exposure to identified receptors. Co-contaminants such as arsenic and copper are more bioavailable and may therefore be seen as a more significant risk

  7. Perspectives of antimony compounds in oncology

    Institute of Scientific and Technical Information of China (English)

    Pankaj SHARMA; Diego PEREZ; Armando CABRERA; Nee ROSAS; Jose Luis ARIAS

    2008-01-01

    Antimony, a natural element that has been used as a drug for over more than 100 years, has remarkable therapeutic efficacy in patients with acute promyelocytic leukemia. This review focuses on recent advances in developing antimony anti- cancer agents with an emphasis on antimony coordination complexes, Sb (Ⅲ) and Sb (V). These complexes, which include many organometallic complexes, may provide a broader spectrum of antitumoral activity. They were compared with classical platinum anticancer drugs. The review covers the literature data pub- lished up to 2007. A number of antimonials with different antitumoral activities are known and have diverse applications, even though little research has been done on their possibilities. It might be feasible to develop more specific and effective inhibitors for phosphatase-targeted, anticancer therapeutics through the screen- ing of sodium stibogluconate (SSG) and potassium antimonyltartrate-related compounds, which are comprised of antimony conjugated to different organic moieties. For example, SSG appears to be a better inhibitor than suramin which is a compound known for its antineoplastic activity against several types of cancers.

  8. Preparation of nanosized antimony by mechanochemical reduction of antimony sulphide Sb2S3

    International Nuclear Information System (INIS)

    The preparation of nanosized antimony (grain size 19 nm) by high-energy milling of antimony sulphide Sb2S3 with elemental Fe as reducing element is reported. The mechanochemical reduction was performed in a planetary ball mill for 10-180 min. The process is rather straightforward with elemental antimony and iron sulphide (pyrrhotite-4H) being the only solid-state products. The process kinetics as described by X-ray diffraction (XRD) and vibrating sample magnetometer (VSM) magnetometry shows that most of the reduction is complete after 60 min of milling

  9. The Membrane Electrowinning Separation of Antimony from a Stibnite Concentrate

    Science.gov (United States)

    Yang, Jian-Guang; Yang, Sheng-Hai; Tang, Chao-Bo

    2010-06-01

    The main purpose of this study was to characterize and to extract antimony from a stibnite concentrate through electrowinning. This article reports an account of a study conducted on the optimization of the process parameters for antimony pentachloride circular leaching, purification, and electrowinning of antimony from antimony trichloride solution. The effect of electrowinning parameters, such as antimony and sodium chloride concentration in the catholyte, temperature, current density, polar distance, etc., on the voltage requirement and the current efficiency (CE) of antimony electrodeposition was explored. A maximum CE of more than 97 pct was attained with a catholyte composition of 70-g/L antimony, 25-g/L NaCl, 4.5-mol/L hydrogen ion concentration, with an anolyte composition of 40-g/L antimony trichloride at a temperature of 328 K (55 °C), a 4-cm polar distance, and a cathode current density of 200 A/m2. Under the optimized conditions, the CE was more than 97 pct, and a 99.98 pct antimony plate was obtained on the cathode. The chemical content analysis of the resulting anolyte was indicated to be 97 pct antimony pentachloride and 3 pct antimony trichloride, which could be recycled to leaching tank as the leaching agent.

  10. Synthesis and application of antimony pent(isooctyl thioglycollate)

    Institute of Scientific and Technical Information of China (English)

    LIU You-nian; LI Hong-bing; SHU Wan-gen; CHEN Qi-yuan

    2005-01-01

    A new type of thermal stabilizer, antimony pent(isooctyl thioglycollate)(Sb(SCH2COOC8H17)5), was synthesized by using antimony trioxide, isooctanol and thioglycolic acid in 2 steps. Firstly, antimony trioxide was oxidized into colloidal antimony peroxide. Then antimony peroxide and isooctyl thioglycollate reacted stoichiometrically for 2 h with the yield of 87%. This compound was used as thermal stabilizer for polyvinyl chloride(PVC). The results show that the thermal stability time is 52 min at 200 ℃ by heat-ageing oven test when adding 2.5% thermal stabilizer to PVC resin. Compared with antimony tris(isooctyl thiolycollate), the initial thermal stability of antimony pent(isooctyl thioglycollate) is better than that of antimony tris(isooctyl thioglycollate), while the long-term thermal stability time is shorter than that of antimony tris(isooctyl thioglycollate). Meanwhile, the synergism of antimony pent(isooctyl thioglycollate) with calcium stearate was studied, indicating that when the mass ratio of antimony pent(isooctyl thioglycollate) to calcium stearate is 2:1, the thermal stability time of PVC is 58 min.

  11. Novel methods for the encapsulation of meglumine antimoniate into liposomes

    Directory of Open Access Journals (Sweden)

    F. Frézard

    2000-07-01

    Full Text Available The antimonial drug, meglumine antimoniate, was successfully encapsulated in dehydration-rehydration vesicles and in freeze-dried empty liposomes (FDELs. High encapsulation efficiencies (from 28 to 58% and low weight ratios of lipids to encapsulated antimony (from 1:0.15 to 1:0.3 were achieved. These formulations, contrary to those obtained by conventional methods, can be stored as intermediate lyophilized forms and reconstituted just before use. The efficacy of FDEL-encapsulated meglumine antimoniate was evaluated in hamsters experimentally infected with Leishmania chagasi. A significant reduction of liver parasite burdens was observed in animals treated with this preparation, when compared to control animals treated with empty liposomes. In contrast, free meglumine antimoniate was found to be inefficient when administered at a comparable dose of antimony. This novel liposome-based meglumine antimoniate formulation appears to be promising as a pharmaceutical product for the treatment of visceral leishmaniasis.

  12. Microbial antimony biogeochemistry: Enzymes, regulation, and related metabolic pathways

    Science.gov (United States)

    Li, Jingxin; Qian Wang; Oremland, Ronald S.; Kulp, Thomas R.; Rensing, Christopher; Wang, Gejiao

    2016-01-01

    Antimony (Sb) is a toxic metalloid that occurs widely at trace concentrations in soil, aquatic systems, and the atmosphere. Nowadays, with the development of its new industrial applications and the corresponding expansion of antimony mining activities, the phenomenon of antimony pollution has become an increasingly serious concern. In recent years, research interest in Sb has been growing and reflects a fundamental scientific concern regarding Sb in the environment. In this review, we summarize the recent research on bacterial antimony transformations, especially those regarding antimony uptake, efflux, antimonite oxidation, and antimonate reduction. We conclude that our current understanding of antimony biochemistry and biogeochemistry is roughly equivalent to where that of arsenic was some 20 years ago. This portends the possibility of future discoveries with regard to the ability of microorganisms to conserve energy for their growth from antimony redox reactions and the isolation of new species of “antimonotrophs.”

  13. Vacuum Evaporation Technology for Treating Antimony-Rich Anode Slime

    Science.gov (United States)

    Qiu, Keqiang; Lin, Deqiang; Yang, Xuelin

    2012-11-01

    A vacuum evaporation technology for treating antimony-rich anode slime was developed in this work. Experiments were carried out at temperatures from 873 K to 1073 K and residual gas pressures from 50 Pa to 600 Pa. During vacuum evaporation, silver from the antimony-rich anode slime was left behind in the distilland in a silver alloy containing antimony and lead, and antimony trioxide was evaporated. The experimental results showed that 92% by weight of antimony can be removed, and the silver content in the alloy was up to 12.84%. The antimony trioxide content in the distillate was more than 99.7%, and the distillate can be used directly as zero-grade antimony trioxide (China standard).

  14. Study on determination of antimony in environmental samples by nuclear technique neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Tassiane Cristina Gomes; Saiki, Mitiko [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2010-07-01

    Full text: The Interest on determination of antimony in environmental samples has increased significantly in recent years due to the impact caused by human activities and their potential cumulative toxic at low concentrations, apart from not having known biological function. However, the quantification of antimony has interference problems due to low concentrations that hinder its analysis. Therefore becomes of great interest to establish adequate procedures for neutron activation analysis (NAA) to obtain reliable results in environmental samples. In this context, reference materials INCT-TL-1 Tea Leaves, INCT-MPH -2 Mixed Polish Herbs, CTA-VTL-2 Virginia Tobaco Leaves, White Cabbage BCR-679, IAEA 140/TM Seaweed (Focus sp), IAEA -SL-1 Lake Sediment and IAEA-336 Lichen, were selected for analysis and evaluation of results. Aliquots of these standard synthetic materials and antimony were irradiated in the nuclear research reactor IEA-R1 under thermal neutron flux of approximately 5 x 1012 cm{sup -2} s{sup -1} for a period of 8 or 16 hours. After appropriate decay time, the induced gamma activity of the irradiated samples and standard was measured using hyperpure Ge detector coupled to the digital spectrum analyzer DAS 1000, both from Canberra. The radioisotopes measured with gamma ray energies and the half-life were Sb-122 (E{gamma} = 564keV ; t1=2 = 2:7d) and Sb - 124 (E{gamma} = 1692keV; t1=2 60:2d). Antimony concentrations were calculated by the comparative method and the uncertainties of the results were estimated using statistical error of the sample and standard counts Results obtained in these analyses showed a good agreement with certified values and relative errors varying from 0.78 to 13.8%. The values of the standardized difference or Z-scores obtained were lower than 2, indicating that the obtained data were within the range of certified values at a significance level of 68%, demonstrating the suitability of the method used for determination of antimony

  15. Study on determination of antimony in environmental samples by nuclear technique neutron activation analysis

    International Nuclear Information System (INIS)

    Full text: The Interest on determination of antimony in environmental samples has increased significantly in recent years due to the impact caused by human activities and their potential cumulative toxic at low concentrations, apart from not having known biological function. However, the quantification of antimony has interference problems due to low concentrations that hinder its analysis. Therefore becomes of great interest to establish adequate procedures for neutron activation analysis (NAA) to obtain reliable results in environmental samples. In this context, reference materials INCT-TL-1 Tea Leaves, INCT-MPH -2 Mixed Polish Herbs, CTA-VTL-2 Virginia Tobaco Leaves, White Cabbage BCR-679, IAEA 140/TM Seaweed (Focus sp), IAEA -SL-1 Lake Sediment and IAEA-336 Lichen, were selected for analysis and evaluation of results. Aliquots of these standard synthetic materials and antimony were irradiated in the nuclear research reactor IEA-R1 under thermal neutron flux of approximately 5 x 1012 cm-2 s-1 for a period of 8 or 16 hours. After appropriate decay time, the induced gamma activity of the irradiated samples and standard was measured using hyperpure Ge detector coupled to the digital spectrum analyzer DAS 1000, both from Canberra. The radioisotopes measured with gamma ray energies and the half-life were Sb-122 (Eγ = 564keV ; t1=2 = 2:7d) and Sb - 124 (Eγ = 1692keV; t1=2 60:2d). Antimony concentrations were calculated by the comparative method and the uncertainties of the results were estimated using statistical error of the sample and standard counts Results obtained in these analyses showed a good agreement with certified values and relative errors varying from 0.78 to 13.8%. The values of the standardized difference or Z-scores obtained were lower than 2, indicating that the obtained data were within the range of certified values at a significance level of 68%, demonstrating the suitability of the method used for determination of antimony in this type sample

  16. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    International Nuclear Information System (INIS)

    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122 Sb and 124 Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  17. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta Etel Treiger; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Lab. de Biologia Molecular]. E-mail: samanta@usp.br; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo (IMT-SP), SP (Brazil). Lab. de Protozoologia]. E-mail:hfandrad@usp.br

    2005-10-15

    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes {sup 122} Sb and {sup 124} Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  18. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    OpenAIRE

    Samanta Etel Treiger Borborema; Heitor Franco de Andrade Junior; João Alberto Osso Junior; Nanci do Nascimento

    2005-01-01

    Pentavalent antimony, as meglumine antimoniate (Glucantime® ) or sodium stibogluconate (Pentostam® ), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer...

  19. RNF138 joins the HR team

    DEFF Research Database (Denmark)

    Bekker-Jensen, Simon; Mailand, Niels

    2015-01-01

    Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

  20. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  1. The exposure to and health effects of antimony

    DEFF Research Database (Denmark)

    Cooper, Ross G.; Harrison, Adrian Paul

    2009-01-01

    . Antimony toxicity is dependent on the exposure dose, duration, route (breathing, eating, drinking, or skin contact), other chemical exposures, age, sex, nutritional status, family traits, life style, and state of health. Chronic exposure to antimony in the air at levels of 9 mg/m3 may exacerbate irritation...

  2. The presence of antimony in various dental filling materials

    International Nuclear Information System (INIS)

    Antimony was determined in a number of non-metallic dental materials currently used for tooth restoration. The method applied was instrumental neutron activation analysis. The concentration of antimony in some of the brands tested was found to be as high as 900 fold that in the normal hard dental tissues. (author)

  3. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    International Nuclear Information System (INIS)

    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb+5) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes 122Sb and 124Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony and high uptake in

  4. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta E.T.; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mails: samanta@usp.br; nnascime@ipen.br; Andrade Junior, Heitor F. de [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular; Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil); E-mail: hfandrad@usp.br; Osso Junior, Joao A. [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br

    2007-07-01

    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb{sup +5}) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes {sup 122}Sb and {sup 124}Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony

  5. MARS DESERT RESEARCH STATION: CREW 138

    OpenAIRE

    Roman-Gonzalez, Avid; Saab, Bechara; Berger, Jay; hoyt, johanna; Urquhart, Jimmy; guined, jamie

    2015-01-01

    Crew 138 was comprised of a team of highly-skilled professionals with varied backgrounds who were selected by the Mars Society to undertake a two-week interdisciplinary expedition at the Mars Desert Research Station near Hanksville, Utah. The Crew's activities ranged in scope from preparing operational handbooks and checklists for the Mars Desert Research Station, performing hardware and logistical evaluations for future research at MDRS, an analysis of Google Earth as a tool for geological f...

  6. Separation of traffic related antimony compounds

    International Nuclear Information System (INIS)

    Complete text of publication follows. It is known that most of the brake pads contain Sb2S3 as lubricant to achieve better friction stability. Due to braking the brake lining crumbles away and its Sb content gets into the air. As a result of the temperature increase accompanying the braking a part of the antimony may oxidize to oxides, as Sb2O3 or even to the more stable form, Sb2O4. Since Sb2O3 more readily soluble than the others, its absorption from the lung so its environmental impact effect is more harmful. After a systematic investigation involving solubilization of the solid compounds, citric and tartaric acid as well as 6 mol/dm3 HCl were tested for leaching of trace antimony compounds from natural matrix. To prepare reference material related to these species, soil and activated charcoal was spiked in 10 μg/g concentration with all the three material (Sb2S3, Sb2O3,Sb2O4). separately. Recovery of the different forms was checked by graphite furnace atomic absorption spectrometric (GFAAS) analysis of the leachates. The soil was confirmed to oxidize the sulfide content while the activated charcoal was established to enrich antimony from HCl solution as ion association complex. It was concluded, that Sb2S3 is leached only in slight amount in 4 hours by 0.1-0.5 mol/dm3 citric acid, while leaching of Sb2O3 is quantitative. On the other side, it was proved that Sb2O3 as well as Sb2S3 traces are soluble in 6 HCl solution in 60 min, whilst Sb2O4 is not destroyed. So, the Sb2O3 and Sb2S3 content of a flying dust can be determined. The GFAAS temperature program had to be modified in order to be capable to analyze high organic matrix as citric or tartaric acid even in 0.5 mol/dm3 concentration. Concerning their decomposition temperature an additional step was inserted into the temperature program, pyrolysis on 300 and 400 deg C, respectively. The antimony concentration of the highly acidic leachates were determined by hydride generation GFAAS. The reproducibility of

  7. Reducing NOx emissions with antimony additive

    International Nuclear Information System (INIS)

    This paper describes improvement in a process for the catalytic cracking of a heavy hydrocarbon feed containing Ni and nitrogen compounds by contact with a circulating inventory of catalytic cracking catalyst to produce catalytically cracked products and spent catalyst. It comprises: Ni or Ni compounds and coke comprising nitrogen compounds, and wherein the spent catalyst is regenerated by contact with oxygen or an oxygen-containing gas in a catalyst regeneration zone operating at catalyst regeneration conditions to produce hot regenerated catalyst comprising Ni or Ni compounds which is recycled to catalytically crack the heavy feed and the catalyst regeneration zone produces a flue gas comprising CO, CO2 and oxides of nitrogen, NOx. The improvement comprises: adding to the circulating catalyst inventory CO combustion promoter in an amount equivalent to 0.01 to 50 wt ppm Pt to reduce the CO content of the flue gas and reducing the NOx content of the flue gas by adding to the circulating catalyst inventory a separate particle additive comprising antimony. The additive being added in an amount sufficient to reduce the production of NOx relative to operation without the additive, and wherein the additive comprises a compound of antimony which does not substantially passivate the Ni or Ni compounds present on the cracking catalyst, nor deactivate the CO combustion promoter

  8. Investigation into antimony mobility in sewage sludge fermentation.

    Science.gov (United States)

    Wehmeier, Silvia; Feldmann, Jörg

    2005-12-01

    Antimony is distributed in the environment in inorganic and organic species with different solubility and mobility characters. Here we investigate the transformation of antimony in view of biomethylation during sewage sludge fermentation as a case study for an anaerobic environment. Our approach was to identify if antimony methylation follows the Challenger pathway by using isotopically enriched antimonite (123Sb(v)). The antimony source was subjected to methylation in sewage sludge, an anaerobic dominant methanogenic Archaea community. The antimony species were determined in the gas phase using cryotrapping (CT)-GC-ICP-MS, and in the medium (sewage slude) by hydride generation (HG) prior CT-GC-ICP-MS. The determined 123/121Sb isotope ratios in the volatile trimethylstibine and non-volatile methylantimony species indicated that the methylation follows the proposed methylation pathway. With this approach we were able to quantify 123Sb incorporation into monomethyl-, dimethyl- and trimethylantimony, respectively. The incorporation decreased with further methylation from 91% to 82% and 73%. Volatilisation as trimethystibine was generally lower than 0.1%, however, up to 0.8% of added antimony was found methylated to methylantimony species and mainly accumulated in the cell. Moreover, antimony biomethylation was enhanced by stimulation of the anaerobic communities of methanogenic Archaea and sulfate reducing bacteria (SRB), with the methanogens showing a higher activity. PMID:16307071

  9. 7 CFR 800.138 - Conflict of interest.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Conflict of interest. 800.138 Section 800.138 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Inspection Services § 800.138 Conflict of interest. Official personnel cannot perform or participate...

  10. 22 CFR Appendix A to Part 138 - Certification Regarding Lobbying

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Certification Regarding Lobbying A Appendix A to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. A Appendix A to Part 138—Certification Regarding Lobbying Certification for Contracts,...

  11. Dicty_cDB: VHD138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD138 (Link to dictyBase) - - - Contig-U12323-1 - (Link to Original site) ... yy*frf*virfmwqrk*ktlv nsscchctccwlcfnncsihvkkkds*q*nts **i Frame B: ---PTTTITKIISKDDKKVLISLDMPHCNQCLLDPDFS ... DNA Score E Sequences producing significant alignments : (bits) Value VHD138 (VHD138Q) /CSM/VH/VHD1-B/VHD1 ...

  12. 33 CFR 110.138 - Boston Harbor, Mass.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Boston Harbor, Mass. 110.138 Section 110.138 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.138 Boston Harbor, Mass. (a) The anchorage grounds—(1)...

  13. Structural and electrical characterization of zinc oxide doped with antimony

    Directory of Open Access Journals (Sweden)

    G. Juárez Díaz

    2014-08-01

    Full Text Available In this work we report the results of structural and electrical characterization realized on zinc oxide single crystal samples with (001 orientation, which were doped with antimony. Doping was carried out by antimony thermal diffusion at 1000 °C for periods of 1 and 2 hours under nitrogen environment from a solid source formed by antimony oxide. Electrical characterization by I-V curves and Hall effect shown an increase in acceptor concentration which demonstrates that doping is effective and create holes in zinc oxide samples.

  14. Nanometric Antimony Powder Synthesis by Activated Alkaline Hydride Reduction of Antimony Pentachloride

    International Nuclear Information System (INIS)

    A novel chemical reduction method using an activated alkaline hydride (LiH or NaH-t-BuONa) in tetrahydrofuran solvent has been applied to antimony salt reduction. X-ray diffraction and transmission electron microscopy studies have been carried out to characterize the morphology and structure of the materials. Alkali hydride nature influence has been proved. In both cases the process allows to prepare antimony particles in nanometer range from few nanometers to about 20nm which could be used as anodic materials for lithium-ion batteries. With lithium hydride well-crystallized particles inclined to agglomeration were observed whereas finely dispersed amorphous particles were pointing out after activated sodium hydride reduction

  15. Deposition of rod-shaped antimony sulfide thin films from single-source antimony thiosemicarbazone precursors

    Energy Technology Data Exchange (ETDEWEB)

    Biswal, Jasmine B.; Sawant, Narayan V. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India); Garje, Shivram S., E-mail: ssgarje@chem.mu.ac.i [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India)

    2010-04-02

    Antimony sulfide thin films were deposited on glass substrates by aerosol assisted chemical vapour deposition technique using single source precursors, namely, antimony(III) thiosemicarbazones, SbCl{sub 3}(L) (L = thiosemicarbazones of thiophene-2-carboxaldehyde (1) and cinnamaldehyde (2)). The deposited films were characterized by X-ray diffraction, scanning electron microscopy, energy dispersive X-ray analysis and UV-visible spectroscopy in order to identify their phases, morphologies, compositions and optical properties respectively. These characterizations revealed that the films were comprised of rod-shaped particles of orthorhombic stibnite (Sb{sub 2}S{sub 3}) with a Sb:S stoichiometry of {approx} 1:1.3. The calculated optical band gap from UV-vis absorption spectrum is found to be 3.48 eV.

  16. Antimony mobility in Japanese agricultural soils and the factors affecting antimony sorption behavior

    International Nuclear Information System (INIS)

    The mobility of antimony (Sb) in Japanese agricultural soils was studied by radiotracer experiments using 124Sb tracer. The soil-solution distribution coefficients (K d) of Sb were measured for 110 soil samples. These K ds ranged from 1 to 2065 L kg-1; the geometric mean was 62 L kg-1 excluding one extremely high value, 2065 L kg-1. Experimental measurement of K d showed a decrease with both increasing pH and increasing phosphate concentration. The latter suggested that one aspect of the Sb sorption phenomena in Japanese soil was influenced by specific adsorption of anions such as phosphate. However, other aspects could not be explained by this specific adsorption mechanism, because only 20-40% of soil-sorbed Sb could be extracted by phosphate solution. - Antimony mobility in tested Japanese agricultural soils was generally low and was affected by pH and phosphate concentration

  17. Selective determination of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone by atomic-absorption spectrometry with a carbon-tube atomizer.

    Science.gov (United States)

    Kamada, T; Yamamoto, Y

    1977-05-01

    The extraction behaviour of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone in organic solvents has been investigated by means of frameless atomic-absorption spectrophotometry with a carbon-tube atomizer. The selective extraction of antimony(III) and differential determination of antimony(III) and antimony(V) have been developed. With ammonium pyrrolidinedithiocarbamate and methyl isobutyl ketone, when the aqueous phase/solvent volume ratio is 50 ml/10 ml and the injection volume in the carbon tube is 20 mul, the sensitivity for antimony is 0.2 ng/ml for 1% absorption. The relative standard deviations are ca. 2%. Interferences by many metal ions can be prevented by masking with EDTA. The proposed methods have been applied satisfactorily to determination of antimony(III) and antimony(V) in various types of water. PMID:18962096

  18. Antimony distribution and environmental mobility at an historic antimony smelter site, New Zealand

    International Nuclear Information System (INIS)

    A historic antimony smelter site at Endeavour Inlet, New Zealand has smelter residues with up to 17 wt.% antimony. Residues include coarse tailings (cm scale particles, poorly sorted), sand tailings (well sorted) and smelter slag (blocks up to 30 cm across). All of this material has oxidised to some degree over the ca. 100 years since the site was abandoned. Oxidation has resulted in acidification of the residues down to pH 2-5. Smelter slag contains pyrrhotite (FeS) and metallic antimony, and oxidation is restricted to surfaces only. The coarse tailings are the most oxidised, and few sulfide grains persist. Unoxidised sand tailings contain 10-20 vol.% stibnite (Sb2S3) containing up to 5% As, with subordinate arsenopyrite (FeAsS), and minor pyrite (FeS2). The sand tailings are variably oxidised on a scale of 2-10 cm, but original depositional layering is preserved during oxidation and formation of senarmontite (Sb2O3). Oxidation of sand tailings has resulted in localised mobility of both Sb and As on the cm scale, resulting in redistribution of these metalloids with iron oxyhydroxide around sand grain boundaries. Experiments demonstrate that Sb mobility decreases with time on a scale of days. Attenuation of both As and Sb occurs due to adsorption on to iron oxyhydroxides which are formed during oxidation of the smelter residues. There is no detectable loss of Sb or As from the smelter site into the adjacent river, <50 m away, which has elevated Sb (ca. 20 μg/l) and As (ca. 7 μg /l) from mineralised rocks upstream. Despite the high concentrations of Sb and As in the smelter residues, these metalloids are not being released into the environment. - High levels of antimony in primitive smelter soils remain largely immobile on the metre scale

  19. Tissue distribution of residual antimony in rats treated with multiple doses of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Deise Riba Coelho

    2014-07-01

    Full Text Available Meglumine antimoniate (MA and sodium stibogluconate are pentavalent antimony (SbV drugs used since the mid-1940s. Notwithstanding the fact that they are first-choice drugs for the treatment of leishmaniases, there are gaps in our knowledge of their toxicological profile, mode of action and kinetics. Little is known about the distribution of antimony in tissues after SbV administration. In this study, we evaluated the Sb content of tissues from male rats 24 h and three weeks after a 21-day course of treatment with MA (300 mg SbV/kg body wt/d, subcutaneous. Sb concentrations in the blood and organs were determined by inductively coupled plasma-mass spectrometry. In rats, as with in humans, the Sb blood levels after MA dosing can be described by a two-compartment model with a fast (t1/2 = 0.6 h and a slow (t1/2 >> 24 h elimination phase. The spleen was the organ that accumulated the highest amount of Sb, while bone and thyroid ranked second in descending order of tissues according to Sb levels (spleen >> bone, thyroid, kidneys > liver, epididymis, lungs, adrenals > prostate > thymus, pancreas, heart, small intestines > skeletal muscle, testes, stomach > brain. The pathophysiological consequences of Sb accumulation in the thyroid and Sb speciation in the liver, thyroid, spleen and bone warrant further studies.

  20. How can we adapt to geological scarcity of antimony? Investigation of antimony's substitutability and of other measures to achieve a sustainable use

    NARCIS (Netherlands)

    Henckens, M.L.C.M.; Driessen, P.P.J.; Worrell, E.

    2016-01-01

    Abstract Antimony is an element that is applied in many useful applications for mankind. However, antimony resources are very scarce, when comparing the current extraction rates with the availability of antimony containing ores. From an inter-temporal sustainability perspective, current generations

  1. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials

    International Nuclear Information System (INIS)

    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1 M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by L-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3σ) of the proposed method was 0.02 ng mL-1 for antimony(III), and the relative standard deviation was 7.8% (c = 1.0 ng mL-1, n = 7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results.

  2. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials.

    Science.gov (United States)

    Jiang, Xiuming; Wen, Shengping; Xiang, Guoqiang

    2010-03-15

    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by l-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3 sigma) of the proposed method was 0.02 ng mL(-1) for antimony(III), and the relative standard deviation was 7.8% (c=1.0 ng mL(-1), n=7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results. PMID:19853991

  3. Antimony distribution and environmental mobility at an historic antimony smelter site, New Zealand.

    Science.gov (United States)

    Wilson, N J; Craw, D; Hunter, K

    2004-05-01

    A historic antimony smelter site at Endeavour Inlet, New Zealand has smelter residues with up to 17 wt.% antimony. Residues include coarse tailings (cm scale particles, poorly sorted), sand tailings (well sorted) and smelter slag (blocks up to 30 cm across). All of this material has oxidised to some degree over the ca. 100 years since the site was abandoned. Oxidation has resulted in acidification of the residues down to pH 2-5. Smelter slag contains pyrrhotite (FeS) and metallic antimony, and oxidation is restricted to surfaces only. The coarse tailings are the most oxidised, and few sulfide grains persist. Unoxidised sand tailings contain 10-20 vol.% stibnite (Sb2S3) containing up to 5% As, with subordinate arsenopyrite (FeAsS), and minor pyrite (FeS2). The sand tailings are variably oxidised on a scale of 2-10 cm, but original depositional layering is preserved during oxidation and formation of senarmontite (Sb2O3). Oxidation of sand tailings has resulted in localised mobility of both Sb and As on the cm scale, resulting in redistribution of these metalloids with iron oxyhydroxide around sand grain boundaries. Experiments demonstrate that Sb mobility decreases with time on a scale of days. Attenuation of both As and Sb occurs due to adsorption on to iron oxyhydroxides which are formed during oxidation of the smelter residues. There is no detectable loss of Sb or As from the smelter site into the adjacent river, <50 m away, which has elevated Sb (ca. 20 microg/l) and As (ca. 7 microg/l) from mineralised rocks upstream. Despite the high concentrations of Sb and As in the smelter residues, these metalloids are not being released into the environment. PMID:14987811

  4. Heat-treated Saccharomyces cerevisiae for antimony speciation and antimony(III) preconcentration in water samples

    International Nuclear Information System (INIS)

    An analytical method was developed for antimony speciation and antimony(III) preconcentration in water samples. The method is based on the selective retention of Sb(III) by modified Saccharomyces cerevisiae in the presence of Sb(V). Heat, caustic and solvent pretreatments of the biomass were investigated to improve the kinetics and thermodynamics of Sb(III) uptake process at room temperature. Heating for 30 min at 80 deg. C was defined as the optimal treatment. Antimony accumulation by the cells was independent of pH (5-10) and ionic strength (0.01-0.1 mol L-1). 140 mg of yeast and 2 h of contact were necessary to ensure quantitative sequestration of Sb(III) up to 750 μg L-1. In these conditions, Sb(V) was not retained. Sb(V) was quantified in sorption supernatant by inductively coupled plasma mass spectrometry (ICP-MS) or inductively coupled plasma optical emission spectrometry (ICP-OES). Sb(III) was determined after elution with 40 mmol L-1 thioglycolic acid at pH 10. A preconcentration factor close to nine was achieved for Sb(III) when 100 mL of sample was processed. After preconcentration, the detection limits for Sb(III) and Sb(V) were 2 and 5 ng L-1, respectively, using ICP-MS, 7 and 0.9 μg L-1 using ICP-OES. The proposed method was successfully applied to the determination of Sb(III) and Sb(V) in spiked river and mineral water samples. The relative standard deviations (n = 3) were in the 2-5% range at the tenth μg L-1 level and less than 10% at the lowest Sb(III) and Sb(V) tested concentration (0.1 μg L-1). Corrected recoveries were in all cases close to 100%

  5. Characterization of Antimony exchanged Hydrous Zirconium oxide

    International Nuclear Information System (INIS)

    Pentavalent 125Sb bearing species are persistent even after chemical treatment in low level liquid waste effluents. It was found that Hydrous Zirconium Oxide (HZO) had an efficiency better that 80% for Sb pick in a wide pH range of 1-13 for concentrations up to 150 mg/l. HZO coated on poly urethane foam was used in WMD Trombay for removal for 125Sb from waste effluent. The exchange capacity of HZO with 40% moisture content ranged between 0.7-0.9 meq/g for removal of Sb(V). In order to understand the mechanism of Sb uptake by HZO, freshly prepared HZO exchanged with trivalent and pentavalent Sb from aqueous solutions was characterized with FTIR and XRD. The FTIR analysis confirmed presence of surface hydroxyl groups. Sb exchanged HZO samples showed modification in characteristic frequencies of -OH group when compared with unexchanged HZO. The broadening of -OH stretching frequency at 3400 cm-1 in Sb exchanged HZO-B indicated of ingress of disorderliness or weakening of -OH bond. The spectral shift was towards lower frequencies indicating clustering of low frequency bonds around -OH groups and weakening of -O-H bond. This change in -OH profile shows it to be the site of exchange/sorption. The XRD analysis showed HZO to be amorphous. Both pentavalent and trivalent antimony was exchanged with HZO, heat treated at 600℃ and analysed with XRD. Hydrous Zirconium Oxide (Heated up to 600℃) had an X-Ray diffraction pattern identical to Aldrich make pure Zirconia (Monoclinic) (PCPDF-371484). Pentavalent Sb loaded HZO and trivalent Sb loaded HZO showed different crystalline structures on heat treatment. Sb(V) loaded HZO shows Orthorhombic structure (PCCPDF-371413) and Sb(III) exchanged Zirconia shows tetragonal structure (PCPDF-501089). Cubic Sb2O5 antimony oxide crystals were also detected in the sample. From the above analysis it could be understood that the surface hydroxyl group helped in sorption of Sb species. But this was not purely surface phenomenon. Sb after

  6. Noninferiority of Miltefosine Versus Meglumine Antimoniate for Cutaneous Leishmaniasis in Children

    OpenAIRE

    Rubiano, Luisa Consuelo; Miranda, María Consuelo; Muvdi Arenas, Sandra; Montero, Luz Mery; Rodríguez-Barraquer, Isabel; Garcerant, Daniel; Prager, Martín; Osorio, Lyda; Rojas, Maria Ximena; Pérez, Mauricio; Nicholls, Ruben Santiago; Gore Saravia, Nancy

    2012-01-01

    Background. Children have a lower response rate to antimonial drugs and higher elimination rate of antimony (Sb) than adults. Oral miltefosine has not been evaluated for pediatric cutaneous leishmaniasis.

  7. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb+ ions to a fluence of 5 x 1020 ions/m2, thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  8. Recovery of antimony-125 from tin-124 irradiated by neutrons

    International Nuclear Information System (INIS)

    Currently, antimony-125 is produced by recovery from tin-124 irradiated by neutrons in nuclear reactors. The radionuclide builds up following the pathway: Sn-124 (n,γ) → Sn-125 (β-) (9.6 days) → Sb-125 ((β-) (2.77 years) The cross-section of the (n,γ) reaction is low (0.2 barn), therefore tin metal enriched with tin-124 is used. It should be noted that the use of an enriched target decreases the build-up of other radionuclides as compared to the natural mixture of tin isotopes. Published data showed that ion exchange on anion exchangers is one of the most promising procedures of recovery of antimony-125 from irradiated tin-124. We irradiated tin metal enriched with tin-124 (approximately 96%). After cooling and storage, the specific activity was 5 μCi per g of metal. The irradiated sample was dissolved in concentrated hydrochloric acid containing hydrogen peroxide or bromine in order to convert tin to the tetravalent state and antimony to the pentavalent state. We used tin-119m as a mark for an express gamma-spectrometric determination of the distribution coefficients. We studied the separation of Sb-125 and tin on strongly basic (Dowex-50 and AV-17), moderately basic (AN-2FN), and weakly basic (AN-31) ion exchangers. Hydrochloric acid, a mixture of hydrochloric and hydrobromic acids, and nitric acid were used as the elutriating agents. The samples from chromatography were subjected to gamma-spectrometric analysis using Si(Li) and Ge(Li) semiconductor detectors. In experiments examining the separation on strongly basic anion exchangers, the attained decontamination factor for removal of tin from antimony-125 was approximately 104-105 in one cycle. In the experiments devoted to the separation on moderately basic and weakly basic anion exchangers, tin was eluted before antimony-125. This should improve reasonably the regeneration of the enriched tin samples. The most interesting and significant results were obtained in the study of separation of antimony-125

  9. Oral Delivery of Meglumine Antimoniate-β-Cyclodextrin Complex for Treatment of Leishmaniasis

    OpenAIRE

    Demicheli, Cynthia; Ochoa, Rosemary; da Silva, José B. B.; Falcão, Camila A. B.; Rossi-Bergmann, Bartira; Melo, Alan L.; Sinisterra, Ruben D.; Frézard, Frédéric

    2004-01-01

    The need for daily parenteral administration represents one of the most serious limitations in the clinical use of pentavalent antimonials against leishmaniasis. In this work, we investigated the ability of β-cyclodextrin to enhance the oral absorption of antimony and to promote the oral efficacy of meglumine antimoniate against experimental cutaneous leishmaniasis. The occurrence of interactions between β-cyclodextrin and meglumine antimoniate was demonstrated through the changes induced in ...

  10. The influence of pet containers on antimony concentration in bottled drinking water

    OpenAIRE

    Perić-Grujić Aleksandra A.; Radmanovac Aleksandar R.; Stojanov Aleksander M.; Pocajt Viktor V.; Ristić Mirjana Đ.

    2010-01-01

    Antimony trioxide (Sb2O3) is the most frequently used catalyst in the polyethylene terephthalate (PET) manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potent...

  11. The influence of pet containers on antimony concentration in bottled drinking water

    Directory of Open Access Journals (Sweden)

    Perić-Grujić Aleksandra A.

    2010-01-01

    Full Text Available Antimony trioxide (Sb2O3 is the most frequently used catalyst in the polyethylene terephthalate (PET manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potentially toxic trace element. In this paper, the antimony content in nine brands of bottled mineral and spring water from Serbia, and seven brands of bottled mineral and spring water from EU countries was analyzed. The measurements were conducted using the inductively coupled plasma-mass spectrometry (ICP-MS technique. In the all examined samples the antimony concentration was bellow the maximum contaminant level of 5 μg/L prescribed by the Serbian and EU regulations. Comparison of the content of antimony in PET bottled waters with the content of antimony in water bottled commercially in glass and the natural content of antimony in pristine groundwaters, provides explicit evidence of antimony leaching from PET containers. Since waters bottled in PET have much greater concentration ratio of Sb to Pb than corresponding pristine groundwaters, it can be assumed that bottled waters cannot be used as the relavant source for the study of the natural antimony content in groundwaters. There is a clear relation between the quality of water in bottles (composition, ion strength and antimony leaching rate. Moreover, while the rate of antimony leaching is slow at temperatures below 60 oC, at the temperature range of 60-80 oC antimony release occurs and reaches maximum contaminant level rapidly. As antimony can cause both acute and chronic health problems, factors that promote the increase of antimony concentration should be avoided.

  12. Antimony Doped Tin Oxide Thin Films: Co Gas Sensor

    Directory of Open Access Journals (Sweden)

    P.S. Joshi

    2011-01-01

    Full Text Available Tin dioxide (SnO2 serves as an important base material in a variety of resistive type gas sensors. The widespread applicability of this semicoducting oxide is related both to its range of conductance variability and to the fact that it responds to both oxidising and reducing gases. The antimony doped tin-oxide films were prepared by spray pyrolysis method. The as-deposited films are blackish in colour. Addition of antimony impurity showed little increase in the thickness. The X-ray diffraction pattern shows characteristic tin oxide peaks with tetragonal structure. As the doping concentration of antimony was increased, new peak corresponding to Sb was observed. The intensity of this peak found to be increased when the Sb concentration was increased from 0.01 % to the 1 % which indicates the antimony was incorporated into the tin oxide. For gas sensing studies ohmic contacts were preferred to ensure the changes in resistance of sensor is due to only adsorption of gas molecule. The graph of I-V shows a straight line in nature which indicates the ohmic contact. The sensitivity of the sensor for CO gas was tested. The sensitivity of antimony doped tin oxide found to be increased with increasing Sb concentration. The maximum sensitivity was observed for Sb = 1 % at a working temperature of 250 °C.

  13. Behavior of arsenic impurity at antimony electric precipitation

    International Nuclear Information System (INIS)

    In the paper the arsenic impurity electrochemical behavior and it purification from antimony by electric precipitation out of fluoride solutions was studied. For this the arsenic sample with mass 0.003-0.006 g has been irradiated at the WWR-SM nuclear reactor during 3-5 hour in the thermal neutron flux 1013 n/cm2 s, after 24 h keeping the sample has being dissolved in the concentrated nitric acid, and then it has been evaporated several times with distillation water addition up to wet precipitation state. It is shown, that arsenic impurity behavior character in the antimony electric precipitation out to fluoride electrolyte depends on the electrolyte content, electrolysis conditions, arsenic valency state in arsenic impurity existence in the five-valency state its joint electric reduction with antimony is practically not observing. In the case the arsenic being in three-valency state, it joint electric reduction with antimony is taking place. In this time the electrolytic antimony contents arsenic impurities less in dozen time than initial material

  14. 21 CFR 139.138 - Whole wheat macaroni products.

    Science.gov (United States)

    2010-04-01

    ...)(3), and (g), except that: (1) Whole wheat flour or whole durum wheat flour or both are used as the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Whole wheat macaroni products. 139.138 Section 139... and Noodle Products § 139.138 Whole wheat macaroni products. (a) Whole wheat macaroni products are...

  15. 32 CFR 644.138 - Family housing leasing program.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 4 2010-07-01 2010-07-01 true Family housing leasing program. 644.138 Section... PROPERTY REAL ESTATE HANDBOOK Acquisition Acquisition by Leasing § 644.138 Family housing leasing program... of Engineers. (a) Leasing requests. The Departments of the Army and Air Force direct their...

  16. Dicty_cDB: CHQ138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHQ138 (Link to dictyBase) - - - Contig-U15936-1 CHQ138P (Link to Original ... in D, the CST2 gene encoding cystatin SA, contains CST1 ... gene encoding cystatin SN, CSTP2 gene encoding a C ...

  17. Antimony Resistance in Leishmania, Focusing on Experimental Research

    Directory of Open Access Journals (Sweden)

    Fakhri Jeddi

    2011-01-01

    Full Text Available Leishmaniases are parasitic diseases that spread in many countries with a prevalence of 12 million cases. There are few available treatments and antimonials are still of major importance in the therapeutic strategies used in most endemic regions. However, resistance toward these compounds has recently emerged in areas where the replacement of these drugs is mainly limited by the cost of alternative molecules. In this paper, we reviewed the studies carried out on antimonial resistance in Leishmania. Several common limitations of these works are presented before prevalent approaches to evidence antimonial resistance are related. Afterwards, phenotypic determination of resistance is described, then confronted to clinical outcome. Finally, we detail molecular mechanisms and targets involved in resistance and already identified in vitro within selected mutant strains or in clinical isolates.

  18. Lattice dynamics of femtosecond laser-excited antimony

    Science.gov (United States)

    Abdel-Fattah, Mahmoud Hanafy; Bugayev, Aleksey; Elsayed-Ali, Hani E.

    2016-07-01

    Ultrafast electron diffraction is used to probe the lattice dynamics of femtosecond laser-excited antimony thin film. The temporal hierarchies of the intensity and position of diffraction orders are monitored. The femtosecond laser excitation of antimony film was found to lead to initial compression after the laser pulse, which gives way to tension vibrating at new equilibrium displacement. A damped harmonic oscillator model, in which the hot electron-blast force contributes to the driving force of oscillations in lattice spacing, is used to interpret the data. The electron-phonon energy-exchange rate and the electronic Grüneisen parameter were obtained.

  19. Self-standing nanoribbons of antimony selenide and antimony sulfide with well-defined size and band gap

    Energy Technology Data Exchange (ETDEWEB)

    Vadapoo, Rajasekarakumar; Krishnan, Sridevi; Yilmaz, Hulusi [Department of Physics, University of Puerto Rico, San Juan, PR 00936 (Puerto Rico); Marin, Carlos [Institute for Functional Nanomaterials, University of Puerto Rico, San Juan, PR 00936 (United States)

    2011-04-29

    Sub-10 nm semiconducting nanostructures are crucial for the realization of nanoscale devices. Fabrication of nanostructures at this scale with homogeneous properties is challenging. Using ab initio calculations, we show that self-standing ribbons of antimony selenide and antimony sulfide of width 1.1 nm exhibit well-defined bandgaps of 1.66 and 2.16 eV, respectively. Molecular dynamics studies show that these ribbons are stable at 500 K. The one-dimensional (1D) heterostructure of these nanoribbons (Sb{sub 2}Se{sub 3}/Sb{sub 2}S{sub 3}) along the [001] direction shows a straddling type behavior.

  20. Selective oxidation of propene on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony

    International Nuclear Information System (INIS)

    Propene + 1802 reactions have been studied in a static reaction system on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony. The [160] acrolein content of the total acrolein formed and the proportion of 160 in the oxygen of the carbon dioxide by-product have been determined. The results indicate that for each catalyst the lattice is the only direct source of the oxygen in the aldehyde, and that lattice and/or gas phase oxygen is used in carbon dioxide formation. Oxygen anion mobility appears to be greater in the molybdate catalyst than in the other two. (author)

  1. Antimony to Cure Visceral Leishmaniasis Unresponsive to Liposomal Amphotericin B

    Science.gov (United States)

    Morizot, Gloria; Jouffroy, Romain; Faye, Albert; Chabert, Paul; Belhouari, Katia; Calin, Ruxandra; Charlier, Caroline; Miailhes, Patrick; Siriez, Jean-Yves; Mouri, Oussama; Yera, Hélène; Gilquin, Jacques; Tubiana, Roland; Lanternier, Fanny; Mamzer, Marie-France; Legendre, Christophe; Peyramond, Dominique; Caumes, Eric; Lortholary, Olivier; Buffet, Pierre

    2016-01-01

    We report on 4 patients (1 immunocompetent, 3 immunosuppressed) in whom visceral leishmaniasis had become unresponsive to (or had relapsed after) treatment with appropriate doses of liposomal amphotericin B. Under close follow-up, full courses of pentavalent antimony were administered without life-threatening adverse events and resulted in rapid and sustained clinical and parasitological cure. PMID:26735920

  2. Vapor pressures of dimethylcadmium, trimethylbismuth, and tris(dimethylamino)antimony

    Czech Academy of Sciences Publication Activity Database

    Morávek, Pavel; Fulem, Michal; Pangrác, Jiří; Hulicius, Eduard; Růžička, K.

    2013-01-01

    Roč. 360, Dec (2013), s. 106-110. ISSN 0378-3812 R&D Projects: GA ČR GA13-15286S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : vapor pressure * dimethylcadmium * trimethylbismuth * tris(dimethylamino)antimony * sublimation and vaporization enthalpy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.241, year: 2013

  3. Discovery of palladium, antimony, tellurium, iodine, and xenon isotopes

    OpenAIRE

    Kathawa, J.; Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-eight palladium, thirty-eight antimony, thirty-nine tellurium, thirty-eight iodine, and forty xenon isotopes have been observed and the discovery of these isotopes is discussed here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented.

  4. Vacuum distillation of antimony-mercury gold containing concentrates

    International Nuclear Information System (INIS)

    Results of researches on vacuum distillation of mercury from gold containing antimony-mercury concentrates are considered in this article. It is shown that at vacuum of 20-50 mm Hg and temperature 300 deg C mercury is sublimated and gold remain in a cinder. (author)

  5. Antimony content of macrofungi from clean and polluted areas

    Czech Academy of Sciences Publication Activity Database

    Borovička, J.; Řanda, Zdeněk; Jelínek, E.

    2006-01-01

    Roč. 64, č. 11 (2006), s. 1837-1844. ISSN 0045-6535 Institutional research plan: CEZ:AV0Z10480505 Keywords : mushrooms * antimony pollution * bioaccumulation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.442, year: 2006

  6. Antimony and arsenic biogeochemistry in the East China Sea

    Science.gov (United States)

    Ren, Jing-Ling; Zhang, Xu-Zhou; Sun, You-Xu; Liu, Su-Mei; Huang, Daji; Zhang, Jing

    2016-02-01

    The biogeochemical cycles of the metalloid elements arsenic and antimony in the East China Sea (ECS), one of the most important marginal seas for western Pacific, were examined in May 2011. Dissolved inorganic arsenic (As(V) and As(III)) and antimony (Sb(V) and Sb(III)) species were determined by selective hydride generation-atomic fluorescence spectrometry (HG-AFS). Results show that total dissolved inorganic arsenic (TDIAs; [TDIAs]=[As(V)]+[As(III)]) were moderately depleted in the surface water and enriched in the deep water. Arsenite (As(III)) showed different vertical profiles with that of TDIAs, with significant surface enrichment in the middle shelf region where the concentrations of phosphate were extremely low. Speciation of dissolved arsenic was subtly controlled by the stoichiometric molar ratio of arsenate (As(V)) to phosphate. The average As(V)/P ratio for the ECS in spring 2011 was 10.8×10-3, which is higher than previous results and indicates the arsenate stress. The concentrations of total dissolved inorganic antimony (TDISb; [TDISb]=[Sb(V)]+[Sb(III)]) were high near the Changjiang Estuary and the coastal area of Hangzhou Bay and decreased moderately off the coast. TDISb displayed moderate conservative behavior in the ECS that confirms by the correlations with salinity and dissolved aluminum. Different with that of As(III), antimonite (Sb(III)) concentrations were extremely lower in the ECS, with relative higher concentration appeared at the bottom layer which indicates the contribution from sediment-water interface. A preliminary box model was established to estimate the water-mass balance and antimony budgets for the ECS. Compared with other areas in the world, the concentrations of dissolved inorganic arsenic and antimony in the ECS remain at natural levels.

  7. The determination of the thermodynamic activity of antimony in alpha-iron

    International Nuclear Information System (INIS)

    In this paper a method is suggested for determining the thermodynamic activity of antimony dissolved in alpha-iron, based on the study of antimony distribution between the two phases: liquid lead and solid iron. By this method, it was found that solid solutions of antimony in alpha-iron can be distinguished by positive divergences from the ideal state. Over a fairly wide range of concentrations, solutions of antimony in iron obey Henry's law. Special experiments on the distribution of antimony between lead and liquid iron showed that in the liquid state also the iron-antimony system is marked by positive divergences from the ideal state when small concentrations of antimony are present. The heat required for the solution of antimony in alpha-iron, and the excess partial molar entropy, were calculated from the activity temperature. The results were used for accurately locating the line showing the solubility limit of antimony in alpha-iron. Since alloys of antimony with iron were obtained by diffusion saturation and not by cooling from the liquid state, there was no liquefaction. Thus the lattice constant of the alloys and its relation to the alloy concentration could be reliably determined. The solubility limit established from X-ray data agrees with that obtained with Sb124. (author)

  8. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2005-10-01

    Full Text Available Pentavalent antimony, as meglumine antimoniate (Glucantime® or sodium stibogluconate (Pentostam® , is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology.Os antimoniais pentavalentes, como o antimoniato de meglumina (Glucantime® ou estibogluconato de sódio (Pentostam® , são o principal tratamento para a leishmaniose, um complexo de doenças causadas pelo protozoário parasita Leishmania, uma doença endêmica e negligenciada no Brasil. Apesar do seu uso clínico por mais de meio século, seu mecanismo de ação, toxicidade e dados de farmacocinética permanecem desconhecidos. Os métodos analíticos para determinação de antimônio em sistemas biológicos são complexos e apresentam baixa sensibilidade. Estudos utilizando radiotraçadores têm papel potencial no desenvolvimento farmacológico. O objetivo deste estudo foi desenvolver um radiotraçador de antimônio, com propriedades físicas e biológicas adequadas. O antimoniato de meglumina foi irradiado por nêutrons no reator nuclear IEA-R1, produzindo dois radioisótopos: 122

  9. States of antimony and tin atoms in lead chalcogenides

    International Nuclear Information System (INIS)

    It is shown by Mössbauer spectroscopy of the 119Sb(119mSn) isotope that impurity antimony atoms in PbS, PbSe, and PbTe lattices are distributed between cation and anion sublattices. In n-type samples, the greatest part of antimony is located in the anion sublattice; in hole ones, in the cation sublattice. The tin atoms formed as a result of radioactive decay of 119Sb (antisite state) are electrically inactive in the anion sub-lattice of PbS and PbSe, while, in the cation sublattice, they form donor U− centers. Electron exchange between the neutral and doubly ionized tin U− centers via the allowed band states is observed. The tin atoms formed after radioactive decay of 119Sb are electrically inactive in the anion and cation sublattices of PbTe.

  10. Resistance to Arsenic- and Antimony-Based Drugs

    OpenAIRE

    Milena Salerno; Arlette Garnier-Suillerot

    2003-01-01

    Organic arsenicals were the first antimicrobial agents specifically synthesized for the treatment of infectious diseases such as syphilis and sleeping sickness. For the treatment of diseases caused by trypanosomatid parasites, organic derivatives of arsenic and the related metalloid antimony are still the drugs of choice. Arsenic trioxide, As203, has been used for a long time in traditional Chinese medicines for treatment of various diseases, and it has recently been shown to be clinically ac...

  11. Crystallization of antimony orthotantalate and its physical properties

    International Nuclear Information System (INIS)

    Physicochemical conditions of monophase synthesis of antimony orthoniobate monocrystals in the system SbO3-Ta2O5-KHF2-H2O2-H2O were investigated. In the area of monophase synthesis of SbTaO4 monocrystals kinetic studies of its growth conditions for inoculation, depending on solvent concentration, temperature, pyroelectric properties of the monocrystal grown were studied and conclusion was made on their practical use

  12. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Hernandez-Garcia, C. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA

    2015-06-01

    CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  13. Correlation of CsK{sub 2}Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A., E-mail: mmamu001@odu.edu; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529 (United States); The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States); Hernandez-Garcia, C.; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States)

    2015-06-01

    CsK{sub 2}Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  14. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Directory of Open Access Journals (Sweden)

    M. A. Mamun

    2015-06-01

    Full Text Available CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  15. Removal of lead from crude antimony by using NaPo3 as lead elimination reagent

    OpenAIRE

    Ye L.G.; Tang C.B.; Yang S.H.; Chen Y.M.; Zhang W.H.

    2015-01-01

    In order to solve the shortcomings when removing lead from crude antimony in the traditional antimony smelting, a new process was provided using NaPO3 as lead elimination reagent to yield phosphate slag, and it was removed by floating on the surface of the liquid antimony. Reaction mechanism was clarified by using the TG-DTA and XRD techniques and single factor experiments of removal lead from crude antimony were engaged. The results show that PbO and NaPO3...

  16. 慢性胰腺炎138例分析%Analysis of 138 cases of chronic pancreatitis

    Institute of Scientific and Technical Information of China (English)

    罗桢; 周戎君; 高泰龙; 欧政林; 韩同; 李宜雄

    2015-01-01

      结果:138例CP患者中,116例(84.1%)以腹痛为主要表现;长期饮酒者44.2%(61/138),长期吸烟42.8%(59/138)、高脂血症39.9%(55/138)、胆道疾病20.2%(28/138);I型11例,II型58例,III型47例,IV型22例;1期69例,2期47例,3期22例。大量饮酒患者胰腺钙化比例高于非饮酒患者,而长期吸烟患者胰腺钙化比例与糖尿病比例均高于非吸烟患者(均P  结论:饮酒、吸烟、高脂血症、胆道疾病依然是CP的主要致病危险因素,不同因素所致CP的特征有所不同,应该根据CP诊治指南并结合患者具体情况,制定合理的治疗方案。

  17. Recent advances on antimony(III/V) compounds with potential activity against tumor cells.

    Science.gov (United States)

    Hadjikakou, S K; Ozturk, I I; Banti, C N; Kourkoumelis, N; Hadjiliadis, N

    2015-12-01

    Antimony one of the heavier pnictogens, has been in medical use against microbes and parasites as well. Antimony-based drugs have been prescribed against leishmaniasis since the parasitic transmission of the tropical disease was understood in the beginning of the 20th century. The activity of arsenic against visceral leishmaniasis led to the synthesis of an array of arsenic-containing parasitic agents, among them the less toxic pentavalent antimonials: Stibosan, Neostibosan, and Ureastibamine. Other antimony drugs followed: sodium stibogluconate (Pentostam) and melglumine antimoniate (Glucantim or Glucantime); both continue to be in use today despite their toxic side effects and increasing loss in potency due to the growing resistance of the parasite against antimony. Antimony compounds and their therapeutic potentials are under consideration from many research groups, while a number of early reviews recording advances of antimony biomedical applications are also available. However, there are only few reports on the screening for antitumor potential of antimony compounds. This review focuses upon results obtained on the anti-proliferative activity of antimony compounds in the past years. This survey shows that antimony(III/V) complexes containing various types of ligands such as thiones, thiosemicarbazones, dithiocarbamates, carboxylic acids, or ketones, nitrogen donor ligands, exhibit selectivity against a variety of cancer cells. The role of the ligand type of the complex is elucidated within this review. The complexes and their biological activity are already reported elsewhere. However quantitative structure-activity relationship (QSAR) modeling studies have been carried out and they are reported for the first time here. PMID:26092367

  18. Complexation of HSA with different forms of antimony (Sb): An application of fluorescence spectroscopy

    International Nuclear Information System (INIS)

    Antimony (Sb) pollution has been of a great environmental concern in some areas in China. Sb enters human body via drinking water, inhalation and food chain, unavoidably interacts with human serum albumin (HSA) in blood plasma, and consequently does harm to human health. The harmful effects of Sb on human health depend on the Sb species and their binding ability to HSA. In the present study, binding of three forms of Sb with HSA was investigated by excitation-emission matrix (EEM) spectroscopy. All of antimony potassium tartrate, antimony trichloride and potassium pyroantimonate quenched fluorescence of HSA. Values of conditional stability constant Ka (×105/M) for Sb and HSA systems were 8.13–9.12 for antimony potassium tartrate, 2.51–4.27 for antimony trichloride and 3.63–9.77 for potassium pyroantimonate. The binding constant Kb (×104/M) values of HSA with antimony potassium tartrate, antimony trichloride and potassium pyroantimonate were 0.02–0.07, 3.55–5.01, and 0.07–1.08, respectively. There was one independent class of binding site for antimony trichloride towards HSA. There was more than one Sb binding site and negative cooperativity between multiple binding sites for potassium pyroantimonate and antimony potassium tartrate towards HSA. The binding ability of HSA to complex Sb followed the order: antimony trichloride>potassium pyroantimonate>antimony potassium tartrate. -- Highlights: ► The first study reporting interaction of Sb with HSA. ► Sb can effectively quench the fluorescence of HSA. ► The binding ability of HSA to Sb was dependent on the form of Sb. ► Binding differences indicate differences in toxicity of various forms Sb to human. ► HAS-Sb binding parameters are important for understanding toxicity of Sb

  19. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    DEFF Research Database (Denmark)

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan;

    2011-01-01

    role in promoting osteoblast differentiation, as a bona fide target of miR-138. We show that miR-138 attenuates bone formation in vivo, at least in part by inhibiting the focal adhesion kinase signaling pathway. Our findings suggest that pharmacological inhibition of miR-138 by antimiR-138 could...

  20. 42 CFR 460.138 - Committees with community input.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Committees with community input. 460.138 Section... community input. A PACE organization must establish one or more committees, with community input, to do the... implementation of, and results from, the quality assessment and performance improvement plan. (c) Provide...

  1. 33 CFR 138.90 - Individual and Fleet Certificates.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Individual and Fleet Certificates... for Water Pollution (Vessels) § 138.90 Individual and Fleet Certificates. (a) The Director, NPFC... provided and appropriate fees have been paid, except where a Fleet Certificate is issued under this...

  2. Leishmania donovani isolates with antimony-resistant but not -sensitive phenotype inhibit sodium antimony gluconate-induced dendritic cell activation.

    Directory of Open Access Journals (Sweden)

    Arun Kumar Haldar

    2010-05-01

    Full Text Available The inability of sodium antimony gluconate (SAG-unresponsive kala-azar patients to clear Leishmania donovani (LD infection despite SAG therapy is partly due to an ill-defined immune-dysfunction. Since dendritic cells (DCs typically initiate anti-leishmanial immunity, a role for DCs in aberrant LD clearance was investigated. Accordingly, regulation of SAG-induced activation of murine DCs following infection with LD isolates exhibiting two distinct phenotypes such as antimony-resistant (Sb(RLD and antimony-sensitive (Sb(SLD was compared in vitro. Unlike Sb(SLD, infection of DCs with Sb(RLD induced more IL-10 production and inhibited SAG-induced secretion of proinflammatory cytokines, up-regulation of co-stimulatory molecules and leishmanicidal effects. Sb(RLD inhibited these effects of SAG by blocking activation of PI3K/AKT and NF-kappaB pathways. In contrast, Sb(SLD failed to block activation of SAG (20 microg/ml-induced PI3K/AKT pathway; which continued to stimulate NF-kappaB signaling, induce leishmanicidal effects and promote DC activation. Notably, prolonged incubation of DCs with Sb(SLD also inhibited SAG (20 microg/ml-induced activation of PI3K/AKT and NF-kappaB pathways and leishmanicidal effects, which was restored by increasing the dose of SAG to 40 microg/ml. In contrast, Sb(RLD inhibited these SAG-induced events regardless of duration of DC exposure to Sb(RLD or dose of SAG. Interestingly, the inhibitory effects of isogenic Sb(SLD expressing ATP-binding cassette (ABC transporter MRPA on SAG-induced leishmanicidal effects mimicked that of Sb(RLD to some extent, although antimony resistance in clinical LD isolates is known to be multifactorial. Furthermore, NF-kappaB was found to transcriptionally regulate expression of murine gammaglutamylcysteine synthetase heavy-chain (mgammaGCS(hc gene, presumably an important regulator of antimony resistance. Importantly, Sb(RLD but not Sb(SLD blocked SAG-induced mgammaGCS expression in DCs by

  3. Derepression of miRNA-138 contributes to loss of the human articular chondrocyte phenotype

    OpenAIRE

    Seidl, C; Martinez-Sanchez, A; Murphy, CL

    2016-01-01

    Objective: To investigate the function of microRNA-138 (miR-138) in human articular chondrocytes (HACs). Methods: The expression of miR-138 in intact cartilage and cultured chondrocytes and the effects of miR-138 overexpression on chondrocyte marker genes were investigated. Targets of miR-138 relevant to chondrocytes were identified and verified by overexpression of synthetic miRNA mimics and inhibitors, luciferase assays, chromatin immunoprecipitation, and RNA immunoprecipitation o...

  4. Oxidation and mobilization of metallic antimony in aqueous systems with simulated groundwater

    Science.gov (United States)

    Ilgen, A. G.; Majs, F.; Barker, A. J.; Douglas, T. A.; Trainor, T. P.

    2014-05-01

    Antimony (Sb) is a contaminant of concern that can be present in elevated concentrations in shooting range soils due to mobilization from spent lead/antimony bullets. Antimony in shooting range soils has been observed as either metallic Sb(0) or as Sb(V) immobilized by iron (hydr)oxides. The absence of Sb(III) in soils is indicative of rapid Sb(III) oxidation to Sb(V) under surface soil conditions. However, the major controls on antimony oxidation and mobility are poorly understood. To better understand these controls we performed multiple batch experiments under oxic conditions to quantify the oxidation and dissolution of antimony in systems where Sb(0) is oxidized to Sb(III) and further to Sb(V). We also tested how variations in the aqueous matrix composition and the presence of metallic lead (Pb) affect the dissolution, solid phase speciation, and oxidation of antimony. We monitored changes in the aqueous antimony speciation using liquid chromatography inductively coupled plasma mass spectrometry (LC-ICP-MS). To test which solid phases form as a result of Sb(0) oxidation, and therefore potentially limit the mobility of antimony in our studied systems, we characterized the partially oxidized Sb(0) powders by means of extended X-ray absorption fine structure (EXAFS) spectroscopy and powder X-ray diffraction (XRD).

  5. Tin dioxide sol-gel derived films doped with platinum and antimony deposited on porous silicon

    NARCIS (Netherlands)

    Savaniu, C.; Arnautu, A.; Cobianu, C.; Craciun, G.; Flueraru, C.; Zaharescu, M.; Parlog, C.; Paszti, F.; Berg, van den A.

    1999-01-01

    SnO2 sol-gel derived thin films doped simultaneously with Pt and Sb are obtained and reported for the first time. The Sn sources were tin(IV) ethoxide or tin(II) ethylhexanoate, while hexachloroplatinic acid (H2PtCl6) and antimony chloride (SbCl3) were used as platinum and antimony sources, respecti

  6. Comparison of modification with strontium and the refining with antimony in A 356 aluminium alloys

    International Nuclear Information System (INIS)

    Strontium and Antimony treated A356 aluminium alloy samples were metallographically characterized in the as cast and solution and aged conditions. Antimony treated alloy has shown slower spheroidizing kinetics of the Silicon particles during solution treatment, lower porosity level and higher tensile strength and elongation than Strontium treated one. (author)

  7. Leishmania donovani: an in vitro study of antimony-resistant amphotericin B-sensitive isolates

    DEFF Research Database (Denmark)

    Sharief, Abdalla Hassan; Gasim Khalil, Eltahir Awad; Theander, Thor G;

    2006-01-01

    Drug sensitivity of clinically antimony-unresponsive Leishmania donovani isolates from Eastern Sudan was evaluated in an in vitro culture system against sodium stibogluconate (Pentostam) and Amphotericin B. Eight isolates, six from antimony-resistant and two from clinically responsive patients were...

  8. Waste treatment as applied to the problem of recovery of antimony-125

    International Nuclear Information System (INIS)

    In the report we present the average radionuclide and chemical composition of processing solutions in various stages of treatment of spent nuclear fuel. The behavior of antimony-125 during sorption from these solutions was studied. A series of oxide and phosphate compounds was used as sorbents. The best results on recovery of antimony were reached on silica gel. A necessary condition for prolonged high-cycle operation of silica gel in actual practice is its rather complete regeneration. In this connection, we studied completeness of antimony desorption from various sorbents. The best results were obtained with aqueous hydrochloric and oxalic acids. Our study showed the possibility of recovery of antimony-125 from spent nuclear fuel wastes by adsorption on silica gel from processing solutions with subsequent desorption of the target product. In the average the yield of antimony-125 is 85%. (authors)

  9. Testing of antimony selective media for treatment of liquid radwaste

    International Nuclear Information System (INIS)

    Nuclear power plants have sought radiation source term reduction and reduced discharge of radioactive constituents for many years. In the case of pressurized water reactors (PWRs), the latter efforts have been directed toward capture and immobilization of recalcitrant (ubiquitous radionuclides with long half-lives) species such as Cs-134 and Cs-137 and Co-58 and Co-60. As these plants resolved, or at least mitigated, the problems with radiocesium and radio-cobalt, antimony radionuclides (Sb-122, Sb-124, and Sb-125) have become a primary concern in liquid liquid radwaste systems Graver Technologies developed a granular composite metal oxide media with good selectivity for radio-antimony. Initial laboratory data were collected using non-radioactive salts of antimony, cesium, and cobalt to judge efficacy of selective removal of antimony. Based on success of those trials, the media, designated Gravex GX187, was tested in partnership with Energy Solutions (nee Duratek) using actual liquid liquid radwaste in two PWR plants. One of these plants performed extensive slip-stream trials comparing the GX187 with strong base anion resins. With more than 2500 bed volumes of throughput, the GX187 outperformed the other competitors by reducing both Sb-124 and Sb-125 radionuclides below minimum detectable activity (MDA) with average decontamination factors (DF's) of 170, even when subjected to high levels of borate. Based on these favorable results, Energy Solutions installed the GX187 in a layered bed in their ALPS liquid radwaste processing system at this plant in August 2005. After one year of intermittent, batchwise operation including an outage, the GX187 processed more than 2.25 million liters (>600,000 gallons) of liquid liquid radwaste while reducing the Sb-125 activity to 2.9 E-08 Bq/L (DF=111) on average. This evaluation is ongoing and will continue at least until the fall 2006 outage at this plant. Concurrently, Graver developed a second generation antimony selective

  10. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    International Nuclear Information System (INIS)

    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103Ru, 134Cs and 124Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10-3 to 5.10-5% of the Ru fed, for Cs the corresponding release fraction ranges between 3.10-3 to 10-4% and for Sb the release fraction ranges between 1.7 10-4 to 1.7 10-5%. The same experiments were performed at a throughput of 1 to 2 1 h-1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103Ru and 134Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  11. Metabolism of antimony-124 in lactating dairy cows

    International Nuclear Information System (INIS)

    Lactating cows received oral and intravenous administrations of radioactive antimony (III) chloride to study its intestinal and urinary excretion, secretion into milk and organ distribution. Milk samples were taken twice a day and the milk, feces and urine assayed using gamma spectroscopy. Cows administered orally were sacrificed at 102 days and those injected intravenously at 70 days. Distribution of 124 Sb in the organs was determined at the time of sacrifice. Excretion of 124Sb occurs mainly via urine, little is secreted into milk. Highest organ concentrations are in the spleen, liver and bone. (U.K.)

  12. Electrostatically defined silicon quantum dots with counted antimony donor implants

    Energy Technology Data Exchange (ETDEWEB)

    Singh, M., E-mail: msingh@sandia.gov; Luhman, D. R.; Lilly, M. P. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Integrated Nanotechnologies, Sandia National Laboratories, Albuquerque, New Mexico 87175 (United States); Pacheco, J. L.; Perry, D.; Garratt, E.; Ten Eyck, G.; Bishop, N. C.; Wendt, J. R.; Manginell, R. P.; Dominguez, J.; Pluym, T.; Bielejec, E.; Carroll, M. S. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)

    2016-02-08

    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants.

  13. Electrostatically defined silicon quantum dots with counted antimony donor implants

    International Nuclear Information System (INIS)

    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants

  14. Antimony implanted strained Si for nMOSFET applications

    OpenAIRE

    Zamani, Atieh

    2009-01-01

    Incorporation of implanted antimony (Sb) in strained-silicon (s-Si) formed on relaxed-SiGe virtual substrates (10 and 30% Ge) has been studied. The implantation doses were 5×1013- 5×1014 cm-2 with an energy of 20 keV. The activation of dopant was performed by an rapid thermal annealing (RTA) treatment at 700 and 800 °C for 30 sec. Projected range of this implantation is about 20 nm which was also confirmed by different techniques. The layers were analyzed in terms of strain relaxation, sheet ...

  15. Solubility behaviour of antimony(III) and antimony(V) solids in basic aqueous solutions at 300{sup o}C

    Energy Technology Data Exchange (ETDEWEB)

    Lemire, R.J.; Tosello, N.B.; Halliday, J.D

    1999-12-01

    The major contributions of the isotopes {sup 122}Sb and {sup 124}Sb to activity transport in a CANDU reactor primary heat transport system (HTS), have been associated with oxygen ingress during reactor shutdown. As part of a program to minimize the release and redeposition of these isotopes, the solubilities of antimony(III) and (V) oxides and salts have been measured in basic solutions at temperatures from 25 to 300{sup o}C. The results provide information on the charge and the stability as a function of temperature of antimony solution species and, hence, a guide to the trends in the temperature dependence of the solubilities of antimony solids. In solutions in which oxidation of antimony(III) to antimony(V) is minimized, the solubility of Sb{sub 2}O{sub 3} increases by about two orders of magnitude between 25 and 200{sup o}C, and then levels out or decreases slightly. At 250{sup o}C, in oxidizing solutions, Sb{sub 2}O{sub 5}{center_dot}xH{sub 2}O and simple sodium antimonate(V) were found to be unstable in sodium hydroxide solutions with respect to the solid, Na{sub 2{alpha}}[H(H{sub 2}O)]{sub 2-2{alpha}}Sb{sub 2}O{sub 6}, which has a pyrochlore structure. The solubility of this partially protonated sodium antimonate increases from 25 to 200{sup o}C and decreases at temperatures above 250{sup o}C. These solubility changes for the antimony (V) solids reflect changes in the stability of the anionic antimony solution species (SbO{sub 3}{sup -} or Sb(OH){sub 6}{sup -}), even though the compositions of antimony-containing solids in basic oxidizing solutions are strongly dependent on the cations and their aqueous phase concentrations. All solids used in the present experiments would be expected to generate total solution antimony concentrations {>=} 0.00005 mol{center_dot}dm{sup -3} in any neutral or basic aqueous solutions (assuming no added sodium salts). Therefore, under HTS conditions, precipitation of any antimony oxides or mixed oxides is unlikely. It cannot be

  16. Thermal decomposition kinetics of antimony oxychloride in air

    Institute of Scientific and Technical Information of China (English)

    阳卫军; 唐谟堂; 金胜明

    2002-01-01

    The DTA and XRD techniques were employed to study thermal decomposition mechanism of antimony oxychloride SbOCl in the air. The thermal decomposition reaction occurs in four steps, and the former three steps as: SbOCl(s)→Sb4O5Cl2(s)+SbCl3(g)→Sb8O11Cl2(s)+SbCl3(g)→Sb2O3(s)+SbCl3(g). The forth step is the oxidation of Sb2O3 by air, Sb2O3(s)+O2→Sb2O4(s). The activation energy and the order of the thermal decomposition reaction of antimony oxychloride in three steps presented in DTA curves were calculated according to Kinssinger methods from DTA curves. The values of activation energy and the order are respectively 91.97kJ/mol, 0.73 in the first step, 131.14kJ/mol, 0.63 in the second step and 146.94kJ/mol, 1.58 in the third step.

  17. Alkali oxide-tantalum, niobium and antimony oxide ionic conductors

    Science.gov (United States)

    Roth, R. S.; Brower, W. S.; Parker, H. S.; Minor, D. B.; Waring, J. L.

    1975-01-01

    The phase equilibrium relations of four systems were investigated in detail. These consisted of sodium and potassium antimonates with antimony oxide and tantalum and niobium oxide with rubidium oxide as far as the ratio 4Rb2O:llB2O5 (B=Nb, Ta). The ternary system NaSbO3-Sb2O4-NaF was investigated extensively to determine the actual composition of the body centered cubic sodium antimonate. Various other binary and ternary oxide systems involving alkali oxides were examined in lesser detail. The phases synthesized were screened by ion exchange methods to determine mobility of the mobility of the alkali ion within the niobium, tantalum or antimony oxide (fluoride) structural framework. Five structure types warranted further investigation; these structure types are (1) hexagonal tungsten bronze (HTB), (2) pyrochlore, (3) the hybrid HTB-pyrochlore hexagonal ordered phases, (4) body centered cubic antimonates and (5) 2K2O:3Nb2O5. Although all of these phases exhibit good ion exchange properties only the pyrochlore was prepared with Na(+) ions as an equilibrium phase and as a low porosity ceramic. Sb(+3) in the channel interferes with ionic conductivity in this case, although relatively good ionic conductivity was found for the metastable Na(+) ion exchanged analogs of RbTa2O5F and KTaWO6 pyrochlore phases.

  18. Antimony removal from the polyethylene terephthalate manufacture wastewater

    Directory of Open Access Journals (Sweden)

    Tomas Vengris

    2010-04-01

    Full Text Available In this study, antimony removal by coagulation from polyethylene terephthalate resin production wastewater of „Orion Global PET“ factory in Klaipėda city was investigated, with regard to the dependence of coagulant type and dosage, pH and presence of organics. FeCl3 ∙6H2O, FeSO4 ∙7H2O, AlCl3∙6H2O and TiCl4 salts were used as coagulants. Ti(IV and Fe(III revealed oneself to be the most effective coagulants. Antimony removal effectiveness is moderate and low using FeSO4 ∙7H2O and AlCl3∙6H2O coagulants, respectively. The addition of 10 mg dm-3 Ti(IV and 30 mg dm-3 Fe(III reduces by ~98% of the Sb, when the initial amount of Sb in wastewater is about 1200 mkg/l. The action of Fe(III is practically independent in the pH range 4-9, and that of Ti(IV slightly decreases in the same pH interval. The Sb amount in wastewater can be reduced to 13-20 mkg dm-3, while the initial Sb concentration is 1200 mkg dm-3. The presence of organic compounds in wastewater determines the reduction of Sb removal by coagulation.

  19. Antimony contamination and its effect on Trifolium plants

    Science.gov (United States)

    Corrales, Isabel; Barceló, Juan; Bech, Jaume; Poschenrieder, Charlotte

    2014-05-01

    Antimony is not an essential element and soil Sb contents usually are low.However, soil contamination by Sb has increased in the last years due to the human activities (combustion of fossil fuels, mining, waste incineration, smelting, shooting and road traffic). The main objective of this work was to study the effect of different concentrations of antimony (KSb(OH)6) in order to evaluate the effect on growth and Sb uptake on Trifolium pratense cv. Milvus and Trifolium repens. Our results show that Sb accumulated both in roots and shoots of clover without any negative effect on root growth, cellular viability and lipid peroxidation. This absence of toxicity sympthoms in clover plants could be very dangerous because Sb can be inadvertedly incorporated into the trophic chain causing toxic effects both in animals and humans. The absence of toxic effects on plants does not seem to be due to detoxification by phytochelatins because the use of the gamma-glutamylcysteine synthetase inhibitor, L-buthionine-[S,R]-sulphoximine (BSO) did not enhance Sb toxicity to plants. (Supported by the Spanish MICINN project BFU2010-14873)

  20. Segregation of antimony in InP in MOVPE

    Energy Technology Data Exchange (ETDEWEB)

    Weeke, Stefan

    2008-07-01

    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  1. Leaching Mechanism of Complicated Antimony-Lead Concentrate and Sulfur Formation in Slurry Electrolysis

    Institute of Scientific and Technical Information of China (English)

    WangChengyan; QiuDingfan; JiangPeihai

    2004-01-01

    Anodic reaction mechanism of complicated antimony-lead concentrate in slurry electrolysis was investigated by the anodic polarization curves determined under various conditions. The main reactions on the anode are the oxidations of FeCln(2-n) . Though the oxidation of jamesonite particle on the anode can occur during the whole process, it is less. With the help of mineralogy studies and relevant tests, the leaching reaction mechanism of jameson[to and gudmundite during slurry electrolysis was ascertained. Because of the oxidation reaction of FeCl3 produced by antimony-lead concentrate itself, the non-oxidation complex acid dissolution of jameson[re, the oxidation complex acid dissolution of gudmundite, and the oxidation of air carried by stirring, the leaching ratio of antimony reaches about 35% when HCl-NH4Cl solution is used to leach antimony-lead concentrate directly. So when the theoretical electric quantity is given to oxidation of antimony in slurry electrolysis, all of antimony, lead and iron containing in antimony-lead concentrate, are leached. The formation of sulfur is through the directly redox reaction of Fe3+ and jameson[re. The S2- in jamesonite is oxidized into S0 , and forms the crystals of sulfur again on the spot. The redox reaction of Fe3+ and H2S formed by non-oxidative acid dissolution of jamesonite is less.

  2. Behaviour of antimony during thermal treatment of Sb-rich halogenated waste

    International Nuclear Information System (INIS)

    Antimony compounds have a wide range of industrial applications, particularly as additives in flame retardants. To ensure environmentally friendly waste incineration of Sb-rich wastes, it is essential to strengthen the knowledge about the fate of antimony and the potential formation of harmful species. Investigations should be conducted particularly in relation with the main operational parameters controlling the process, chiefly temperature, residence time and air supply in the oven and in the post-combustion zone, prior final adapted cleaning of the flue-gas stream. Experimental studies focusing on antimony behaviour were undertaken through laboratory-scale thermal treatment at 850 deg. C and 1100 deg. C of a Sb-rich halogenated waste, originating from the sector of flame retardants formulation. The configuration of our laboratory experimental device allowed to achieve only low oxidative conditions in the waste bed, but high oxidative strength coupled with high temperature and sufficient gas residence time in the post-combustion zone, as prescribed during the incineration of hazardous wastes. Atomic absorption spectroscopy was used to assess the partition of antimony in the different compartments of the process. The oxidation degree of antimony in the gas-phase was determined by the use of electrochemical techniques, namely polarography coupled with anodic stripping voltamperometry. The partition of antimony between the residual ash and the gas-phase under moderate oxidative conditions in the waste bed was constant, whatever the temperature: the volatilization rate for antimony was ∼64%, while a ∼36% fraction remained in the residual bottom ashes. But interestingly, while at 850 oC, antimony was mainly present in the gas-phase at a +III oxidation degree, an increase in temperature of 250 oC favoured the presence of antimony to its highest oxidation degree +V in the flue-gas stream, a valence known to be involved in less toxic species.

  3. Antimony powder-modified carbon paste electrodes for electrochemical stripping determination of trace heavy metals

    International Nuclear Information System (INIS)

    Highlights: → New antimony powder-modified carbon paste electrode. → Combination of specific properties of carbon paste substrate and metallic antimony. → No requirement of using toxic antimony(III) salts. → Electrochemical stripping determination of trace heavy metals at ppb levels. → Anodic stripping voltammetric and stripping chronopotentiometric measurements. - Abstract: A new type of the antimony electrode based on a carbon paste bulk-modified with antimony powder (Sb-CPE) is presented for the determination of cadmium(II) and lead(II) ions at the microgram-per-liter concentration level, when using square-wave anodic stripping voltammetric or stripping chronopotentiometric protocol. The Sb-CPE was prepared by mixing fine antimony powder, carbon powder, and silicon oil, thus combining typical features of the carbon paste material with specific electrochemical properties of antimony. Key-operational parameters, including the amount of antimony powder in the carbon paste mixture, effect of the deposition potential and deposition time, were optimized and electroanalytical performance of the Sb-CPE in nondeaerated solution of 0.01 M hydrochloric acid (pH 2) was compared with related bismuth powder-modified carbon paste electrode (Bi-CPE) and with in situ prepared antimony film carbon paste electrode (SbF-CPE). The electrode of interest exhibited well-developed signals and highly linear calibration plots for both metal ions tested. In addition, favorable limits of detection were achieved; namely: 1.4 μg L-1 for Cd(II) and 0.9 μg L-1 for Pb(II). The applicability of the new electrode was demonstrated on the analysis of tap water (spiked sample). Besides voltammetric measurements, the Sb-CPE was preliminary tested also under chronopotentiometric stripping mode in deoxygenated solutions, revealing also an excellent electroanalytical performance.

  4. Structural and optical characterization of thermally evaporated bismuth and antimony films for photovoltaic applications

    Science.gov (United States)

    Srimathy, N.; Ruban Kumar, A.

    2016-05-01

    In this present study, the thin film of bismuth and antimony is coated by thermal evaporation system equipped with the inbuilt ultra high vacuum system. XRD analysis confirmed the rhombohedral structure of Bismuth and Antimony on the prepared film. The surface roughness and physical appearance is analyzed by Atomic force microscopy. The results of Raman Spectroscopy show the wave functions and the spectrum of electrons. The preparation technique and conditions strongly influence the crystalline structure and the phase composition of bismuth and antimony thin films. The electrical and optical properties for the prepared film are analyzed. The results show a great interest and promising applications in Photovoltaic devices.

  5. Varicella zoster virus reactivation during or immediately following treatment of tegumentary leishmaniasis with antimony compounds

    Directory of Open Access Journals (Sweden)

    Andrea Barbieri Barros

    2014-07-01

    Full Text Available Antimony compounds are the cornerstone treatments for tegumentary leishmaniasis. The reactivation of herpes virus is a side effect described in few reports. We conducted an observational study to describe the incidence of herpes zoster reactivation during treatment with antimony compounds. The global incidence of herpes zoster is approximately 2.5 cases per 1,000 persons per month (or 30 cases per 1,000 persons per year. The estimated incidence of herpes zoster in patients undergoing antimony therapy is higher than previously reported.

  6. Coordination- and Redox-Noninnocent Behavior of Ambiphilic Ligands Containing Antimony.

    Science.gov (United States)

    Jones, J Stuart; Gabbaï, François P

    2016-05-17

    Stimulated by applications in catalysis, the chemistry of ambiphilic ligands featuring both donor and acceptor functionalities has experienced substantial growth in the past several years. The unique opportunities in catalysis offered by ambiphilic ligands stem from the ability of their acceptor functionalities to play key roles via metal-ligand cooperation or modulation of the reactivity of the metal center. Ligands featuring group 13 centers, most notably boranes, as their acceptor functionalities have undoubtedly spearheaded these developments, with remarkable results having been achieved in catalytic hydrogenation and hydrosilylation. Motivated by these developments as well as by our fundamental interest in the chemistry of heavy group 15 elements, we became fascinated by the possibility of employing antimony centers as Lewis acids within ambiphilic ligands. The chemistry of antimony-based ligands, most often encountered as trivalent stibines, has historically been considered to mirror that of their lighter phosphorus-based congeners. There is growing evidence, however, that antimony-based ligands may display unique coordination behavior and reactivity. Additionally, despite the diverse Lewis acid and redox chemistry that antimony exhibits, there have been only limited efforts to explore this chemistry within the coordination sphere of a transition metal. By incorporation of antimony into the framework of polydentate ligands in order to enforce the main group metal-transition metal interaction, the effect of redox and coordination events at the antimony center on the structure, electronics, and reactivity of the metal complex may be investigated. This Account describes our group's continuing efforts to probe the coordination behavior, reactivity, and application of ambiphilic ligands incorporating antimony centers. Structural and theoretical studies have established that both Sb(III) and Sb(V) centers in polydentate ligands may act as Z-type ligands toward late

  7. Fabrication of thin target of 138Ba by vacuum evaporation

    International Nuclear Information System (INIS)

    Target fabrication is a highly sophisticated and crucial step in nuclear physics experiments. The success of any nuclear experiment is primarily determined by the quality and quantity of the target. 138Ba target is prepared for the evaporation residue cross section measurement of 188Pt populated through the reaction with 50Ti ion beam. Barium is a highly reactive metal and upon exposure to air at room temperature it will readily react with oxygen. Presently no information is available in the literature for the thin barium target fabrication through vacuum evaporation method. The two previous attempts available in literature were in sputtering method using barium nitrate or barium carbonate

  8. Phenotypic, genomic and functional characterization reveals no differences between CD138++ and CD138low subpopulations in multiple myeloma cell lines.

    Directory of Open Access Journals (Sweden)

    Teresa Paíno

    Full Text Available Despite recent advances in the treatment of multiple myeloma (MM, it remains an incurable disease potentially due to the presence of resistant myeloma cancer stem cells (MM-CSC. Although the presence of clonogenic cells in MM was described three decades ago, the phenotype of MM-CSC is still controversial, especially with respect to the expression of syndecan-1 (CD138. Here, we demonstrate the presence of two subpopulations--CD138++ (95-99% and CD138low (1-5%--in eight MM cell lines. To find out possible stem-cell-like features, we have phenotypically, genomic and functionally characterized the two subpopulations. Our results show that the minor CD138low subpopulation is morphologically identical to the CD138++ fraction and does not represent a more immature B-cell compartment (with lack of CD19, CD20 and CD27 expression. Moreover, both subpopulations have similar gene expression and genomic profiles. Importantly, both CD138++ and CD138low subpopulations have similar sensitivity to bortezomib, melphalan and doxorubicin. Finally, serial engraftment in CB17-SCID mice shows that CD138++ as well as CD138low cells have self-renewal potential and they are phenotypically interconvertible. Overall, our results differ from previously published data in MM cell lines which attribute a B-cell phenotype to MM-CSC. Future characterization of clonal plasma cell subpopulations in MM patients' samples will guarantee the discovery of more reliable markers able to discriminate true clonogenic myeloma cells.

  9. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

    Science.gov (United States)

    2010-07-01

    ... to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for... speed not greater than— (i) 12 statute miles per hour (10.4 knots) between Fort Gratiot Light and...

  10. 22 CFR Appendix B to Part 138 - Disclosure Form To Report Lobbying

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disclosure Form To Report Lobbying B Appendix B to Part 138 Foreign Relations DEPARTMENT OF STATE MISCELLANEOUS NEW RESTRICTIONS ON LOBBYING Pt. 138, App. B Appendix B to Part 138—Disclosure Form To Report Lobbying EC06OC91.000 EC06OC91.001...

  11. Complete Genome of the Attenuated Sparfloxacin-Resistant Streptococcus agalactiae Strain 138spar

    OpenAIRE

    Pridgeon, Julia W.; Zhang, Dunhua; Zhang, Lee

    2014-01-01

    Through the selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain, 138spar, was obtained from its virulent parent strain, S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. This genome will allow comparative genomics to identify genes associated with virulence, antibiotic resistance, or other characteristics.

  12. Complete genome sequence of an attenuated Sparfloxacin resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    Through selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain 138spar was obtained from its virulent parent strain S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. The availability of this genome will allow comparative genomics to identi...

  13. Crystal structure and thermodynamic properties of potassium antimony tungsten oxide

    Energy Technology Data Exchange (ETDEWEB)

    Knyazev, Aleksandr V., E-mail: knav@uic.nnov.ru [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation); Tananaev, Ivan G. [Institute of Physical Chemistry and Electrochemistry, Russian Academy of Sciences, 31 Leninsky prospect, Moscow GSP-1, 119991 (Russian Federation); Kuznetsova, Nataliya Yu.; Smirnova, Nataliya N.; Letyanina, Irene A.; Ladenkov, Igor V. [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation)

    2010-02-20

    In the present work potassium antimony tungsten oxide with pyrochlore structure is refined by the Rietveld method (space group Fd3m, Z = 8). The temperature dependences of heat capacity have been measured for the first time in the range from 7 to 370 K for this compound. The experimental data were used to calculate standard thermodynamic functions, namely the heat capacity C{sub p}{sup o}(T), enthalpy H{sup o}(T) - H{sup o}(0), entropy S{sup o}(T) - S{sup o}(0) and Gibbs function G{sup o}(T) - H{sup o}(0), for the range from T {yields} 0 to 370 K. The differential scanning calorimetry was applied to measure the incongruent melting temperature of compound under study. The high-temperature X-ray diffraction was used for the determining thermal expansion coefficients.

  14. Atomistic mechanisms governing structural stability change of zinc antimony thermoelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xiaolong [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); Lin, Jianping, E-mail: jaredlin@163.com [School of Materials Science and Engineering, Xiamen University of Technology, Xiamen 361024 (China); Qiao, Guanjun [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Wang, Zhao, E-mail: zwangzhao@gmail.com [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China)

    2015-01-05

    The structural stability of thermoelectric materials is a subject of growing importance for their energy harvesting applications. Here, we study the microscopic mechanisms governing the structural stability change of zinc antimony at its working temperature, using molecular dynamics combined with experimental measurements of the electrical and thermal conductivity. Our results show that the temperature-dependence of the thermal and electrical transport coefficients is strongly correlated with a structural transition. This is found to be associated with a relaxation process, in which a group of Zn atoms migrates between interstitial sites. This atom migration gradually leads to a stabilizing structural transition of the entire crystal framework, and then results in a more stable crystal structure of β–Zn{sub 4}Sb{sub 3} at high temperature.

  15. Coherent and Incoherent Structural Dynamics in Laser-Excited Antimony

    CERN Document Server

    Waldecker, Lutz; Bertoni, Roman; Vasileiadis, Thomas; Garcia, Martin E; Zijlstra, Eeuwe S; Ernstorfer, Ralph

    2016-01-01

    We investigate the excitation of phonons in photoexcited antimony and demonstrate that the entire electron-lattice interactions, in particular coherent and incoherent electron-phonon coupling, can be probed simultaneously. Using femtosecond electron diffraction (FED) with high temporal resolution, we observe the coherent excitation of the fully symmetric \\Ag\\ optical phonon mode via the shift of the minimum of the atomic potential energy surface. Molecular dynamics simulations are performed to quantify the change in lattice potential and the associated real-space amplitude of the coherent atomic oscillations. In addition, our experimental configuration allows observing the energy transfer from electrons to phonons via incoherent electron-lattice scattering events. Applying a modified two-temperature model, the electron-phonon coupling is determined from the data as a function of electronic temperature.

  16. NEW THIO S2- ADDUCTS WITH ANTIMONY (III AND V HALIDE: SYNTHESIS AND INFRARED STUDY

    Directory of Open Access Journals (Sweden)

    HASSAN ALLOUCH

    2013-12-01

    Full Text Available Five new S2- adducts with SbIII and SbV halides have been synthesized and studied by infrared. Discrete structures have been suggested, the environment around the antimony being tetrahedral, trigonal bipyramidal or octahedral.

  17. Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

    International Nuclear Information System (INIS)

    The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

  18. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity

    OpenAIRE

    Samanta Etel Treiger Borborema; João Alberto Osso Junior; Heitor Franco de Andrade Junior; Nanci do Nascimento

    2016-01-01

    Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine l...

  19. Removal of lead from crude antimony by using NaPo3 as lead elimination reagent

    Directory of Open Access Journals (Sweden)

    Ye L.G.

    2015-01-01

    Full Text Available In order to solve the shortcomings when removing lead from crude antimony in the traditional antimony smelting, a new process was provided using NaPO3 as lead elimination reagent to yield phosphate slag, and it was removed by floating on the surface of the liquid antimony. Reaction mechanism was clarified by using the TG-DTA and XRD techniques and single factor experiments of removal lead from crude antimony were engaged. The results show that PbO and NaPO3 begin endothermic reaction at 863K (590°C, and the reaction mainly form NaPb4(PO43 and NaPbPO4 below 1123K (850°C and above 1123K (850°C, respectively. Sb2O3 and NaPO3 start the reaction at 773K (500°C and generate an antimonic salt compound. The reaction product of the mixture of PbO, Sb2O3 and NaPO3 show that NaPO3 reacted with PbO prior when NaPO3 was insufficient, amorphous antimony glass will be generated only when NaPO3 was adequate. Single factor experiments were taken with NaNO3 as oxidizing agent under argon, effect of reaction time, reaction temperature and dosage of NaPO3 and NaNO3 on smelting results. The average content of lead in refined antimony was 0.05340% and 98.85% of lead were removed under optimal conditions; the content of lead in antimony have meet the requirements of commercial antimony.

  20. Electrochemical antimony removal from accumulator acid: Results from removal trials in laboratory cells

    International Nuclear Information System (INIS)

    Highlights: ► In non-divided cells, antimony did not deposit at cathode due to oxidation of Sb(III) at anode. ► Copper and graphite were found to be the most suitable electrode materials for antimony deposition. ► Sb species covering electrode lowers deposition efficiency with time. ► Thus, periodical renewal of cathode material is necessary. ► Calculated specific electroenergy consumption was relatively high. ► In contrast, absolute energy consumption was low due to small quantities of antimony removed. - Abstract: Regeneration of spent accumulator acid could be an alternative process for crystallization, neutralisation and disposal. Therefore, for the first time in a study of the possibilities of electrochemical removal of antimony and accumulator acid regeneration on a laboratory scale, two synthetic and several real systems containing sulfuric acid of concentrations ranging between 28% and 36%, and antimony species were tested. Discontinuous electrochemical reactors with anion exchange membranes were successfully used in these experiments, which were conducted at a temperature of 35 °C. Removal of antimony using cells that were not divided by a separator, however, was not possible. In selected experiments, by varying the electrode material, type of electrolyte, and cell current, the concentration of antimony could be reduced from the range of 5 ppm to 0.15 ppm. This resulted in current efficiencies between 0.00002% and 0.001%, and in specific electroenergy demands between 100 Wh L−1 and 2000 Wh L−1. In other experiments on substances with antimony contents up to 3500 mg L−1, the current efficiencies obtained were more than a thousandfold higher. In contrast to the formally high relative energy consumption parameters absolute demand parameters are relatively small and favour the electrochemical method in small scale application. Besides plate electrodes, 3D-cathodes were used. Copper- and graphite cathodes produced the best results.

  1. Effect of Antimony, Phosphorous and Salinity on Growth, Root Membrane Permeability and Root Antimony, Iron and Zinc Concentration of Corn in Hydroponic Media

    OpenAIRE

    H. Barangizi; M. Afyuni; B. Rezaee

    2010-01-01

    Antimony (Sb) pollution has increased in recent years because of human activities and extensive usage of antimony compounds. To date, only a few researches have been conducted in this field in Iran. The purpose of this research is to determine fresh and dry weight, root permeability percentage and root concentration of Sb, Fe and Zn in the corn. This greenhouse research was performed in hydroponics. A factorial experiment (3 × 2 × 3) with three Sb concentrations (0, 6, 18 mgL-1), with and wit...

  2. Dicty_cDB: VHF138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NNN Length of 5' end seq. 616 3' end seq. ID - 3' end seq. - Length of 3' end seq. - Connect...ed seq. ID - Connected seq. - Length of connected seq. - Full length Seq ID - Full length Seq. - Length of full length seq. - ... ...etal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction...VH (Link to library) VHF138 (Link to dictyBase) - - - Contig-U11530-1 - (Link to Or...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11530-1 Original site URL http://dictycdb.b

  3. Arsenic and Antimony Content in Soil and Plants from Baia Mare Area, Romania

    Directory of Open Access Journals (Sweden)

    Gabriela Oprea

    2010-01-01

    Full Text Available Problem statement: The objective of this research was to evaluate the degree of soil contamination with arsenic and antimony in Baia Mare, a nonferrous mining and metallurgical center located in the North West region of Romania. The soil in the area is affected by the emissions of powders containing metals from metallurgical factories. Previous studies indicated the soil contamination with copper, zinc, cadmium and lead, but there is few data about the actual level of soil pollution with arsenic and antimony. Approach: The soil samples were collected from 2 districts of Baia Mare: Ferneziu, which is located in the proximity of a lead smelter and Săsar district which is located along the Sasar River in the preferential direction of the wind over a metallurgical factory producing lead. As reference was considered Dura area located in a less polluted hilly area, in the west part of the town. Samples of soil and plants from the residential area of Ferneziu, Săsar and Dura districts were collected. The arsenic determination was carried out by inductively coupled plasma atomic emission spectrometry and the antimony determination by inductively coupled plasma mass spectrometry. Results: In Ferneziu area, the concentration of arsenic in soil ranged between 0.25 and 255 mg kg-1. In Săsar district the arsenic concentration in the soil ranged between 5.5 and 295 mg kg-1. Regarding antimony, in Ferneziu area the concentration ranged between 5.3 and 40.6 mg kg-1; while in Săsar, antimony soils concentrations vary in the range: 0.9-18.4. Arsenic and antimony concentrations in plants were low for almost of the samples, both in Ferneziu and Săsar area indicating a low mobility of these elements in the studied soils. Conclusion: This study indicated the soil pollution with arsenic both in Ferneziu district and in Săsar district. The soil pollution with antimony was found especially in Ferneziu district.

  4. The MRP1-mediated effluxes of arsenic and antimony do not require arsenic-glutathione and antimony-glutathione complex formation.

    Science.gov (United States)

    Salerno, Milena; Petroutsa, Maria; Garnier-Suillerot, Arlette

    2002-04-01

    Arsenic trioxide is an effective treatment for acute promyelocytic leukemia, but resistance to metalloid salts is found in humans. Using atomic absorption spectroscopy, we have measured the rate of uptake of arsenic trioxide and of antimony tartrate in GLC4 and GLC4/ADR cells overexpressing MRP1 and the rate of their MRP1-mediated effluxes as a function of the intracellular GSH concentration. In sensitive cells, after 1 h, a pseudosteady state is reached where intra- and extracellular concentrations of metalloid are the same. This precludes the formation, at short term, of complexes between arsenic or antimony with GSH. In resistant cells reduced intracellular accumulation of arsenic (or antimony), reflecting an increased rate of arsenic (or antimony) efflux from the cells, is observed. No efflux of the metalloid is observed in GSH depleted cells. The two metalloids and GSH are pumped out by MRP1 with the same efficiency. Moreover for the three compounds 50% of the efflux is inhibited by 2 microM MK571. This led us to suggest that As- and Sb-containing species could be cotransported with GSH. PMID:12018890

  5. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    International Nuclear Information System (INIS)

    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas

  6. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Murciego, A. Murciego [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Sanchez, A. Garcia [IRNA-CSIC, Departamento de Geoquimica Ambiental, Aptdo. 257, Salamanca (Spain); Gonzalez, M.A. Rodriguez [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Gil, E. Pinilla [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)]. E-mail: epinilla@unex.es; Gordillo, C. Toro [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Fernandez, J. Cabezas [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Triguero, T. Buyolo [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)

    2007-01-15

    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas.

  7. Determination of antimony by using tungsten trap atomic absorption spectrometry

    International Nuclear Information System (INIS)

    An electrically heated tungsten coil was used as a trap in the determination of antimony. The technique consists of three steps. Initially, SbH3 is formed by hydride generation procedure; then the analyte species in vapor form are transported to W-coil trap heated at 370 deg. C. Following the preconcentration step, the trap is heated to 895 deg. C; analyte species are revolatilized and transported to the flame-heated quartz atom cell where atomization and the formation of signal take place. The experimental parameters were optimized both for trap and no-trap studies. The most important experimental parameters are concentrations of HCl and NaBH4 solutions, H2 and Ar gas flow rates, and collection and revolatilization temperatures of W-coil. Accuracy was tested using a certified reference material, waste water EU-L-1. Limit of detection for the system is 16 ng l-1 using a sample of 36 ml collected in 4.0 min. Enhancement factor in sensitivity was 17

  8. NEW ERBIUM DOPED ANTIMONY GLASSES FOR LASER AND GLASS AMPLIFICATION

    Directory of Open Access Journals (Sweden)

    B. Tioua

    2015-07-01

    Full Text Available Because of the special spectroscopic properties of the rare earth ions, rare earth doped glasses are widely used in bulk and fiber lasers or amplifiers. The modelling of lasers and searching for new laser transitions require a precise knowledge of the spectroscopic properties of rare earth ions in different host glasses. In this poster will offer new doped erbium glasses synthesized in silicate crucibles were obtained in the combination Sb2O3-WO3-Na2O. Several properties are measured and correlated with glass compositions. The absorption spectral studies have been performed for erbium doped glasses. The intensities of various absorption bands of the doped glasses are measured and the Judd-Ofelt parameters have been computed. From the theory of Judd-Ofelt, various radiative properties, such as transition probability, branching ratio and radiative life time for various emission levels of these doped glasses have been determined and reported. These results confirm the ability of antimony glasses for glass amplification.

  9. 11 CFR 100.138 - Sale of food and beverages by vendor.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138 Section 100.138 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage by a vendor (whether incorporated...

  10. A Study of the r-Process Path Nuclides,$^{137,138,139}$Sb using the Enhanced Selectivity of Resonance Ionization Laser Ionization

    CERN Multimedia

    Walters, W

    2002-01-01

    The particular features of the r-process abundances with 100 < A < 150 have demonstrated the close connection between knowledge of nuclear structure and decay along the r-process path and the astrophysical environement in which these elements are produced. Key to this connection has been the measurement of data for nuclides (mostly even-N nuclides) that lie in the actual r-process path. Such data are of direct use in r-process calculations and they also serve to refine and test the predictive power of nuclear models where little or no data now exist. In this experiment we seek to use the newly developed ionization scheme for the Resonance Ionization Laser Ion Source (RILIS) to achieve selective ionization of neutron-rich antimony isotopes in order to measure the decay properties of r-process path nuclides $^{137,138,139}$Sb. These properties include the half-lives, delayed neutron branches, and daughter $\\gamma$-rays. The new nuclear structure data for the daughter Te nuclides is also of considerable in...

  11. Predictors of an unsatisfactory response to pentavalent antimony in the treatment of American visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Santos Mácia A.

    2002-01-01

    Full Text Available Although treatment of visceral leishmaniasis with pentavalent antimony is usually successful, some patients require second-line drug therapy, most commonly with amphotericin B. To identify the clinical characteristics that predict an inadequate response to pentavalent antimony, a case-control study was undertaken in Teresina, Piaui, Brazil. Over a two-year period, there were 19 cases of VL in which the staff physicians of a hospital prescribed second-line therapy with amphotericin B after determining that treatment with pentavalent antimony had failed. The control group consisted of 97 patients that were successfully treated with pentavalent antimony. A chart review using univariate and multivariate analysis was performed. The cure rate was 90% with amphotericin B. The odds ratio for the prescription of amphotericin B was 10.2 for children less than one year old, compared with individuals aged over 10 years. Patients who presented coinfection had an OR of 7.1 while those on antibiotics had an OR of 2.8. These data support either undertaking a longer course of therapy with pentavalent antimony for children or using amphotericin B as a first-line agent for children and individuals with coinfections. It also suggests that chemoprophylaxis directed toward bacterial coinfection in small children with VL may be indicated.

  12. Copper-promoted cementation of antimony in hydrochloric acid system: A green protocol.

    Science.gov (United States)

    Wu, Lian-Kui; Li, Ying-Ying; Cao, Hua-Zhen; Zheng, Guo-Qu

    2015-12-15

    A new method of recovering antimony in hydrochloric acid system by cementation with copper powder was proposed and carried out at laboratory scale. Thermodynamic analysis and cyclic voltammetry test were conducted to study the cementation process. This is a novel antimony removal technology and quite meets the requirements of green chemistry. The main cement product Cu2Sb is a promising anodic material for lithium and sodium ion battery. And nearly all consumed copper powder are transformed into CuCl which is an important industrial material. The effect of reaction temperature, stoichiometric ratio of Cu to Sb(III), stirring rate and concentration of HCl on the cementation efficiency of antimony were investigated in detail. Optimized cementation condition is obtained at 60 °C for 120 min and stirring rate of 600 rpm with Cu/Sb(III) stoichiometric ratio of 6 in 3 mol L(-1) HCl. At this time, nearly all antimony can be removed by copper powder and the cementation efficiency is over 99%. The structure and morphologies of the cement products were characterized by X-ray diffraction and scanning electron microscopy, respectively. Results show that the reaction temperature has little influence on the morphology of the cement products which consist of particles with various sizes. The activation energy of the cementation antimony on copper is 37.75 kJ mol(-1), indicating a chemically controlled step. Inductively coupled plasma mass spectrometry results show that no stibine generates during the cementation process. PMID:26252996

  13. Determination of traces of uranium and thorium in antimony(III) oxide by ICP-MS

    International Nuclear Information System (INIS)

    Traces of uranium and thorium in antimony(III) oxide were determined by inductively coupled plasma mass spectrometry (ICP-MS). A method of vaporization as the halide was applied to the separation of the analytes from the antimony matrix. Because the above separation method is so simple, reduced of external contamination was expected. In the case of vaporization using hydrochloric acid, however, it was found that antimony trichloride ions overlapped thorium ion of 232 (m/z). To find the most suitable conditions for matrix separation, vaporization behaviors were studied by using different acidic solutions such as HBr, HBr-HClO4 and HBr-H2SO4. Neither HBr+HClO4 nor HBr+H2SO4 was able to reduce the antimony matrix down to an unaffected level on ICP-MS measurement. On the other hand, in the case of the vaporization using hydrobromic acid, almost all the antimony matrix was removed. Determination limits obtained by this method were 0.02 and 0.03 ng g-1 for uranium and thorium, respectively. (author)

  14. Gaseous hydrogen embrittlement of PH 13-8 Mo steel

    Science.gov (United States)

    Ding, Y. S.; Tsay, L. W.; Chiang, M. F.; Chen, C.

    2009-04-01

    In this study, notched tensile and fatigue crack growth tests in gaseous hydrogen were performed on PH 13-8 Mo stainless steel specimens at room temperature. These specimens were susceptible to hydrogen embrittlement (HE), but at different degrees, depending on the aging conditions or the microstructures of the alloys. In hydrogen, the accelerated fatigue crack growth rate (FCGR) usually accompanied a reduced notched tensile strength (NTS) of the specimens, i.e., the faster the FCGR the lower the NTS. It was proposed that the same fracture mechanism could be applied to these two different types of specimens, regardless of the loading conditions. Rapid fatigue crack growth and high NTS loss were found in the H800 (426 °C under-aged) and H900 (482 °C peak-aged) specimens. The HE susceptibility of the steel was reduced by increasing the aging temperature above 593 °C, which was attributed to the increased amount of austenite in the structure. Extensive quasi-cleavage fracture was observed for the specimens that were deteriorated severely by HE.

  15. Antimony leaching in plastics from waste electrical and electronic equipment (WEEE) with various acids and gamma irradiation

    International Nuclear Information System (INIS)

    Highlights: • We have proposed a method to recover antimony from electronic plastics. • The most efficient acid solution was sodium hydrogen tartrate in dimethyl sulfoxide. • Gamma irradiation did not influence the antimony leaching ability. - Abstract: There has been a recent interest in antimony since the availability in readily mined areas is decreasing compared to the amounts used. It is important in many applications such as flame retardants and in the production of polyester, which can trigger an investigation of the leachability of antimony from plastics using different acids. In this paper, different types of acids are tested for their ability to leach antimony from a discarded computer housing, made of poly(acrylonitrile butadiene styrene), which is a common plastic type used in electrical and electronic equipment. The acid solutions included sodium hydrogen tartrate (0.5 M) dissolved in either dimethyl sulfoxide or water (at ca. 23 °C and heated to ca. 105 °C). The metal content after leaching was determined by inductively coupled plasma optical emission spectroscopy. The most efficient leaching medium was the heated solution of sodium hydrogen tartrate in dimethyl sulfoxide, which leached almost half of the antimony from the poly(acrylonitrile butadiene styrene). Gamma irradiation, which is proposed to improve the mechanical properties in plastics, was used here to investigate the influence of antimony leaching ability. No significant change in the amount of leached antimony could be observed

  16. Analysis of 138 cases of drug eruption%138例药疹住院病例分析

    Institute of Scientific and Technical Information of China (English)

    龚春燕; 申国庆; 江丽; 李敏

    2008-01-01

    目的 探讨药疹致敏药物与临床表现.方法 收集2005年1月至2007年6月,对住院治疗的138例药疹病例,进行同顾性分析.结果 主要的致敏药物为抗菌药,占31.46%;其中阿莫西林致病最常见,占11.23%;其次为非甾体抗炎药,占28.09%;中药类,占15.73%.口服给药是引起药疹的主要途径,占54.17%.主要的皮疹类型为多形红斑型,占33.71%.其次为固定型,占28.09%,发疹型占22.47%.重症药疹主要致敏药物为抗痛风药和中药类.结论 抗菌药和非甾体抗炎药引起药疹比较常见,尤其是阿莫西林.中成药引起药疹的发生率有所上升,临床应重视口服给药引起药疹的问题.%Objective To update the knowledge on the sensitizing drugs and clinical features of drug eruption. Methods The clinical data on 138 patients hospitalized for drug eruption in the Department of Dermatology, Institute of Dermatology, Chinese Academy of Medical Sciences, from January 2005 to June 2007, were collected and retrospectively analyzed. Results Totally, 178 episodes of drug eruption were observed in these patients during the tested period. The major sensitizing drugs included antibacterial agents (31.46%), non-steroidal anti-inflammatory drugs (28.09%), traditional Chinese medicines (15.73%). Amoxicillin triggered 20 episodes of drug eruption and was the most common causative drug. Oral administration was the predominant sensitizing route of administration (54.17%). Of all the drug eruptions, 33.71% manifested by erythema multiforme, 28.09% by fixed drug eruption, 22.47% by exanthematous drug eruption. Severe types of drug eruption were mainly caused by traditional Chinese medicines and anti-gout drugs. Conclusions Antibacterial agents and non-steroidal anti-inflammatory drugs have become the major sensitizing drugs of drug eruption, especially amoxicillin. The frequency of traditional Chinese medicine-induced eruptions are increasing. Furthermore, caution is warranted for the drug

  17. Mixed Antimony(V Complexes with Different Sugars to Modulate the Oral Bioavailability of Pentavalent Antimonial Drugs

    Directory of Open Access Journals (Sweden)

    Weverson A. Ferreira

    2014-04-01

    Full Text Available Previous studies have shown that the association of the drug meglumine antimoniate (MA with β-cyclodextrin can improve its bioavailability by the oral route. In this work, ribose and maltose were investigated for their ability to form mixed or association complexes with MA, release MA and modulate the serum levels of Sb after oral administration in mice. Analysis of the MA/ribose composition by high performance liquid chromatography coupled to mass spectrometry (LCMS-IT-TOF revealed the presence of mixed meglumine-Sb-ribose and Sb-ribose complexes. Analysis of the MA/maltose composition suggested the formation of MA-maltose association compounds. Circular dichroism characterization of these compositions following dilution in water at 37 °C suggested a partial and slow dissociation of the association compounds. When the MA/ribose composition was administered orally and compared to MA, the serum concentration of Sb was significantly lower after 1 h and greater after 3 h. On the other hand, the MA/maltose composition showed similar serum Sb concentration after 1 h and higher level of Sb after 3 h, when compared to MA. In conclusion, the present study has demonstrated the formation of mixed or association complexes of MA with sugars, such as maltose and ribose, which promoted sustained serum level of Sb after oral administration.

  18. Anodic stripping voltammetry of antimony using gold nanoparticle-modified carbon screen-printed electrodes

    International Nuclear Information System (INIS)

    Carbon screen-printed electrodes (CSPE) modified with gold nanoparticles present an interesting alternative in the determination of antimony using differential pulse anodic stripping voltammetry. Metallic gold nanoparticles deposits have been obtained by direct electrochemical deposition. Scanning electron microscopy measurements show that the electrochemically synthesized gold nanoparticles are deposited in aggregated form. Any undue effects caused by the presence of foreign ions in the solution were also analyzed to ensure that common interferents in the determination of antimony by ASV. The detection limit for Sb(III) obtained was 9.44 x 10-10 M. In terms of reproducibility, the precision of the above mentioned method in %R.S.D. values was calculated at 2.69% (n = 10). The method was applied to determine levels of antimony in seawater samples and pharmaceutical preparations

  19. Response of cutaneous leishmaniasis (chiclero's ulcer) to treatment with meglumine antimoniate in Southeast Mexico.

    Science.gov (United States)

    Vargas-Gonzalez, A; Canto-Lara, S B; Damian-Centeno, A G; Andrade-Narvaez, F J

    1999-12-01

    Cutaneous leishmaniasis, known as chiclero's ulcer in southeastern Mexico, is characterized by a predominantly single, painless, ulcerated lesion, without lymphangitis or adenopathy. When located on the ear, it tends to become chronic, causing destruction of the pinna and disfigurement. It is caused predominantly by Leishmania (L.) mexicana. Although pentavalent antimonials (Sb5+) are the mainstay of leishmanial therapy and have been used for more than 50 years, dosage regimens have been repeatedly modified and the best one has not been fully identified. The main purpose of the present study was to investigate the response of chiclero's ulcer to treatment with meglumine antimoniate. One hundred five patients were treated with meglumine antimoniate at a daily dose of 1 ampule per day (425 mg of Sb5+) until healing. The lesions healed after a mean of 25 days (range = 5-60 days). PMID:10674678

  20. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮

    2001-01-01

    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  1. Geothermal and fluid flowing simulation of ore-forming antimony deposits in Xikuangshan

    Institute of Scientific and Technical Information of China (English)

    YANG Ruiyan; MA Dongsheng; BAO Zhengyu; PAN Jiayong; CAO Shuanglin; XIA Fei

    2006-01-01

    The Xikuangshan Antimony Deposit located in the Mid-Hunan Basin, China, is the largest antimony deposit in the world. Based on the hydrogeological and geochemical data collected from four sections, Xikuangshan-Dajienao (AO), Xikuangshan-Dashengshan (BO), Xikuangshan-Longshan (CO) and Dafengshan (DO) in the Basin, an advanced metallogenic model related to deep-cyclic meteoric water of Xikuangshan Antimony Deposit is put forward in this paper using a model of heat-gravity-driving fluid flow transportation. The simulation results show that the ore-forming fluid of the deposit mainly comes from the Dashengshan and Longshan areas where BO and CO sections are located if the overall basin keeps a constant atmospheric precipitation and infiltration rate during mineralization, and that the average transportation speed of the ore-forming fluids is about 0.2-0.4 m/a.

  2. Future trends of global atmospheric antimony emissions from anthropogenic activities until 2050

    Science.gov (United States)

    Zhou, Junrui; Tian, Hezhong; Zhu, Chuanyong; Hao, Jiming; Gao, Jiajia; Wang, Yong; Xue, Yifeng; Hua, Shenbin; Wang, Kun

    2015-11-01

    This paper presents the scenario forecast of global atmospheric antimony (Sb) emissions from anthropogenic activities till 2050. The projection scenarios are built based on the comprehensive global antimony emission inventory for the period 1995-2010 which is reported in our previous study. Three scenarios are set up to investigate the future changes of global antimony emissions as well as their source and region contribution characteristics. Trends of activity levels specified as 5 primary source categories are projected by combining the historical trend extrapolation with EIA International energy outlook 2013, while the source-specific dynamic emission factors are determined by applying transformed normal distribution functions. If no major changes in the efficiency of emission control are introduced and keep current air quality legislations (Current Legislation scenario), global antimony emissions will increase by a factor of 2 between 2010 and 2050. The largest increase in Sb emissions is projected from Asia due to large volume of nonferrous metals production and waste incineration. In case of enforcing the pollutant emission standards (Strengthened Control scenario), global antimony emissions in 2050 will stabilize with that of 2010. Moreover, we can anticipate further declines in Sb emissions for all continents with the best emission control performances (Maximum Feasible Technological Reduction scenario). Future antimony emissions from the top 10 largest emitting countries have also been calculated and source category contributions of increasing emissions of these countries present significant diversity. Furthermore, global emission projections in 2050 are distributed within a 1° × 1°latitude/longitude grid. East Asia, Western Europe and North America present remarkable differences in emission intensity under the three scenarios, which implies that source-and-country specific control measures are necessary to be implemented for abating Sb emissions from

  3. Co-doping with antimony to control phosphorous diffusion in germanium

    KAUST Repository

    Tahini, H. A.

    2013-02-15

    In germanium, phosphorous and antimony diffuse quickly and as such their transport must be controlled in order to design efficient n-typed doped regions. Here, density functional theory based calculations are used to predict the influence of double donor co-doping on the migration activation energies of vacancy-mediated diffusion processes. The migration energy barriers for phosphorous and antimony were found to be increased significantly when larger clusters involving two donor atoms and a vacancy were formed. These clusters are energetically stable and can lead to the formation of even larger clusters involving a number of donor atoms around a vacancy, thereby affecting the properties of devices.

  4. Studies on Thin Films of Antimony Vacuum Evaporated from a Knudsen-Type Source

    Directory of Open Access Journals (Sweden)

    K.L. Chaudhary

    2000-10-01

    Full Text Available A Knudsen-type evaporation source was used for the deposition of thin films of antimony to study their growth and microstructure under different rates of evaporation and substrate temperatures when vacuum evaporated onto air-cleaved KC1, mica, amorphous carbon and doped KCl substrates. The crystallisation of these films on exposure to an electron beam of moderate intensity inside the electron microscope was studied, and the orientations of the crystallised films wrt the substrate were established. It has been concluded that antimony films prepared by this source compare well with those prepared by other sources of vacuum evaporation.

  5. 33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation.

    Science.gov (United States)

    2010-07-01

    .... (d) 33 CFR Ch. I (7-1-10 Edition) Coast Guard, DHS ... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative...

  6. 29 CFR 2570.138 - Decision of the administrative law judge.

    Science.gov (United States)

    2010-07-01

    ... file with the administrative law judge, subject to the judge's discretion, proposed findings of fact... 29 Labor 9 2010-07-01 2010-07-01 false Decision of the administrative law judge. 2570.138 Section... Civil Penalties Under ERISA Section 502(c)(7) § 2570.138 Decision of the administrative law judge....

  7. Human Cytomegalovirus UL138 Open Reading Frame Is Highly Conserved in Clinical Strains

    Institute of Scientific and Technical Information of China (English)

    Ying Qi; Rong He; Yan-ping Ma; Zheng-rong Sun; Yao-hua Ji; Qiang Ruan

    2009-01-01

    To investigate the variability of human cytomegalovirus (HCMV) UL138 open reading flame (ORF) in clinical strains.Methods HCMV UL138 ORF was amplified by polymerase chain reaction (PCR) and PCR amplification products were sequenced directly, and the data were analyzed in 19 clinical strains.Results UL138 ORF in all 30 clinical strains was amplified successfully. Compared with that of Toledo strain, the nucleotide and amino acid sequence identities of UL138 ORF in all strains were 97.41% to 99.41% and 98.24% to 99.42%, respectively. All of the nucleotide mutations were substitutions. The spatial structure and post-translational modification sites of UL138 encoded proteins were conserved. The result of phylogenetic tree showed that HCMV UL138 sequence variations were not definitely related with different clinical symptoms.Conclusion HCMV UL138 ORF in clinical strains is high conservation, which might be helpful for UL138 encoded protein to play a role in latent infection of HCMV.

  8. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from diseased Nile tilapia

    Science.gov (United States)

    Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome of S. agalactiae 138P is 1,838,716 bp. The availability of this genome will allow comparative genomics to identify genes for antigen disco...

  9. Complete Genome Sequence of a Virulent Streptococcus agalactiae Strain, 138P, Isolated from Diseased Nile Tilapia

    OpenAIRE

    Pridgeon, Julia W.; Zhang, Dunhua

    2014-01-01

    Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome sequence of S. agalactiae 138P is 1,838,701 bp. The availability of this genome will allow comparative genomics analysis to identify genes for antigen discovery and vaccine development.

  10. Electron-impact ionization of laser-excited Ba-138 (... 5p6 6s 6p) and Ba-138 (... 5p6 6s 5d) atoms

    Science.gov (United States)

    Trajmar, S.; Nickel, J. C.; Antoni, T.

    1986-01-01

    Electron-impact ionization cross sections for laser-excited Ba-138 (... 5p6 6s 6p; 1P1, M = - 1) and cascade-populated Ba-138 (... 5p6 6s 5d; 1D + 3D) atoms were measured in the threshold to 10 eV energy range. The peak cross sections for the excited species are about a factor of 2 larger than that for ground-state Ba. In addition, it was demonstrated that ionization from individual magnetic substates of various hyperfine levels can be studied. The ionization cross sections in the case of Ba-138 (1P1) were found to be equal for the M = 0 and for the M = + or - 1 sublevels within the experimental error limit.

  11. Diel variation of arsenic, molybdenum and antimony in a stream draining natural As geochemical anomaly

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Nováková, B.; Matoušek, Tomáš; Mihaljevič, M.; Rohovec, Jan; Filippi, Michal

    2013-01-01

    Roč. 31, APR (2013), s. 84-93. ISSN 0883-2927 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:68081715 ; RVO:67985831 Keywords : arsenic * molybdenum * antimony * trace elements * diel cycle Subject RIV: CB - Analytical Chemistry, Separation; DD - Geochemistry (GLU-S) Impact factor: 2.021, year: 2013

  12. Differences in antimony and arsenic releases from lead smelter fly ash in soils

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Šebek, O.; Valigurova, R.; Klementová, Mariana

    2012-01-01

    Roč. 72, Supp. 4 (2012), s. 15-22. ISSN 0009-2819 Institutional research plan: CEZ:AV0Z40320502 Keywords : Antimony * Arsenic * Lead smelting * Fly ash * Soil * Mobility Subject RIV: CA - Inorganic Chemistry Impact factor: 1.351, year: 2012

  13. Transparent Conducting Films of Antimony-Doped Tin Oxide with Uniform Mesostructure Assembled from Preformed Nanocrystals

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rathouský, Jiří; Rasp, M.; Schütz, B.; Niederberger, M.; Fattakhova-Rohlfing, D.

    Vol. 1. Boca Raton : Taylor-Francis, 2010, s. 627-630. ISBN 978-1-4398-3401-5. - ( Nanotech 2010) R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * mesoporous materials * nanoparticles * self-assembly Subject RIV: CF - Physical ; Theoretical Chemistry

  14. Determination of barium and antimony in gun shot residues by neutron activation analysis

    International Nuclear Information System (INIS)

    The antimony contents on both hands of 7 persons before and after firing an automatic pistol were determined by instrumental neutron activation analysis. The gun shot residues were removed from hands by a 4% solution of cellulose acetate in acetone. The average content of antimony on both hands before firing obtained from 70 measurements (35 from each hand) was 0.040 ± 0.010 micro gram, whereas the average contents on the right and the left hands after 1 firing were 0.385 ± 0.036 and 0.144 ± 0.029 micro gram respectively. The ration of the antimony contents after 1 firing to the normal level (before firing) was 9.9 for the right and 3.6 for the left. No significant difference was observed between male and female, smoker and non-smoker. The antimony content after several firings was not much different from that of 1 firing and it reduced to the normal level within 2 days after firing. The barium contents before and after firing were studied from one person. Barium was precipitated as Ba SO4 before counting. An average contents of 0.936 ± 0.551 micro gram for both hands before firing, 4.092 ± 2.687 micro gram for the right hand and 1.363 ± 0.879 micro gram for the left hand after 1 firing were found

  15. Transparent Conducting Films of Antimony-Doped Tin Oxide with Uniform Mesostructure Assembled from Preformed Nanocrystals

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rasp, M.; Rathouský, Jiří; Schütz, B.; Niederberger, M.; Fattakhova-Rohlfing, D.

    2010-01-01

    Roč. 6, č. 5 (2010), s. 633-637. ISSN 1613-6810 R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * msoporous materials * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 7.333, year: 2010

  16. Antimony production by carbothermic reduction of stibnite in the presence of lime

    Directory of Open Access Journals (Sweden)

    Padilla R.

    2014-01-01

    Full Text Available Experimental work on the carbothermic reduction of Sb2S3 in the presence of lime was carried out in the temperature range of 973 to 1123 K to produce antimony in an environmentally friendly manner. The results demonstrated the technical feasibility of producing antimony by this method without producing SO2 gas. Complete conversion of Sb2S3 was obtained at 1023 K in about 1000 seconds and at 1123 K in less than 250 seconds using stibnite-carbon-lime mixtures with molar ratios Sb2S3:CaO:C = 1:3:3. It was found that the reduction proceeds through the formation of an intermediate oxide SbO2, which is subsequently reduced by CO(g to yield antimony metal and CaS. The kinetics of the Sb2S3 reduction was analyzed by using the equation ln(1-X = -kt. The activation energy was 233 kJ mol-1 in the temperature range of 973 to 1123 K. This value would correspond to an antimony catalyzed carbon oxidation by CO2.

  17. Reaction products and corrosion of molybdenum electrode in glass melt containing antimony oxides and sodium sulfate

    Czech Academy of Sciences Publication Activity Database

    Matěj, J.; Langrová, Anna

    2012-01-01

    Roč. 56, č. 3 (2012), s. 280-285. ISSN 0862-5468 Institutional support: RVO:67985831 Keywords : antimony oxides * corrosion * glass melt * Molybdenum electrode * sulfate Subject RIV: DD - Geochemistry Impact factor: 0.418, year: 2012 http://www.ceramics-silikaty.cz/2012/pdf/2012_03_280.pdf

  18. On the segregation behavior of tin and antimony at grain boundaries of polycrystalline bcc iron

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Šandera, P.; Horníková, J.; Pokluda, J.; Godec, M.

    2016-01-01

    Roč. 363, Feb (2016), 140-144. ISSN 0169-4332 R&D Projects: GA ČR GAP108/12/0144 Institutional support: RVO:68378271 Keywords : grain boundary segregation * tin * antimony * Fe based alloy * AES quantification Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.711, year: 2014

  19. Synthesis of antimony tris(mercaptoethyl carboxylates) as thermal stabilizer for polyvinyl chloride

    Institute of Scientific and Technical Information of China (English)

    舒万艮; 刘又年; 陈启元

    2002-01-01

    A novel type of thermal stabilizers-antimony tris(mercaptoethyl carboxylates) (Sb(SCH2CH2OOCR) 3), was synthesized from carboxylic acid, antimony trioxide and 2-mercaptoethanol in two steps. The experimental results show that the molar ratio of carboxylic acid to antimony tris(2-hydroxyethyl mercaptide) is 1.2, when adding 0.6% tetra-n-butyl titanate as catalyst and xylene as isotropic solvent, heating and refluxing for about 2~4h. The thermal stability was measured by heat-aging oven test. The thermal stability time is about 8~40min(at 200℃) when adding 2% tetra-n-butyl titanate in polyvinyl chloride(PVC). Among these stabilizers, antimony tris(mercaptoethyl stearate) has best thermal stability. Its thermal stability is better than that of Ca-Zn complex and basic lead stabilizers, and equal to that of organotin. In addition, the stabilization mechanism of this kind of stabilizers for PVC was discussed briefly.

  20. Cd138 Expression in Renal Tumors and Its Usage in the Differential Diagnosis

    Directory of Open Access Journals (Sweden)

    Ayhan ÖZCAN

    2011-05-01

    Full Text Available Objective: The differential diagnosis of kidney tumors, especially those with eosinophilic cytoplasms, can be problematic due to overlapping morphologic features. CD138 is primarily a plasma cell marker but is known to be expressed in the proximal renal tubular epithelium as well. This study aims to investigate the possible contribution of CD138 expression in the differential diagnosis of kidney tumors with eosinophilic cytoplasm.Material and Method: The case series consisted of 15 chromophobe (ChRCC, 5 eosinophilic variant (EoRCC, 10 clear cell (CCRCC and 9 papillary (PRCC renal cell carcinomas, and 13 oncocytomas. Sections obtained from representative paraffin blocks were stained against CD138 antibody.Results: All CCRCC and PRCC showed membranous CD138 expression. In some of the other eosinophilic renal tumors, cytoplasmic CD138 labeling in varying degrees was detected. In CCRCC cases, CD138 expression was especially observed in low grade areas and areas showing cystic and pseudopapillary growth patterns. A similar pattern of cytoplasmic staining was seen in 3 of the EoRCC and the most of the PRCC cases (6/9.Conclusion: Our findings suggest that CD138 may contribute to the differential diagnosis of renal tumors because of the membranous staining pattern in CCRCC and EoRCC cases and the cytoplasmic staining in CHRCC and oncocytoma cases. Its contributory role may be improved by combined usage with markers like Cytokeratin 7 and RCC marker.

  1. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2016-04-01

    Full Text Available Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine liposomes and to analyze their biological and physicochemical characteristics. METHODS: Liposomes containing meglumine antimoniate (MA or pentavalent antimony salt (Sb were obtained through filter extrusion (FEL and characterized by transmission electron microscopy. Promastigotes of Leishmania infantum were incubated with the drugs and the viability was determined with a tetrazolium dye (MTT assay. The effects of these drugs against intracellular amastigotes were also evaluated by optical microscopy, and mammalian cytotoxicity was determined by an MTT assay. RESULTS: Liposomes had an average diameter of 162nm. MA-FEL showed inhibitory activity against intracellular L. infantum amastigotes, with a 50% inhibitory concentration (IC50 of 0.9μg/mL, whereas that of MA was 60μg/mL. Sb-FEL showed an IC50 value of 0.2μg/mL, whereas that of free Sb was 9μg/mL. MA-FEL and Sb-FEL had strong in vitro activity that was 63-fold and 39-fold more effective than their respective free drugs. MA-FEL tested at a ten-times higher concentration than Sb-FEL did not show cytotoxicity to mammalian cells, resulting in a higher selectivity index. CONCLUSIONS: Antimonial drug-containing liposomes are more effective against Leishmania-infected macrophages than the non-liposomal drugs.

  2. A novel extended-spectrum TEM-type beta-lactamase, TEM-138, from Salmonella enterica serovar Infantis.

    OpenAIRE

    chouchani, chedli; Berlemont, Renaud; A. Masmoudi; Galleni, Moreno; Frère, Jean-Marie; O Belhadj; Ben-Mahrez, K.

    2006-01-01

    A novel natural TEM beta-lactamase with extended-spectrum activity, TEM-138, was identified in a ceftazidime-resistant clinical isolate of Salmonella enterica serovar Infantis. Compared to TEM-1, TEM-138 contains the following mutations: E104K, N175I, and G238S. The bla(TEM-138) gene was located on a 50-kb transferable plasmid. Expression studies with Escherichia coli revealed efficient ceftazidimase and cefotaximase activities for TEM-138.

  3. A Novel Extended-Spectrum TEM-Type β-Lactamase, TEM-138, from Salmonella enterica Serovar Infantis

    OpenAIRE

    CHOUCHANI, CHEDLY; Berlemont, Renaud; Masmoudi, Afef; Galleni, Moreno; Frere, Jean-Marie; Belhadj, Omrane; Ben-Mahrez, Kamel

    2006-01-01

    A novel natural TEM β-lactamase with extended-spectrum activity, TEM-138, was identified in a ceftazidime-resistant clinical isolate of Salmonella enterica serovar Infantis. Compared to TEM-1, TEM-138 contains the following mutations: E104K, N175I, and G238S. The blaTEM-138 gene was located on a 50-kb transferable plasmid. Expression studies with Escherichia coli revealed efficient ceftazidimase and cefotaximase activities for TEM-138.

  4. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can...

  5. Excited states in the neutron deficient nuclei 138Sm and 139Eu

    International Nuclear Information System (INIS)

    Excited states in the two N=76 nuclei 138Sm and 139Eu have been identified via 32S induced reactions on different targets using γ-ray spectroscopy methods. Lifetimes have been measured with the Doppler shift recoil distance technique, showing the coexistence of a large nuclear deformation (β-0.24) with excitations of single particle character. The E2 transition strengths in the odd-even nucleus 139Eu and in its core 138Sm are discussed. (orig.)

  6. Mammary serine protease inhibitor and CD138 immunohistochemical expression in ovarian serous and clear cell carcinomas.

    Science.gov (United States)

    Hasby, Eiman Adel

    2016-04-01

    This study aims to investigate the immunohistochemical expression of mammary serine protease inhibitor (maspin) and CD138 in primary ovarian high-grade serous carcinomas (HGSC) as compared to low-grade serous carcinomas (LGSC) and clear cell carcinomas and investigate if the studied markers have a correlation to International Federation of Gynaecology and Obstetrics (FIGO) stage, Ki67 proliferation index, and to each other. Maspin cellular location varied significantly between studied groups with only nuclear expression seen in 46.7 % of LGSC group, mixed nuclear and cytoplasmic in 13.3, 28.6, and 20 % of LGSC, HGSC, and clear cell carcinoma, respectively, and was only cytoplasmic in 26.7, 71.4, and 80 % of LGSC, HGSC, and clear cell carcinoma, respectively. Mean maspin and CD138 counts were significantly higher in HGSC and clear cell carcinoma compared to LGSC. Both maspin and CD138 scores varied significantly between studied groups and were positively correlated with adverse prognostic factors in studied carcinomas including FIGO stage and Ki67 proliferation index. Besides, both maspin and CD138 had significant correlation to each other. These findings suggest that epithelial cytoplasmic expression of maspin and CD138 may have a significant role in tumorigenesis in ovarian high-grade serous carcinomas and clear cell carcinomas; these markers may regulate tumor cell proliferation, and their significant correlation to each other may suggest that CD138 probably induces maspin expression to protect tumor growth factors from being lysed by proteolytic enzymes. PMID:26526579

  7. Extraction-radiochemical study of the ion-association complex of antimony (V) with tetrazolium violet and its thermal behavior

    International Nuclear Information System (INIS)

    The optimum conditions for extraction of ion-associated complexes (IAS) formed from the tetrazolium salt - tetrazolium violet and Sb(V) in hydrochloric acid medium have been studied. An isotope of antimony (125Sb) was used for determination of the recovery factor (R%) and distribution ratio (DSb). The thermal behavior of the antimony complex with tetrazole violet was studied using differential thermal and thermogravimetric analysis. (author) 12 refs.; 3 figs

  8. Electrodes modified with bismuth, antimony and tin precursor compounds for electrochemical stripping analysis of trace metals (a short review)

    OpenAIRE

    Lezi, Nikolitsa; Economou, Anastasios; Barek, Jiří

    2014-01-01

    Over the last decade, intensive research is being carried out towards the development of “green” electrochemical sensors. Bismuth, antimony and tin electrodes have been proposed as potential substitutes of mercury electrodes in electrochemical stripping analysis of trace metals. The main advantage of these metals as electrode materials is their lower toxicity compared to mercury. Among the different configuration of bismuth, antimony and tin electrodes, one of the most attractive inv...

  9. Electrodeposition of SnSbCu Alloy on Copper from an Electrolyte with Varied Content of Antimony Chloride

    Science.gov (United States)

    Valeeva, A. Kh.; Valeev, I. Sh.

    2015-10-01

    The microstructure and chemical composition of electrodeposited alloys of the SnSbCu system with varied concentration of antimony chloride in the electrolyte have been investigated. It is shown that during electrodeposition mechanical-mixture alloys are not formed, but rather intermetallic compounds. It is found that increasing the concentration of antimony chloride in the electrolyte leads to a decrease in the tin content and cracking of the coating.

  10. Investigation into properties of the mixture of perfluoro-2-methyl-bicyclo(4,4,0) decane with antimony fluoride

    International Nuclear Information System (INIS)

    State diagram was constructed for a binary system formed by antimony fluoride and perfluoro-2-methyl-bicyclo-(4,4,0)decane in the temperature range of -58 deg to +56 deg C. Temperature dependence of solubility and the differential molar heat of solubility of solid Sb F5 were determined. Above the melting point of antimony fluoride these components were found to form a system of two sparingly miscible liquids with upper critical dissolution temperature

  11. Treatment of antimony mine drainage: challenges and opportunities with special emphasis on mineral adsorption and sulfate reducing bacteria.

    Science.gov (United States)

    Li, Yongchao; Hu, Xiaoxian; Ren, Bozhi

    2016-01-01

    The present article summarizes antimony mine distribution, antimony mine drainage generation and environmental impacts, and critically analyses the remediation approach with special emphasis on iron oxidizing bacteria and sulfate reducing bacteria. Most recent research focuses on readily available low-cost adsorbents, such as minerals, wastes, and biosorbents. It is found that iron oxides prepared by chemical methods present superior adsorption ability for Sb(III) and Sb(V). However, this process is more costly and iron oxide activity can be inhibited by plenty of sulfate in antimony mine drainage. In the presence of sulfate reducing bacteria, sulfate can be reduced to sulfide and form Sb2S3 precipitates. However, dissolved oxygen and lack of nutrient source in antimony mine drainage inhibit sulfate reducing bacteria activity. Biogenetic iron oxide minerals from iron corrosion by iron-oxidizing bacteria may prove promising for antimony adsorption, while the micro-environment generated from iron corrosion by iron oxidizing bacteria may provide better growth conditions for symbiotic sulfate reducing bacteria. Finally, based on biogenetic iron oxide adsorption and sulfate reducing bacteria followed by precipitation, the paper suggests an alternative treatment for antimony mine drainage that deserves exploration. PMID:27148704

  12. Basis for Early and Preferential Selection of the E138K Mutation in HIV-1 Reverse Transcriptase

    OpenAIRE

    McCallum, Matthew; Oliveira, Maureen; Ibanescu, Ruxandra-Ilinca; Kramer, Victor G; Moisi, Daniela; Asahchop, Eugene L.; Brenner, Bluma G.; Harrigan, P. Richard; Xu, Hongtao; Mark A Wainberg

    2013-01-01

    E138K, a G→A mutation in HIV-1 reverse transcriptase (RT), is preferentially selected by etravirine (ETR) and rilpivirine over other substitutions at position E138 that offer greater drug resistance. We hypothesized that there was a mutational bias for the E138K substitution and designed an allele-specific PCR to monitor the emergence of E138A/G/K/Q/R/V during ETR selection experiments. We also performed competition experiments using mutated viruses and quantified the prevalence of E138 minor...

  13. Understanding the radiolabelling mechanism of 99mTc-antimony sulphide colloid

    International Nuclear Information System (INIS)

    The chemistry of antimony trisulphide colloid (ATC) was examined to elucidate the radiolabelling mechanism with 99mTcO4-. Ion exchange chromatography and atomic absorption spectrophotometry techniques determined ATC to be resistant to hydrolysis in 0.1 M hydrochloric acid (HCl) at 25 deg. C or 100 deg. C (>97% recovery, Sb3+ absent). Hydrogen sulphide gas detected did not participate in the mechanism, where antimony trisulphide and 99mTcO4- in HCl/100 deg. C yielded 96% 99mTc-product from a K2S-free formulation (versus 98% when K2S was present). 99mTcO4- was reduced >90% by DMSA or dithiothreitol under the same conditions, identifying involvement of thiol groups. Infrared analysis of Re-ATC showed S-O bonds, indicating excess thiol groups at the colloid surface were oxidised at the expense of 99mTcO4- reduction

  14. A facile and fast route to prepare antimony (Sb) nanostructures without additives

    KAUST Repository

    Shah, M.A.

    2011-12-01

    Herein, we report a safe, low cost and reproducible approach for the synthesis of antimony (Sb) nanostructures with most of them having prism like morphology and having well defined faces in the range of ∼70210 nm. The organics free approach is based on a reaction of antimony powder and pure water at ∼210 °C without using any harmful additives and amines. The XRD pattern confirmed the composition and crystallinity of the grown nanostructures. The reported method besides being organics free is economical, fast and free of pollution, which will make it suitable for large scale production. Furthermore, it is well expected that such a technique could be extended to prepare many other important metal and metal oxide nanostructures. The prospects of the process are bright and promising. © 2012 Sharif University of Technology. Production and hosting by Elsevier B.V. All rights reserved.

  15. Determination by neutron activation analysis of loss of arsenic, antimony, bromine and mercury during lyophilization

    International Nuclear Information System (INIS)

    Neutron activation analysis has been used to monitor the loss of arsenic, as dimethylarsinic acid, (CH3)2AsOOH, or as sodium arsenate (Na2HAsO4.7H2O), antimony (as potassium antimony, tartrate, KSbC4O7.1/2H2O) and bromine (as bromide ion) during lyophilization of acidified and neutral aqueous synthetic and environmental samples. Losses of Sb and As ranged from zero to 60%, while losses of bromine were constant (at 91%) in acidic solutions. The variable losses of As and Sb were due solely to the presence of and partial decomposition of the (CH3)2AsOOH. Electrochemical oxidation of Br- to Br2 is responsible for the high losses of bromine. In addition losses of mercury (as methylmercuric chloride) were 1O0% in both acidic and neutral aqueous synthetic samples during lyophilization. (author)

  16. Deciphering lead and cadmium stripping peaks for porous antimony deposited electrodes

    Directory of Open Access Journals (Sweden)

    Taimoor Aqeel Ahmad

    2016-06-01

    Full Text Available Cadmium and lead are generally taken as model heavy metal ions in water to scale the detection limit of various electrode sensors, using electrochemical sensing techniques. These ions interact with the electrochemically deposited antimony electrodes depending on the diffusion limitations. The phenomenon acts differently for the in-situ and ex-situ deposition as well as for porous and non-porous electrodes. A method has been adopted in this study to discourage the stripping and deposition of the working ions (antimony to understand the principle of heavy metal ion detection. X-ray photoelectron spectroscopy (XPS technique was used to establish the interaction between the working and dissolved ions. In addition to the distinct peaks for each analyte, researchers also observed a shoulder peak. A possible reason for the presence of this peak was provided. Different electrochemical tests were performed to ascertain the theory on the basis of the experimental observations.

  17. Antimony/Graphitic Carbon Composite Anode for High-Performance Sodium-Ion Batteries.

    Science.gov (United States)

    Zhao, Xin; Vail, Sean A; Lu, Yuhao; Song, Jie; Pan, Wei; Evans, David R; Lee, Jong-Jan

    2016-06-01

    Although the room-temperature rechargeable sodium-ion battery has emerged as an attractive alternative energy storage solution for large-scale deployment, major challenges toward practical sodium-ion battery technology remain including identification and engineering of anode materials that are both technologically feasible and economical. Herein, an antimony-based anode is developed by incorporating antimony into graphitic carbon matrices using low-cost materials and scalable processes. The composite anode exhibits excellent overall performance in terms of packing density, fast charge/discharge capability and cyclability, which is enabled by the conductive and compact graphitic network. A full cell design featuring this composite anode with a hexacyanometallate cathode achieves superior power output and low polarization, which offers the potential for realizing a high-performance, cost-effective sodium-ion battery. PMID:27172376

  18. Antimony segregation in stressed SiGe heterostructures grown by molecular beam epitaxy

    International Nuclear Information System (INIS)

    The effects of the growth temperature, composition, and elastic strains in separate layers on the segregation of antimony are studied experimentally for stressed SiGe structures grown by molecular beam epitaxy. It is established that the growth conditions and parameters of the structures exert an interrelated influence on the segregation of Sb: the degree of the influence of the composition and elastic stresses in the SiGe layers on Sb segregation depends on the growth temperature. It is shown that usage of a method previously proposed by us for the selective doping of silicon structures with consideration for the obtained dependences of Sb segregation on the growth conditions and parameters of the SiGe layers makes it possible to form SiGe structures selectively doped with antimony

  19. Synthesis, spectroscopic characterization and antibacterial activity of antimony(III) bis(dialkyldithiocarbamato)alkyldithiocarbonates.

    Science.gov (United States)

    Chauhan, H P S; Bakshi, Abhilasha; Bhatiya, Sumit

    2011-10-15

    Some mixed sulfur donor ligand complexes of antimony(III) of the general formula [(R(2)NCS(2))](2)SbS(2)COR' where R = CH(3), C(2)H(5) and R' = Me, Et, Pr(n), Pr(i), Bu(n) and Bu(i) have been synthesized by the reaction of antimony(III) bis(dialkyldithiocarbamate) chloride with potassium organodithiocarbonate in an equimolar ratio by stirring at room temperature in benzene/CS(2) mixture. These complexes have been characterized by physicochemical [elemental analysis, melting points and molecular weight determinations] and spectral [UV, IR, Far-IR, NMR ((1)H and (13)C), FAB(+) mass and powder X-ray diffraction] studies. Free ligands and synthesized complexes have also been screened against different bacterial strains and results obtained made it desirable to delineate a comparison between free ligands, standard drug used and synthesized complexes. PMID:21764366

  20. Measurement of aluminium, silicon, manganese, copper and antimony in slag, castings and white metal

    International Nuclear Information System (INIS)

    Chemical analysis of the slag showed 24.90% SiO2, 17.88% Al2O3, 0.75% F2O3, 46.4% CaO and 2.34% MgO. In the four cast metal samples the manganese concentration was 0.75%, 0.48%, 0.47% and 0.42%. The white metal contained 59.04% tin, 7.43% antimony, 22.55% lead and 7.08% copper. The slag, casting and white metal samples came from the Industrial Research Centre for Central Africa (CRIAC), having been provided originally by the Société Somkat of Lubumbashi which operates iron, bronze and aluminium foundries. The aluminium, silicon, manganese, copper and antimony concentrations were easily measured, without the need for chemical separation. (author)

  1. Bi-antimony capped Keggin polyoxometalate modified with Cu-ligand fragment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Jiao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Han, Zhangang, E-mail: hanzg116@yahoo.com.cn [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhang, Heng; Yu, Haitao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhai, Xueliang, E-mail: xlzhai253@mail.hebtu.edu.cn [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China)

    2012-10-15

    Three polyoxometalates consisting of bi-antimony capped Keggin-type clusters: [Cu(mbpy){sub 2}]{sub 2}[PMo{sub 12}O{sub 40}Sb{sub 2}]{center_dot}4H{sub 2}O (1), [Cu(mbpy){sub 2}][PMo{sub 12}O{sub 40}Sb{sub 2}] (2) and {l_brace}Cu(mbpy)[Cu(mbpy){sub 2}]{sub 2}{r_brace}[VMo{sub 8}V{sub 4}O{sub 40}Sb{sub 2}]{center_dot}2H{sub 2}O (3) (mbpy=4,4 Prime -dimethyl-2,2 Prime - dipyridyl in 1 and 2; 5,5 Prime -dimethyl-2,2 Prime -dipyridyl in 3) have been synthesized and characterized by IR, X-ray powder diffraction, TG analysis and electrochemical property. Single-crystal analysis revealed that all of three compounds are built upon bi-antimony capped Keggin-type polyoxoanions and Cu-mbpy cations. In 1-3, two Sb{sup III} centers located at the two opposite of anionic surface adopt fundamentally tetragonal pyramidal coordination geometry. Both compounds 1 and 2 consist of P-centered Keggin structure, while compound 3 presents a V-centered Keggin anion. The Keggin-type anions present different structural features: isolated cluster in 1 and Cu-ligand-supported cluster in 2 and 3. - Graphical abstract: Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters modified with Cu-ligand cations have been synthesized and characterized. Highlights: Black-Right-Pointing-Pointer Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters have been synthesized. Black-Right-Pointing-Pointer Two Sb{sup III} centers located at the two opposite of anionic surface adopt tetragonal pyramidal coordination geometry. Black-Right-Pointing-Pointer The anions present different structural features: isolated and Cu-ligand-supported cluster.

  2. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium

    OpenAIRE

    Rajmund Michalski; Sebastian Szopa; Magdalena Jabłońska; Aleksandra Łyko

    2012-01-01

    Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemi...

  3. Metal corrosion studies with the fluorosulphonic acid-antimony pentafluoride superacid system

    International Nuclear Information System (INIS)

    Because of their rapid dissolution of many actinide metals and refractory oxides, superacids such as HSO3F/SbF5 have potential applications in actinide processing. However, material compatibility must first be addressed because of the highly corrosive nature of superacids. This paper describes the qualitative rates of attack of fluorosulphonic acid-antimony pentafluoride superacid on a variety of metal substrates relevant to nuclear processing

  4. Molybdenum-vanadium-antimony mixed oxide catalyst for isobutane partial oxidation synthesized using magneto hydrodynamic forces

    OpenAIRE

    Stuyven, Bernard; Emmerich, Jens; Eloy, Pierre; Van Humbeeck, Jan; Jacobs, Pierre; Kirschhock, Christine; Martens, Johan; Breynaert, Eric

    2014-01-01

    A peculiar effect was observed that the oxidation behavior of antimony oxide prepared in presence of a weak permanent magnetic field is changed. Reactivity of alpha-Sb2O3 (senarmontite) towards oxidation is significantly enhanced after recirculating its suspension in a magneto hydrodynamic (MHD) system. This inspired the MHD synthesis of a molybdenum-vanadiumantimony mixed oxide with superior catalytic activity for selective partial oxidation of isobutane. Traditionally these mixed oxides are...

  5. Temporal and spatial distribution of atmospheric antimony emission inventories from coal combustion in China

    International Nuclear Information System (INIS)

    A multiple-year inventory of atmospheric antimony (Sb) emissions from coal combustion in China for the period of 1980-2007 has been calculated for the first time. Specifically, the emission inventories of Sb from 30 provinces and 4 economic sectors (thermal power, industry, residential use, and others) are evaluated and analyzed in detail. It shows that the total Sb emissions released from coal combustion in China have increased from 133.19 t in 1980 to 546.67 t in 2007, at an annually average growth rate of 5.4%. The antimony emissions are largely emitted by industrial sector and thermal power generation sector, contributing 53.6% and 26.9% of the totals, respectively. At provincial level, the distribution of Sb emissions shows significant variation. Between 2005 and 2007, provinces always rank at the top five largest Sb emissions are: Guizhou, Hunan, Hebei, Shandong, and Anhui. - Highlights: → Atmospheric Sb emission inventory from coal in China during 1980-2007 is developed. → We included 1612 coal samples to determine the provincial mean Sb contents in coal. →Emission inventories of Sb from 30 provinces and 4 economic sectors are evaluated. → Total 546.67t Sb emissions in 2007 are mainly emitted from industrial sector. → There is significant variation for Sb distribution among different provinces. - A multiple-year inventory of atmospheric antimony emissions from coal combustion in China for the period of 1980-2007 has been calculated for the first time.

  6. Antimony in the Contaminated Site of El Triunfo, Baja California Sur, Mexico

    Directory of Open Access Journals (Sweden)

    Marmolejo-Rodríguez A. J.

    2013-04-01

    Full Text Available Antimony has properties similar to arsenic with some of its compounds toxic to humans. Therefore it is necessary to control the wastes accumulated by anthropogenic activities, such as mining, where it is in tailings to be released to the environment. According to the Environment Protection Agency, the maximum value in sediments is 11.2 mg Sb kg–1 and the Earth’s crust average is 0.2 mg Sb kg–1. In this semiarid area, the drainage basin El Carrizal is impacted with wastes of an abandoned gold mine at the Mining District El Triunfo (MD – ET which have tailings with 17,600 mg kg–1 of antimony. In the main dry river (arroyo, the Sb content is between 0.6 and 122 mg kg–1. This element is transported from the source throughout the fluvial basin to discharge into the Pacific Ocean. In the arroyo mouth we collected one sedimentary core and the sediment from dunes (28.6 – 45.7 and 6.43 – 7.74 mg Sb kg–1. This research concluded the antimony is enriched in this semiarid system, with Normalized Enrichment Factors severely enriched mainly in arroyo sediments close to the MD-ET

  7. Morphology and antimony segregation of spangles on batch hot-dip galvanized coatings

    International Nuclear Information System (INIS)

    Spangles produced by batch hot-dip galvanizing process have a rougher surface and a greater surface segregation of alloying element compared with those in continuous hot-dip galvanizing line (CGL), owing to the cooling rate of the former is much smaller than that of the later. Therefore, typical spangles on a batch hot-dipped Zn-0.05Al-0.2Sb alloy coating were investigated. The chemical, morphological characterization and identification of the phases on the spangles were examined by scanning electron microscopy (SEM), backscattered electron imaging (BSE), atomic force microscopy (AFM), energy dispersive spectroscopy (EDS) and X-ray diffraction analysis (XRD). The results showed that the coating surface usually exhibited three kinds of spangles: shiny, feathery and dull spangle, of which extensively antimony surface segregation was detected. The nature of precipitate on the coating surface was identified as β-Sb3Zn4, The precipitated β-Sb3Zn4 particles distributed randomly on the shiny spangle surface, both β-Sb3Zn4 particles and dentritic segregation of antimony dispersed in the dendritic secondary arm spacings of the feathery spangle and on the whole dull spangle surface. The dentritic segregation of antimony and precipitation of Sb3Zn4 compound are discussed by a proposed model.

  8. Methylated arsenic and antimony species in suspended matter of the river Ruhr, Germany

    Directory of Open Access Journals (Sweden)

    L. Duester

    2008-04-01

    Full Text Available The methylated antimony and arsenic species content of sediments derived from a sedimentation bowl of the river Ruhr were monitored over a 12 month period. The most prevalent species detected were monomethylarsenic (MMAs and monomethylantimony (MMSb. The methylantimony and methylarsenic species concentration was found to be directly correlated to the winter spate. As the biological activity in the water body is generally low at this time of the year, it may be concluded that the concentration maxima in winter originated from the translocation of soil- and sediment particles to the river by heavy rains and the melting of snow. A second maximum in Spring/early Summer was observed for the methylarsenic species, and specifically the dimethylarsenic species (DMAs; this occurred in parallel to the algal bloom. A change in the methylarsenic speciation pattern was observed between April, May and June, with DMAs replacing MMAs as the dominant methylarsenic species. For methylated antimony species no seasonal variation in the species pattern was detected. Taken together these data strongly indicate a higher degree of transformation of arsenic compared to antimony in the Ruhr river system in spring and can be taken as a record for a biogeochemical different behaviour of these two elements which are often treated as equivalent in environmental studies.

  9. Studies in atomic-fluorescence spectroscopy-V The fluorescence characteristics and determination of antimony.

    Science.gov (United States)

    Dagnall, R M; Thompson, K C; West, T S

    1967-10-01

    Atomic-fluorescence of antimony may be generated in an air-propane flame by nebulizing aqueous solutions of antimony salts whilst irradiating the flame by means of a microwave-excited electrode-less discharge tube operating at 30 W. The strongest fluorescence is exhibited by the (4)S(11 2 ) --> (4)P(1 3 ) 2311 A resonance line and weaker signals are observed at the 2068 and 2176 A resonance lines and at four intercombination lines, at 2598, 2671, 2770 and 2878 A. A process of thermally assisted direct-line fluorescence is postulated to account for the otherwise inexplicable intensity of the 2598 A line emission. Atomic-fluorescence spectroscopy at 2176 A permits the determination of antimony in the range 0.1-120 ppm with a detection limit of 0.05 ppm. With the same equipment and source, the range of measurement for atomic-absorption was 6-120 ppm and the detection limit was 1 ppm. No interferences were observed from 100-fold molar amounts of Cd, Co, Cu, Fe, Hg, K, Mg, Mn, Mo, Na, NH(4), Pb and Zn or from arsenate, chloride, nitrate, phosphate and sulphate. PMID:18960212

  10. Ultrasound- assisted emulsification microextraction for separation of trace amounts of antimony prior to FAAS determination

    International Nuclear Information System (INIS)

    We describe a simple and rapid method for the ultrasound-assisted microextraction of antimony using the solidified floating organic drop method. The effects of pH, type and volume of the extractant, time of sonication, amount of chelating agent, type and amount of surfactant were investigated and optimized. Bromopyrogollol red is acting as the chelating agent. Antimony(III) ion was extracted into finely dispersed droplets of undecanol after ion-pair formation with the water soluble chelator and the cationic detergent benzyldimethyltetradecylammonium chloride. Flame atomic absorption spectrometry was used for the detection. The resulting calibration is linear in the concentration range from 4. 0 to 900 ng mL-1 of Sb(III) with a correlation coefficient of 0. 9981. The enrichment factor is 67, the detection limit is 0. 62 ng mL-1, and the relative standard deviation is ±3. 6% (at 100 ng mL-1; for n = 10). The method was successfully applied to the determination of antimony in water samples. (author)

  11. 13.8-kV (ground) fault-bus-relaying study

    International Nuclear Information System (INIS)

    This study was made at the request of the committee appointed to investigate a power outage which occurred on May 5, 1980, at the ORGDP in Oak Ridge, Tennessee. A portion of this outage was due to a false ground on the 13.8-kV fault-bus-relaying system. This report covers the following five areas: (1) fundamentals of fault-bus relaying and application at ORGDP; (2) description of the false ground on the 13.8-kV fault-bus-relaying system and corrective actions taken at that time; (3) causes of the false 13.8-kV fault-bus-relay trip; (4) further possible corrective actions to reduce the possibility of another false 13.8-kV fault-bus-relay trip; and (5) effects of reducing ground-fault current magnitude and its effects on ground/relay coordination. Recommendations are presented concerning the reduction of the possibility of another false 13.8-kV fault-bus-relay trip and the reduction of the magnitude of ground-fault current

  12. Accumulation of antimony and other potentially toxic elements in plants around a former antimony mine located in the Ribes Valley (Eastern Pyrenees)

    Science.gov (United States)

    Bech, Jaume; Corrales, Isabel; Duran, Paola; Roca, Núria; Tume, Pedro; Barceló, Juan; Poschenrieder, Charlotte

    2010-05-01

    Soil contamination by antimony is of increasing environmental concern due to the use of this amphoterous p-block element in many industrial applications such as flame retardant, electronics, alloys, rubber and textile industries. However, little is still known about the response of plants to antimony. Here we report on the accumulation of antimony and other potentially toxic elements (mainly As, Pb and Cu) in plants growing around a former antimony mine in the ribes Valley located in the Eastern Pyrenees (424078E, 4686100N alt. 1145 m.a.s.l) that was operating approximately between the years 1870 to 1960. The ore mineral veins are included in quartz gangue. The main ores were: Sulphides: Stibnite (Sb2S3), Pyrite (FeS2), Sphalerite (ZnS), Arsenopyrite (FeAs), Galenite (PbS), Chalcopyrite (CuFeS2), Tetrahydrite (Cu5Sb2S3). Sulphosals: Boulangerite (5PbS•2Sb2S3), Jamesonite (4PbS•FeS•3Sb2S3), Zinckenite (6PbS•7Sb2S3), Plagionite (5PbS•4Sb2S3), Bournonite PbCu (Sb,As)S3, Pyrargirite (Ag3SbS3). Soil and plant samples were taken at five locations with different levels of Sb, As, and polymetallic contamination. Both pseudototal (aqua regia soluble) and extractable (EDTA) concentrations of metals from sites with low (sites 1 and 2), moderate (site 3 and 4) and high (sites 5 and 6) pollutant burdens were studied. The range of agua regia and EDTA values in mgkg-1 is as follows: Sb 8-2904 and 0.88-44; As: 33-16186 and 3.2-167; Pb: 79-4794 and 49-397; Cu: 66-712 and 48-56 mg•kg-1, respectively). While sites 1 to 4 had alkaline soil pH (7.4-8.7), sites 5 and 6 were acidic with values of 6 and 4.6, respectively. Different herbaceous plant species (Poa annua, Echium vulgare, Sonchus asper, Barbera verna among others) at the low and moderately polluted sites were able to efficiently restrict Sb and As transport to shoots showing average concentration ranges between 5.5 and 23 mg/kg As and 1.21 mg/kg and 4.9 mg/kg Sb. However, at the highly polluted acidic sites (5 and

  13. Ubiquitylation of Rad51d Mediated by E3 Ligase Rnf138 Promotes the Homologous Recombination Repair Pathway

    Science.gov (United States)

    Han, Deqiang; Liang, Junbo; Lu, Yalan; Xu, Longchang; Miao, Shiying; Lu, Lin-Yu; Song, Wei; Wang, Linfang

    2016-01-01

    Ubiquitylation has an important role as a signal transducer that regulates protein function, subcellular localization, or stability during the DNA damage response. In this study, we show that Ring domain E3 ubiquitin ligases RNF138 is recruited to DNA damage site quickly. And the recruitment is mediated through its Zinc finger domains. We further confirm that RNF138 is phosphorylated by ATM at Ser124. However, the phosphorylation was dispensable for recruitment to the DNA damage site. Our findings also indicate that RAD51 assembly at DSB sites following irradiation is dramatically affected in RNF138-deficient cells. Hence, RNF138 is likely involved in regulating homologous recombination repair pathway. Consistently, efficiency of homologous recombination decreased observably in RNF138-depleted cells. In addition, RNF138-deficient cell is hypersensitive to DNA damage insults, such as IR and MMS. And the comet assay confirmed that RNF138 directly participated in DNA damage repair. Moreover, we find that RAD51D directly interacted with RNF138. And the recruitment of RAD51D to DNA damage site is delayed and unstable in RNF138-depleted cells. Taken together, these results suggest that RNF138 promotes the homologous recombination repair pathway. PMID:27195665

  14. Raman sideband cooling of a 138Ba+ ion using a Zeeman interval

    CERN Document Server

    Seck, Christopher M; Dietrich, Matthew R; Odom, Brian C

    2016-01-01

    Motional ground state cooling and internal state preparation are important elements for quantum logic spectroscopy (QLS), a class of quantum information processing. Since QLS does not require the high gate fidelities usually associated with quantum computation and quantum simulation, it is possible to make simplifying choices in ion species and quantum protocols at the expense of some fidelity. Here, we report sideband cooling and motional state detection protocols for $^{138}$Ba$^+$ of sufficient fidelity for QLS without an extremely narrowband laser or the use of a species with hyperfine structure. We use the two S$_{1/2}$ Zeeman sublevels of $^{138}$Ba$^+$ to Raman sideband cool a single ion to the motional ground state. Because of the small Zeeman splitting, near-resonant Raman sideband cooling of $^{138}$Ba$^+$ requires only the Doppler cooling lasers and two additional AOMs. Observing the near-resonant Raman optical pumping fluorescence, we estimate a final average motional quantum number $\\bar{n}\\appro...

  15. Ion-Photon Entanglement and Bell Inequality Violation with 138Ba+

    CERN Document Server

    Auchter, Carolyn; Noel, Thomas W; Blinov, Boris B

    2013-01-01

    We report on the demonstration of ion-photon entanglement and Bell inequality violation in a system of trapped 138Ba+ ions. Entanglement between the Zeeman sublevels of the ground state of a single 138Ba+ ion and the polarization state of a single 493 nm photon emitted by the ion with a fidelity of $0.84\\pm0.01$ was achieved, along with a Bell signal of 2.3, exceeding the classical limit of 2 by over eight standard deviations. This system is a promising candidate for a loophole-free Bell inequality violation test as the wavelengths of the transitions of 138Ba+ are in the visible region and thus suitable for long range transmission over fiber optic cable.

  16. Microscopic interacting boson model calculations for even–even 128−138Ce nuclei

    Indian Academy of Sciences (India)

    Nurettin Turkan; Ismail Maras

    2007-05-01

    In this study, we determined the most appropriate Hamiltonian that is needed for the present calculations of energy levels and (2) values of 128−138Ce nuclei which have a mass around ≅ 130 using the interacting boson model (IBM). Using the best-fitted values of parameters in the Hamiltonian of the IBM-2, we have calculated energy levels and (2) values for a number of transitions in 128,130,132,134,136,138Ce. The results were compared with the previous experimental and theoretical (PTSM model) data and it was observed that they are in good agreement. Also some predictions of this model have better accuracy than those of PTSM model. It has turned out that the interacting boson approximation (IBA) is fairly reliable for calculating spectra in the entire set of 128,130,132,134,136,138Ce isotopes and the quality of the fits presented in this paper is acceptable.

  17. Comparison of oral itraconazole and intramuscular meglumine antimoniate in the treatment of cutaneous leishmaniasis

    International Nuclear Information System (INIS)

    To compare the efficacy and tolerability of oral itraconazole against intramuscular meglumine antimoniate in the treatment of Cutaneous Leishmaniasis (CL). Two hundred eligible and consenting patients of Cutaneous Leishmaniasis (CL) were divided in two groups with 100 patients in each. The number and location of the lesions were documented and clinical types of cutaneous leishmaniasis were noted. The diagnosis was confirmed by skin slit smear and histopathology of the lesional skin. Culture on Nicolle Novy MacNeal (NNN) medium and Leishmanin test was done in all patients. All the patients in both groups were subjected to complete blood picture, urine examination, serum urea and creatinine levels and ECG examination. One group was given itraconazole 100 mg twice daily orally for a duration of 6-8 weeks. The other group was given meglumine antimoniate 10 cc in the form of deep intramuscular injections for 15-30 days. The efficacy of the treatment was judged by clinical and parasitological response. Side effects of the agents were also noted during treatment. Out of 200 patients studied, 185 were males and 15 were females. The mean age of presentation was 30 + 6.6 years. Single lesion was seen in 132 (66%) subjects whereas 68 (34%) subjects had multiple lesions. Slit skin smears were positive in 50 (25%) of the patients. Skin biopsy yielded the presence of LT bodies in 150 (75%) subjects. The culture was positive in 102 (51%) cases. Leishmanin test was positive in 94% subjects. Seventy-five (75%) patients on itraconazole therapy showed complete clinical and parasitological cure in 4-8 weeks duration. A rise in ALT was seen in 12% subjects. Five (5%) subjects did not show any improvement till the end of therapy. Sixty-five (65%) subjects on meglumine antimoniate showed complete healing in 15-30 days. In 35 (35%) of the patients, the treatment had to be stopped due to intolerable side-effects. Four cases of lupoid leishmaniasis and 4 cases of sporotrichoid leishmaniasis

  18. Biodistribution of meglumine antimoniate in healthy and Leishmania (Leishmania infantum chagasi-infected BALB/c mice

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2013-08-01

    Full Text Available Pentavalent antimonials such as meglumine antimoniate (MA are the primary treatments for leishmaniasis, a complex disease caused by protozoan parasites of the genus Leishmania . Despite over 70 years of clinical use, their mechanisms of action, toxicity and pharmacokinetics have not been fully elucidated. Radiotracer studies performed on animals have the potential to play a major role in pharmaceutical development. The aims of this study were to prepare an antimony radiotracer by neutron irradiation of MA and to determine the biodistribution of MA in healthy and Leishmania (Leishmania infantum chagasi-infected mice. MA (Glucantime(r was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes, 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This irradiated compound presented anti-leishmanial activity similar to that of non-irradiated MA in both in vitro and in vivo evaluations. In the biodistribution studies, healthy mice showed higher uptake of antimony in the liver than infected mice and elimination occurred primarily through biliary excretion, with a small proportion of the drug excreted by the kidneys. The serum kinetic curve was bi-exponential, with two compartments: the central compartment and another compartment associated with drug excretion. Radiotracers, which can be easily produced by neutron irradiation, were demonstrated to be an interesting tool for answering several questions regarding antimonial pharmacokinetics and chemotherapy.

  19. Development of an analytical method for antimony speciation in vegetables by HPLC-hydride generation-atomic fluorescence spectrometry.

    Science.gov (United States)

    Olivares, David; Bravo, Manuel; Feldmann, Jorg; Raab, Andrea; Neaman, Alexander; Quiroz, Waldo

    2012-01-01

    A new method for antimony speciation in terrestrial edible vegetables (spinach, onions, and carrots) was developed using HPLC with hydride generation-atomic fluorescence spectrometry. Mechanical agitation and ultrasound were tested as extraction techniques. Different extraction reagents were evaluated and optimal conditions were determined using experimental design methodology, where EDTA (10 mmol/L, pH 2.5) was selected because this chelate solution produced the highest extraction yield and exhibited the best compatibility with the mobile phase. The results demonstrated that EDTA prevents oxidation of Sb(III) to Sb(V) and maintains the stability of antimony species during the entire analytical process. The LOD and precision (RSD values obtained) for Sb(V), Sb(III), and trimethyl Sb(V) were 0.08, 0.07, and 0.9 microg/L and 5.0, 5.2, and 4.7%, respectively, for a 100 microL sample volume. The application of this method to real samples allowed extraction of 50% of total antimony content from spinach, while antimony extracted from carrots and onion samples ranged between 50 and 60 and 54 and 70%, respectively. Only Sb(V) was detected in three roots (onion and spinach) that represented 60-70% of the total antimony in the extracts. PMID:22970588

  20. 7 CFR 58.138 - Quality testing of milk from new producers.

    Science.gov (United States)

    2010-01-01

    ... Service 1 Quality Specifications for Raw Milk § 58.138 Quality testing of milk from new producers. A quality examination and tests shall be made on the first shipment of milk from a producer shipping milk to... 7 Agriculture 3 2010-01-01 2010-01-01 false Quality testing of milk from new producers....

  1. Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

  2. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from disease Nile tilapia

    Science.gov (United States)

    The complete genome of a virulent Streptococcus agalactiae strain 138P is 1838701 bp in size, containing 1831 genes. The genome has 1593 coding sequences, 152 pseudo genes, 16 rRNAs, 69 tRNAs, and 1 non-coding RNA. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipel...

  3. Anti-human CD138 monoclonal antibodies and their bispecific formats: generation and characterization.

    Science.gov (United States)

    Chen, Dan; Zou, Jianxuan; Zong, Yunhui; Meng, Huimin; An, Gangli; Yang, Lin

    2016-06-01

    Syndecan-1 (CD138), a heparan sulfate proteoglycan, acts as a co-receptor for growth factors and chemokines and is a molecular marker associated with the epithelial-mesenchymal transition during development and carcinogenesis. In this study, we generated two specific mouse anti-human CD138 monoclonal antibodies (mAbs, clone ID: 480CT5.4.3, 587CT7.3.6.5) using hybridoma technology and identified their immunological characteristics. After hybridoma sequencing, the single-chain variable fragments (ScFvs) cloned from two hybridoma cells were combined with anti-CD3 OKT-3 ScFv to generate two recombinant bispecific antibodies (h-STL002, m-STL002) against CD138 and CD3 molecules, respectively. The bispecific antibodies were able to specifically target CD138 + multiple myeloma (MM) cells and CD3 + T cells, and showed the potent cytotoxicity against MM RPMI-8226 cell line through T cell activation. However, these bispecific antibodies without T cells did not cause toxic side effect on MM cells. Overall, the two hybridoma clones and their bispecific formats have great potential to promote diagnosis and immunotherapy of plasma cell malignancy. PMID:26954291

  4. A138

    Directory of Open Access Journals (Sweden)

    K. Yurchenko

    2015-11-01

    Thus, results suggest that vascular disruption in the NDV-treated group indicates the virus ability to directly or indirectly affect tumor angiogenesis and regulate tissue trophism in that way. Understanding how and in which step this effect occurs may provide capacity to use oncolytic NDV strains for therapeutic benefit.

  5. Leachability of antimony from energy ashes. Total contents, leachability and remedial suggestions; Lakning av antimon fraan energiaskor. Totalhalter, lakbarhet samt foerslag till aatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Baeckstroem, Mattias [Oerebro Univ. (Sweden)

    2006-01-15

    In the current project total concentrations for antimony in 31 energy ashes have been compiled. The average concentration of antimony in boiler fly ash and grate boiler fly ash is 192 and 1,140 mg/kg, respectively. The corresponding antimony concentrations for boiler ashes and grate bottom ashes are 86,5 and 61,8 mg/kg, respectively. Multivariate calculations clearly pointed out waste as the major source for antimony in ashes. The difference between total antimony concentration in fly ash and bottom ash is greatest for grate boilers, in average 18 times higher in the fly ash. The difference for CFB/BFB-boilers is only slightly more than 2. However, based on amount, 75% of the total antimony inventory is recovered in the fly ashes for both CFB/BFB and grate boilers. Eleven (eight of which were bottom ashes) out of the 31 samples exceeded the guidelines for inert waste. It is clear that the higher ionic strength in the solutions from the fly ashes contribute to decrease the solubility for critical minerals retaining antimony. In addition, the fly ashes have considerably larger effective surface able to sorb trace elements. A clear and positive covariance was discovered between aluminium and antimony. Furthermore, it was noted that antimony showed no typical anionic behaviour despite the fact that it according to the geochemical calculations should be present as SbO{sub 3}{sup -}. At L/S 10, a maximum of 1% of the total antimony concentration is leached. This should be compared to chloride that had 94% of the total concentration leached at L/S 10. There was no correlation between the leached antimony concentrations and the total antimony concentrations. The sequential extractions also suggest a low leachability for antimony from the ashes. In average only 9,6% is released at pH 7, 7,3% at pH 5, 3,6% during reducing conditions and 3,2% during oxidising conditions. In total, only 24% of the total antimony concentrations is released during the four extraction steps. The

  6. Selective liquid-liquid extraction of antimony(III from hydrochloric acid media by N-n-octylaniline in xylene

    Directory of Open Access Journals (Sweden)

    M. A. ANUSE

    2004-04-01

    Full Text Available N-n-Octylaniline in xylene was used for the extraction separation of antimony(III from hydrochloric acid media. Antimony(III was extracted quantitatively with 10 mL 4 % N-n-octylaniline in xylene. It was stripped from the organic phase with 0.5 M ammonia and estimated photometrically by the iodide method. The effect of metal ion, acid, reagent concentration and various foreign ions was investigated. The method affords binary and ternary separation of antimony(III from tellurium(IV, selenium(IV, lead(II, bismuth(III, tin(IV, germanium(IV, copper(II, gold(III, iron(III and zinc(II. The method is applicable for the analysis of synthetic mixtures, alloys and semiconductor thin films. It is fast, accurate and precise.

  7. Synthesis, characterization and single crystal X-ray analysis of chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III

    Directory of Open Access Journals (Sweden)

    H.P.S. Chauhan

    2015-07-01

    Full Text Available The title compound chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III has been prepared in distilled acetonitrile and characterized by physicochemical [melting point and molecular weight determination, elemental analysis (C, H, N, S & Sb], spectral [FT–IR, far IR, NMR (1H & 13C] studies. The crystal and molecular structure was further confirmed using single crystal X-ray diffraction analysis which features a five-coordinate geometry for antimony(III within a ClS4 donor set. The distortion in the co-planarity of ClSbS3 evidences the stereochemical influence exerts by the lone pair of electrons on antimony(III. Two centrosymmetrically related molecule held together via C–H···Cl secondary interaction result in molecular aggregation of the compound.

  8. Pharmacokinetics and tissue distribution of Antimony after multiple intramuscular administrations in the Hamster

    International Nuclear Information System (INIS)

    The fate of pentavalent antimony (Sb) in different tissues in the body after intramuscular administration is of great interest for the future study of Sb therapy in different sitting. Pharmacokinetics and tissue distribution of antimony (Sb) were studied in the hamster after daily dose of sodium stibogluconate equivalent to 120 mg kg of Sb, administered intramuscularly for two weeks. Liver, spleen, heart, kidney and skin tissues were isolated after blood collection at the specified time. Antimony was measured in these tissues after suitable treatment, ashing and processing, by flame less atomic absorption spectrophotometry. The concentration of Sb time profile in blood showed a linear raid decline with elimination half life (tz1/2) of 1.7h. The concentration of drug (ug/gm) declined in a biphasic manner from almost all tissues. However, the concentrations of Sb were declined in slower fashion from the hamster tissues than from the blood. The maximum concentration of Sb was determined in the kidney tissues (3416+-631ug/gm) while the lowest concentration was in the spleen (209+-187ug/gm). The maximum concentration of Sb in the kidney (ug/gm) was more than 25 fold higher than that measured from blood (ug/ml). The AUC of Sb in the studied tissues was in this rank: kidney>liver>skin>spleen>heart>blood. Surprisingly, the heart, spleen and liver showed a similar t1/2 of 5.2-6.2h while the kidney and skin had a t1/2 of about 3h. Therefore, disposition of Sb seems to kinetically follow multicompartmental compartmental model. The kidneys got the highest concentration of drug which may lead to nephrotoxicity on long term therapy. (author)

  9. Lithium-antimony-lead liquid metal battery for grid-level energy storage

    Science.gov (United States)

    Wang, Kangli; Jiang, Kai; Chung, Brice; Ouchi, Takanari; Burke, Paul J.; Boysen, Dane A.; Bradwell, David J.; Kim, Hojong; Muecke, Ulrich; Sadoway, Donald R.

    2014-10-01

    The ability to store energy on the electric grid would greatly improve its efficiency and reliability while enabling the integration of intermittent renewable energy technologies (such as wind and solar) into baseload supply. Batteries have long been considered strong candidate solutions owing to their small spatial footprint, mechanical simplicity and flexibility in siting. However, the barrier to widespread adoption of batteries is their high cost. Here we describe a lithium-antimony-lead liquid metal battery that potentially meets the performance specifications for stationary energy storage applications. This Li||Sb-Pb battery comprises a liquid lithium negative electrode, a molten salt electrolyte, and a liquid antimony-lead alloy positive electrode, which self-segregate by density into three distinct layers owing to the immiscibility of the contiguous salt and metal phases. The all-liquid construction confers the advantages of higher current density, longer cycle life and simpler manufacturing of large-scale storage systems (because no membranes or separators are involved) relative to those of conventional batteries. At charge-discharge current densities of 275 milliamperes per square centimetre, the cells cycled at 450 degrees Celsius with 98 per cent Coulombic efficiency and 73 per cent round-trip energy efficiency. To provide evidence of their high power capability, the cells were discharged and charged at current densities as high as 1,000 milliamperes per square centimetre. Measured capacity loss after operation for 1,800 hours (more than 450 charge-discharge cycles at 100 per cent depth of discharge) projects retention of over 85 per cent of initial capacity after ten years of daily cycling. Our results demonstrate that alloying a high-melting-point, high-voltage metal (antimony) with a low-melting-point, low-cost metal (lead) advantageously decreases the operating temperature while maintaining a high cell voltage. Apart from the fact that this finding

  10. Development and pharmacokinetic of antimony encapsulated in liposomes of phosphatidylserine using radioisotopes in experimental leishmaniasis

    International Nuclear Information System (INIS)

    Leishmaniasis are a complex of parasitic diseases caused by intra macrophage protozoa of the genus Leishmania, and is fatal if left untreated. Pentavalent antimonials, though toxic and their mechanism of action being unclear, remain the first-line drugs for treatment. Effective therapy could be achieved by delivering antileishmanial drugs to these sites of infection. Liposomes are phospholipid vesicles that promote improvement in the efficacy and action of drugs in target cell. Liposomes are taken up by the cells of mononuclear phagocytic system (MPS). The purpose of this study was to develop a preparation of meglumine antimonate encapsulated in liposomes of phosphatidylserine and to study its pharmacokinetic in healthy mice to establish its metabolism and distribution. Quantitative analysis of antimony from liposomes demonstrated that Neutron Activation Analysis was the most sensitive technique with almost 100 % of accuracy. All liposome formulations presented a mean diameter size of 150 nm. The determination of IC50 in infected macrophage showed that liposome formulations were between 10 - 63 fold more effective than the free drug, indicating higher selectivity index. By fluorescence microscopy, an increased uptake of fluorescent-liposomes was seen in infected macrophages during short times of incubation compared with non-infected macrophages. Biodistribution studies showed that meglumine antimonate irradiated encapsulated in liposomes of phosphatidylserine promoted a targeting of antimony for MPS tissues and maintained high doses in organs for a prolonged period. In conclusion, these data suggest that meglumine antimonate encapsulated in liposomes showed higher effectiveness than the non-liposomal drug against Leishmania infection. The development of liposome formulations should be a new alternative for the chemotherapy of infection diseases, especially Leishmaniasis, as they are used to sustain and target pharmaceuticals to the local of infection. (author)

  11. The LABCG2 Transporter from the Protozoan Parasite Leishmania Is Involved in Antimony Resistance.

    Science.gov (United States)

    Perea, Ana; Manzano, José Ignacio; Castanys, Santiago; Gamarro, Francisco

    2016-06-01

    Treatment for leishmaniasis, which is caused by Leishmania protozoan parasites, currently relies on a reduced arsenal of drugs. However, the significant increase in the incidence of drug therapeutic failure and the growing resistance to first-line drugs like antimonials in some areas of Northern India and Nepal limit the control of this parasitic disease. Understanding the molecular mechanisms of resistance in Leishmania is now a matter of urgency to optimize drugs used and to identify novel drug targets to block or reverse resistant mechanisms. Some members of the family of ATP-binding cassette (ABC) transporters in Leishmania have been associated with drug resistance. In this study, we have focused our interest to characterize LABCG2's involvement in drug resistance in Leishmania. Leishmania major parasites overexpressing the ABC protein transporter LABCG2 were generated in order to assess how LABCG2 is involved in drug resistance. Assays of susceptibility to different leishmanicidal agents were carried out. Analysis of the drug resistance profile revealed that Leishmania parasites overexpressing LABCG2 were resistant to antimony, as they demonstrated a reduced accumulation of Sb(III) due to an increase in drug efflux. Additionally, LABCG2 was able to transport thiols in the presence of Sb(III) Biotinylation assays using parasites expressing LABCG2 fused with an N-terminal green fluorescent protein tag revealed that LABCG2 is partially localized in the plasma membrane; this supports data from previous studies which suggested that LABCG2 is localized in intracellular vesicles that fuse with the plasma membrane during exocytosis. In conclusion, Leishmania LABCG2 probably confers antimony resistance by sequestering metal-thiol conjugates within vesicles and through further exocytosis by means of the parasite's flagellar pocket. PMID:27021316

  12. Antimony film sensor for sensitive rare earth metal analysis in environmental samples.

    Science.gov (United States)

    Makombe, Martin; van der Horst, Charlton; Silwana, Bongiwe; Iwuoha, Emmanuel; Somerset, Vernon

    2016-07-01

    A sensor for the adsorptive stripping voltammetric determination of rare earth elements has been developed. The electrochemical procedure is based on the oxidation of the rare earth elements complexed with alizarin complexone at a glassy carbon electrode that was in situ modified with an antimony film, during an anodic scan from -0.2 V to 1.1 V (vs. Ag/AgCl) and deposition potential of -0.1 V (vs. Ag/AgCl). The factors influencing the adsorptive stripping capability were optimised, including the complexing agent concentration, plating concentration of antimony and deposition time. The detection of rare earth elements (La, Ce and Pr) were realised in 0.08 M sodium acetate (pH = 5.8) solution as supporting electrolyte, with 2 × 10(-6) M alizarin complexone and 1.0 mg L(-1) antimony solution. Under the optimised conditions, a deposition time of 360 s was obtained and a linear response was observed between 1 and 25 µg L(-1). The reproducibility of the voltammetric measurements was found to be within 5.0% RSD for 12 replicate measurements of cerium(III) concentration of 5 µg L(-1) using the same electrode surface. The detection limits obtained using stripping analysis was 0.06, 0.42 and 0.71 μg L(-1) for Ce(III), La(III) and Pr(III), respectively. The developed sensor has been successfully applied for the determination of cerium, lanthanum and praseodymium in municipal tap water samples. PMID:27065049

  13. Determination of PM10 deposition based on antimony flux to selected urban surfaces

    International Nuclear Information System (INIS)

    Deposition of PM10 particles to several types of urban surfaces was investigated within this study. Antimony was chosen as a tracer element to calculate dry deposition velocities for PM10, since antimony proved to be present almost exclusively in PM10 particles in ambient urban air. During 18 months, eight sampling sites in Berlin and Karlsruhe, two cities in Germany, were operated. PM10 concentrations and dry deposition were routinely sampled as two week averages. Additionally, leaf-samples were collected at three sites with tall vegetation. The obtained deposition velocities ranged from 0.8 to 1.3 cm s-1 at roadside sites and from 0.4 to 0.5 cm s-1 at the other sites. With reference to the whole canopy, additional deposition velocities of about 0.5 cm s-1 were obtained for leaf surfaces. As a consequence, it can be concluded that vegetation-covered areas beside streets show the highest potential to capture particles in urban areas. - Highlights: → Deposition velocities of PM10 were determined using Sb as a tracer element. → Dry PM10 deposition velocities ranged from 0.8 to 1.3 cm s-1 at roadside sites. → Dry PM10 deposition velocities ranged from 0.4 to 0.5 cm s-1 at other urban sites. → Additional deposition velocities of 0.5 cm s-1 were obtained for leaf surfaces. - Antimony is used as a tracer element to calculate dry deposition velocities of PM10 particles to selected urban surfaces.

  14. 突发性聋138例诊治体会%Diagnosis and treatment of sudden deafness in 138 cases

    Institute of Scientific and Technical Information of China (English)

    张立群; 于丽; 张虎

    2003-01-01

    目的:探讨突发性聋的病因、治疗及预后.方法:分析138例突发性聋的临床资料.结果:138例中经综合治疗有效108例,其中治愈38例,显效44例,有效26例,总有效率为75%,108例中发病时间在1周内65例,占60%,40岁以下36例(男22例),占60%.结论:突发性聋的病因为病毒感染或内耳供血障碍或圆窗膜破裂等,宜采取综合治疗,预后与初诊听阈、年龄、性别、病程、有无眩晕、高低频音听阈差有关.

  15. Separation of antimony from synthetic cloth. Application in forensic science using neutron activation analysis

    International Nuclear Information System (INIS)

    A simple ion-exchange separation procedure was developed for selective removal of antimony from synthetic cloth to facilitate determination of several trace elements frequently used to identify gunshot residues by neutron activation analysis. Radiotracers of Sb, Ba, Cu, Co, As, Zn, Hg and Ag were employed to optimize the developed procedure. The method involves the quantitative retention of the above elements, except of Sb, from 0.2M ammonium carbonate solution using Chelex 100 resin and subsequent quantitative elution of the elements of interest with 2M nitric acid for gamma-ray spectrometry. The procedure was tested by simulated gunshot residues. (author)

  16. Investigation of adsorption interaction of cadmium oxide with antimony (3) in alkaline solutions

    International Nuclear Information System (INIS)

    Adsorption processes on cadmium oxide in pure antimonite alkaline (KOH) solutions and in the presence of organic additions (sodium salt of carboxymethylcellulose, straw oil) have been studied. It is shown, that in the systems being studied, the chemosorptional interaction, leading to a sharp change in the adsorbent surface state is observed. It is established that the formation of a surface high-disperse cadmium oxide-antimony com ound on the cadmium oxide results in practically complete suppression of the cadmium oxide hydration process in aqueous solutions

  17. Polymorphism and properties of Bi{sub 2}WO{sub 6} doped with pentavalent antimony

    Energy Technology Data Exchange (ETDEWEB)

    Kharitonova, E.P.; Belov, D.A. [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Gagor, A.B.; Pietraszko, A.P. [W. Trzebiatowski Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Okólna 2, 50-950 Wrocław (Poland); Alekseeva, O.A. [Shubnikov Institute of Crystallography, Russian Academy of Sciences, Leninsky pr. 59, 119333 Moscow (Russian Federation); Voronkova, V.I., E-mail: voronk@polly.phys.msu.ru [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation)

    2014-04-05

    Highlights: • The limit of Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions is at x = 0.05. • Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} does not fully transform into high-temperature monoclinic phase. • Sb{sup 5+} has a weak effect on the temperatures of the ferroelectric transitions. • γ→γ{sup ‴} transition near 650 °C was observed as strong permittivity peak at 0.01–8 Hz. • The conductivity of Bi{sub 2}W{sub 0.96}Sb{sub 0.04}O{sub 6−y} at 800 °C reaches 0.02 S/cm. -- Abstract: Antimony-containing solid solutions isostructural with bismuth tungstate, Bi{sub 2}WO{sub 6}, have been prepared in air as polycrystalline samples by solid-state reactions and as single crystals by unseeded flux growth. The antimony in the solid solutions is in a pentavalent state and substitutes for tungsten in the structure of Bi{sub 2}WO{sub 6}. The Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions have been shown to exist in the composition range 0 ⩽ x ⩽ 0.05. We have examined the effect of Sb{sup 5+} doping on the polymorphism and properties of Bi{sub 2}WO{sub 6}. In contrast to undoped Bi{sub 2}WO{sub 6}, antimony-substituted bismuth tungstate does not completely transform into its high-temperature, monoclinic phase at 960 °C and remains two-phase up to temperatures approaching its melting point. Antimony substitution for tungsten has a weak effect on the temperatures of the ferroelectric phase transitions. Heterovalent substitution of Sb{sup 5+} for W{sup 6+} is accompanied by the formation of extra oxygen vacancies and an increase in the electrical conductivity of the solid solutions by one to two orders of magnitude relative to undoped Bi{sub 2}WO{sub 6}.

  18. Influence of arsenic,antimony and cobalt impurities on the cathodic process in zinc electrowinning

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    By means of an electrochemical study,the influence of arsenic,antimony and cobalt on cathodic polarization in the zinc electrowinning process,the associated kinetic equations and parameters,and the polarization mechanism have been studied.The results show that the experimental values of the kinetic parameters are in accord with the theoretical values in the ZnSO4/H2SO4 solution with a single impurity is added.In contrast,the charge transfer coefficient α is smaller than the theoretical value in the ZnSO4/H2SO4 solution when the three impurities are added together.

  19. Determination of arsenic, selenium and antimony by neutron activation analysis. Application to hair samples

    International Nuclear Information System (INIS)

    A fast rabbit system for instrumental activation analysis with reactor neutrons is described. Its use in the determination of selenium in hair is discussed. A survey is given of the correction factors which are inherent to the use of short-lived radionuclides. An alternative to INAA is NAA based on the separation of arsenic, selenium and antimony by hydride evaporation and adsorption to active carbon. Data for some Standard Reference Materials are given. This work was done under research contract 2440/RI/RB with the IAEA

  20. Impact of Biofield Treatment on Physical, Structural and Spectral Properties of Antimony Sulfide

    OpenAIRE

    Trivedi, Mahendra Kumar

    2015-01-01

    Antimony sulfide (Sb2S3) has gained extensive attention in solar cells due to their potential as a low-cost and earth abundant absorber material. In solar cell absorber, the optoelectrical properties such as energy band gap and absorption coefficient of Sb2S3play an important role, which have strong relationships with their crystal structure, lattice parameter and crystallite size. Hence in the present investigation, Sb2S3 powder samples were exposed to biofield treatment, and furthe...

  1. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Science.gov (United States)

    Liu, Zhimeng; Zhu, Mengfu; Wang, Zheng; Wang, Hong; Deng, Cheng; Li, Kui

    2016-05-01

    A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2)/carbon aerogel (CA) for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  2. Electromagnetic absorption and shielding behavior of polyaniline-antimony oxide composites

    Science.gov (United States)

    Faisal, Muhammad; Khasim, Syed

    2013-02-01

    This work highlights the microwave absorption and electromagnetic interference (EMI) shielding properties of synthesized polyaniline (PAni)-antimony oxide (Sb2O3) composites in the 8-12 GHz (X-band) range. These composites showed absorption dominated EMI shielding effectiveness (EMI SEA) of -34 to -40 dB (> 99 % attenuation), indicating their shielding potential throughout the X-band. Our analyses reveal that the Sb2O3 particles in PAni matrix have key impact in determining the microwave absorption properties of the composites.

  3. MicroRNA-138 is a potential regulator of memory performance in humans

    Directory of Open Access Journals (Sweden)

    Julia eSchröder

    2014-07-01

    Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

  4. Study of 138La radioactive decays using LaBr3 scintillators

    International Nuclear Information System (INIS)

    We present a detailed investigation of the intrinsic activity of LaBr3 scintillators from the natural abundance of radioactive isotope 138La. Compared to earlier studies of lanthanum halides intrinsic activity, we gained a sharper insight by using samples of different sizes, ranging from 0.16 cm3 to 347 cm3, and by applying in our recent analysis results on the non-proportionality of scintillation response. In addition, we took advantage of the fact that LaBr3 spectrometers offer a unique opportunity, never available before, to study the characteristics of the 138La electron capture and β radioactive decays that are 2nd order unique forbidden transitions. The observed shape of the β continuum, measured down to the energy of 2 keV, is found to be different than expected from standard nuclear theory, indicating a possible underestimation of the screening effect for β energies below 75 keV.

  5. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    DEFF Research Database (Denmark)

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.;

    2006-01-01

    The nef gene from HIV-1 has been shown to be an important pathogenic factor when considering development of AIDS. Detection of nef variants with an effect on immune modulation is important to understand HIV-1 pathogenesis and has possible impact on treatment strategies. METHODS: The nef gene of HIV...... an insight into the LTNP disease profile and allowing for the stratification of patients based on their CD4 cell decline. RESULTS: In sequences from nine patients, most of the functional domains of HIV-1 Nef appeared intact, and no major deletions were observed to possibly account for an effect on...... the delayed disease status. However, the results demonstrate a high incidence of a single amino acid polymorphism (cysteine 138) in HIV-1 Nef. The allelic frequency of cysteine 138 between the delayed disease progression group and the progressor group was found to be statistically significant (P = 0...

  6. Effect of antimony incorporation on structural properties of CuInS{sub 2} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Ben Rabeh, M., E-mail: mohamedbenrabeh@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Chaglabou, N., E-mail: nadia_chaglabou@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Kanzari, M., E-mail: Mounir.Kanzari@ipeit.rnu.t [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia)

    2010-02-15

    CuInS{sub 2} (CIS) single crystals doped with 1, 2, 3 and 4 atomic percent (at.%) of antimony (Sb) were grown by the horizontal Bridgman method. The effect of Sb doping on the structural properties of CIS crystal was studied by means of X-ray diffraction (XRD), energy dispersive X-ray analysis (EDAX), scanning electron microscopy (SEM) and PL measurements. X-ray diffraction data suggests that the doping of Sb in the CIS single crystals does not affect the tetragonal (chalcopyrite) crystal structure and exhibited a (1 1 2) preferred orientation. In addition, with increasing Sb concentration, the X-ray diffraction analysis show that Sb doped CIS crystals are more crystallized and the diffraction peaks of the CuInS{sub 2} phase were more pronounced in particular the (1 1 2) plane. EDAX study revealed that Sb atoms can occupy the indium site and/or occupying the sulfur site to make an acceptor. PL spectra of undoped and Sb doped CIS crystals show two emission peaks at 1.52 and 1.62 eV, respectively which decreased with increasing atomic percent antimony. Sb doped CIS crystals show p-type conductivity.

  7. Understanding the radiolabelling mechanism of {sup 99m}Tc-antimony sulphide colloid

    Energy Technology Data Exchange (ETDEWEB)

    Tsopelas, Chris E-mail: ctsopela@mail.rah.sa.gov.au

    2003-12-01

    The chemistry of antimony trisulphide colloid (ATC) was examined to elucidate the radiolabelling mechanism with {sup 99m}TcO{sub 4}{sup -}. Ion exchange chromatography and atomic absorption spectrophotometry techniques determined ATC to be resistant to hydrolysis in 0.1 M hydrochloric acid (HCl) at 25 deg. C or 100 deg. C (>97% recovery, Sb{sup 3+} absent). Hydrogen sulphide gas detected did not participate in the mechanism, where antimony trisulphide and {sup 99m}TcO{sub 4}{sup -} in HCl/100 deg. C yielded 96% {sup 99m}Tc-product from a K{sub 2}S-free formulation (versus 98% when K{sub 2}S was present). {sup 99m}TcO{sub 4}{sup -} was reduced >90% by DMSA or dithiothreitol under the same conditions, identifying involvement of thiol groups. Infrared analysis of Re-ATC showed S-O bonds, indicating excess thiol groups at the colloid surface were oxidised at the expense of {sup 99m}TcO{sub 4}{sup -} reduction.

  8. A Black Phosphate Conversion Coating on Steel Surface Using Antimony(III)-Tartrate as an Additive

    Science.gov (United States)

    Li, Feng; Wang, Guiping

    2016-05-01

    A novel black phosphate conversion coating was formed on steel surface through a Zn-Mn phosphating bath containing mainly ZnO, H3PO4, Mn(H2PO4)2, and Ca(NO3)2, where antimony(III)-tartrate was used as the blackening agent of phosphatization. The surface morphology and composition of the coating were characterized by scanning electron microscopy, energy dispersion spectroscopy, and x-ray photoelectron spectroscopy. Corrosion resistance of the coating was studied by potentiodynamic polarization curves and electrochemical impedance spectroscopy. The pH value of the solution had significant influence on the formation and corrosion resistance of the coating. The experimental results indicated that the Sb plays a vital role in the blackening of phosphate conversion coating. The optimal concentration of antimony(III)-tartrate in the phosphating bath used in this experiment was 1.0 g L-1, as higher values reduced the corrosion resistance of the coating. In addition, by saponification and oil seals, the corrosion duration of the black phosphate coating in a copper sulfate spot test can be as long as 20 min.

  9. Effect of electronic contribution on temperature-dependent thermal transport of antimony telluride thin film

    International Nuclear Information System (INIS)

    Highlights: • We investigated thermal transport of the antimony telluride thin films. • The contribution of the electronic thermal conductivity increased up to ∼77% at 300 K. • We theoretically analyze and explain the high contribution of electronic component. - Abstract: We study the theoretical and experimental characteristics of thermal transport of 100 nm and 500 nm-thick antimony telluride (Sb2Te3) thin films prepared by radio frequency magnetron sputtering. The thermal conductivity was measured at temperatures ranging from 20 to 300 K, using four-point-probe 3-ω method. Out-of-plane thermal conductivity of the Sb2Te3 thin film was much lesser in comparison to the bulk material in the entire temperature range, confirming that the phonon- and electron-boundary scattering are enhanced in thin films. Moreover, we found that the contribution of the electronic thermal conductivity (κe) in total thermal conductivity (κ) linearly increased up to ∼77% at 300 K with increasing temperature. We theoretically analyze and explain the high contribution of electronic component of thermal conductivity towards the total thermal conductivity of the film by a modified Callaway model. Further, we find the theoretical model predictions to correspond well with the experimental results

  10. Antimony retention and release from drained and waterlogged shooting range soil under field conditions.

    Science.gov (United States)

    Hockmann, Kerstin; Tandy, Susan; Lenz, Markus; Reiser, René; Conesa, Héctor M; Keller, Martin; Studer, Björn; Schulin, Rainer

    2015-09-01

    Many soils polluted by antimony (Sb) are subject to fluctuating waterlogging conditions; yet, little is known about how these affect the mobility of this toxic element under field conditions. Here, we compared Sb leaching from a calcareous shooting range soil under drained and waterlogged conditions using four large outdoor lysimeters. After monitoring the leachate samples taken at bi-weekly intervals for >1.5 years under drained conditions, two of the lysimeters were subjected to waterlogging with a water table fluctuating according to natural rainfall water infiltration. Antimony leachate concentrations under drained conditions showed a strong seasonal fluctuation between 110 μg L(-1) in summer and soil solution indicated that this decrease in Sb(V) concentrations was attributable to the reduction of Sb(V) to Sb(III) and the stronger sorption affinity of the latter to iron (Fe) (hydr)oxide phases. Our results demonstrate the importance of considering seasonal and waterlogging effects in the assessment of the risks from Sb-contaminated sites. PMID:25592464

  11. Phase effects on chemical behaviors of tin, antimony and tellurium fission products in aqueous solutions

    International Nuclear Information System (INIS)

    The oxidation states of tin, antimony and tellurium isotopes formed predominantly (>91%) by fission were investigated in aqueous solutions of 233U irradiated in a reactor. Results were corrected for the thermal reactions with the bulk radiolysis products using tracers for each element. In 0.4 M H2SO4 solutions containing 4.3 mM 233UO22+, 1.5 mM Te(IV) and 1.5 mM Te(VI), the fraction of Te(IV) is 98 +- 2% in the absence of oxygen and 92 +- 3% in the presence of oxygen. In frozen solutions of the same composition, the fraction of Te(IV) is 83 +- 2% in the absence of oxygen and 81 +- 3% in the presence of oxygen. Similar differences are also found in the case of the antimony isotopes in 0.4 M H2SO4 solutions and the tin isotopes in 1 M HCl solutions. For the interpretation of the differences, the reducing action of the species diffusing from the track of the fission fragments is considered. (author)

  12. Effect of indium and antimony doping in SnS single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Chaki, Sunil H., E-mail: sunilchaki@yahoo.co.in; Chaudhary, Mahesh D.; Deshpande, M.P.

    2015-03-15

    Highlights: • Single crystals growth of pure SnS, indium doped SnS and antimony doped SnS by direct vapour transport (DVT) technique. • Doping of In and Sb occurred in SnS single crystals by cation replacement. • The replacement mechanism ascertained by EDAX, XRD and substantiated by Raman spectra analysis. • Dopants concentration affects the optical energy bandgap. • Doping influences electrical transport properties. - Abstract: Single crystals of pure SnS, indium (In) doped SnS and antimony (Sb) doped SnS were grown by direct vapour transport (DVT) technique. Two doping concentrations of 5% and 15% each were employed for both In and Sb dopants. Thus in total five samples were studied viz., pure SnS (S1), 5% In doped SnS (S2), 15% In doped SnS (S3), 5% Sb doped SnS (S4) and 15% Sb doped SnS (S5). The grown single crystal samples were characterized by evaluating their surface microstructure, stoichiometric composition, crystal structure, Raman spectroscopy, optical and electrical transport properties using appropriate techniques. The d.c. electrical resistivity and thermoelectric power variations with temperature showed semiconducting and p-type nature of the as-grown single crystal samples. The room temperature Hall Effect measurements further substantiated the semiconducting and p-type nature of the as-grown single crystal samples. The obtained results are deliberated in detail.

  13. The analysis of antimony species by using ESI-MS and HPLC-ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Lintschinger, J.; Schramel, O.; Kettrup, A. [GSF-Forschungszentrum fuer Umwelt und Gesundheit GmbH, Institut fuer Oekologische Chemie, Ingolstaedter Landstrasse 1, Gebaeude 22, D-85758 Neuherberg (Germany)

    1998-05-01

    A new method for the separation of organic antimony as trimethylantimony dichloride (TMSbCl{sub 2}) and inorganic Sb(V) and Sb(III) by using anion exchange high-performance liquid chromatography coupled with inductively-coupled plasma mass spectrometry (ICP-MS) is presented. In comparison with previous work the detection limits for both species were significantly decreased, down to 5 ngL{sup -1}, mainly by avoiding any contamination from the chromatographic device. Using an ultrasonic nebulizer (USN) improved the detection limits for inorganic Sb species, but was useless for the HPLC method due to problems in the recovery of the TMSbCl{sub 2}. Matrix interferences of the chromatographic determination were studied in detail and the method was applied to environmental samples assumed to contain organic antimony species. Additionally, the molecular structure of the TMSbCl{sub 2} in solution was studied by using electrospray-ionization mass spectrometry (ESI-MS) showing that this species occurs most probably as [TMSbOH]{sup +} in aqueous solutions. (orig.) With 7 figs., 2 tabs., 14 refs.

  14. Migration of antimony from PET containers into regulated EU food simulants.

    Science.gov (United States)

    Sánchez-Martínez, María; Pérez-Corona, Teresa; Cámara, Carmen; Madrid, Yolanda

    2013-11-15

    Antimony migration from polyethylene terephthalate (PET) containers into aqueous (distilled water, 3% acetic acid, 10% and 20% ethanol) and fatty food simulants (vegetable oil), as well as into vinegar, was studied. Test conditions were according to the recent European Regulation 10/2011 (EU, 2011). Sb migration was assayed by ICP-MS and HG-AFS. The results showed that Sb migration values ranged from 0.5 to 1.2μg Sb/l, which are far below the maximum permissible migration value for Sb, 40μg Sb/kg, (EU, Regulation 10/2011). Parameters as temperature and bottle re-use influence were studied. To assess toxicity, antimony speciation was performed by HPLC-ICP-MS and HG-AFS. While Sb(V) was the only species detected in aqueous simulants, an additional species (Sb-acetate complex) was measured in wine vinegar. Unlike most of the studies reported in the literature, migration tests were based on the application of the EU directive, which enables comparison and harmonisation of results. PMID:23790852

  15. Evaluation of antimony microparticles supported on biochar for application in the voltammetric determination of paraquat.

    Science.gov (United States)

    Gevaerd, Ava; de Oliveira, Paulo R; Mangrich, Antonio S; Bergamini, Márcio F; Marcolino-Junior, Luiz H

    2016-05-01

    This work describes the construction and application of carbon paste electrodes modified with biochar and antimony microparticles (SbBCPE) for voltammetric determination of paraquat using a simple and sensitive procedure based on voltammetric stripping analysis. Some parameters such as amount of biochar and antimony used in the composition of the carbon paste and instrumental parameters were examined in detail. Under optimized conditions, an analytical curve was obtained for paraquat determination employing SbBCPE, which showed a linear response ranging from 0.2 to 2.9μmolL(-1), with limit of detection and quantification of 34nmolL(-1) and 113nmolL(-1), respectively, after paraquat pre-concentration of 120s. The repeatability study presented a RSD=2.0% for 10 consecutive measurements using the same electrode surface and the reproducibility study showed a RSD=2.7% for measurements with 10 different electrode surfaces. The proposed sensor was successfully applied for paraquat determination in tap water and citric fruit juice spiked samples and good recoveries were obtained without any sample pre-treatment, showing its promising analytical performance. PMID:26952405

  16. High levels of antimony in dust from e-waste recycling in southeastern China

    International Nuclear Information System (INIS)

    Environmental contamination due to uncontrolled e-waste recycling is an emerging global issue. Antimony (Sb) is a toxic element used in semiconductor components and flame retardants for circuit board within electronic equipment. When e-waste is recycled, Sb is released and contaminates the surrounding environment; however, few studies have characterized the extent of this problem. In this study, we investigated Sb and arsenic (As) distributions in indoor dust from 13 e-waste recycling villages in Guiyu, Guangdong Province, southeastern China. Results revealed significantly elevated concentrations of Sb (6.1-232 mg/kg) in dust within all villages, which were 3.9-147 times higher than those from the non e-waste sites, indicating e-waste recycling was an important source of Sb pollution. On the contrary, As concentrations (5.4-17.7 mg/kg) in e-waste dusts were similar to reference values from the control sites. Therefore, dusts emitted from e-waste recycling may be characterized by high Sb/As ratios, which may help identify the contamination due to the e-waste recycling activities. - Highlights: → Antimony and arsenic concentrations in dust from e-waste recycling were investigated. → E-waste recycling is an important emerging source of Sb pollution. → Sb/As ratios may help identify the e-waste contamination.

  17. Contrasting distribution of trace elements between representative antimony deposits in southern China

    International Nuclear Information System (INIS)

    The Xuefeng uplifted belt and the neighboring Xikuangshan region of southern China is the largest antimony producing area in the world. The mineralizing solution which was responsible for the antimony deposition is considered to be derived mainly from deep crustal fluids during a large tectonic movement of the Jurassic time. We analyzed trace elements of ore minerals and fluid inclusions from this area by CSIRO's micro-PIXE to understand characteristics of the mineralizing solution. We selected three representative 'super-large' deposits, one in the Xikuangshan area and the others within the Xuefeng belt: (1) Xikuangshan (simple Sb) which is structurally controlled by large-scale transcrustal faults and fractures, and mainly hosted by limestone; (2) Wuxi (Sb-Au-W), embedded in slate and structurally controlled by large-scale faults and fractures; and (3) Banxi (simple Sb) which is hosted by slate and controlled by local fractures. Our preliminary result indicated that the trace element distribution is highly contrasting for these three deposits corresponding to each geologic setting. Our case study showed that being combined with field evidence, micro-PIXE can contribute to understand large tectonic movements and to establish an effective exploration model for super-large mineral deposits

  18. Structure and properties of antimony-doped lanthanum molybdate La2Mo2O9

    International Nuclear Information System (INIS)

    Polycrystalline samples of the composition La2Mo2−xSbxO9−y, where 0 ≤ x ≤ 0.05, were prepared by solid-phase synthesis. Single crystals of La2Mo1.96Sb0.04O8.17 were obtained by spontaneous crystallization from flux. The structure of the metastable βms phase of this compound was determined at room temperature by X-ray diffraction. It was found that the La, Mo, and O1 atoms are displaced from the threefold axis on which they are located in the high-temperature β phase. It was shown that molybdenum atoms in the crystal structure are partially replaced by antimony atoms, which are located on the threefold axis. In antimony-doped crystals, lanthanum atoms partially return to the site on the threefold axis and the coordination environment of molybdenum cations becomes more ordered, thus facilitating the stabilization of the cubic phase at room temperature. Calorimetric measurements (DSC) showed that the introduction of Sb as the dopant into the La2Mo2O9 structure leads to a decrease in the temperature of the α → β phase transition from 570 to 520°C and to the partial suppression of this transition. The temperature behavior of the conductivity confirms the DSC data. Thus, doping with Sb contributes to the stabilization of the cubic phase at room temperature.

  19. Organically complexed iron enhances bioavailability of antimony to maize (Zea mays) seedlings in organic soils.

    Science.gov (United States)

    Ptak, Corey; McBride, Murray

    2015-12-01

    Antimony (Sb) is a metalloid belonging to group 15 of the periodic table. Chemical similarities between arsenic (As) and Sb produce concerns about potential health effects of Sb and enrichment in the environment. Antimony is found in oxic environments predominately as an oxyanionic species, antimonite (Sb[OH](6-)). As a result of its net negative charge, Sb[OH](6-) was not initially predicted to have strong interactions with natural organic matter. Oxyanionic species could bind the negatively charged organic matter via a ternary complexation mechanism, in which cationic metals mediate the strong association between organic matter functional groups and oxyanions. However, these interactions are poorly understood in how they influence the bioavailability of oxyanionic contaminants to plants. Iron (Fe) additions to organic soils have been found to increase the number of organically complexed Fe sites suitable for Sb exchange, resulting in a reduced bioavailable fraction of Sb. The bioavailability of Sb to maize seedlings as a function of organically complexed Fe was examined using a greenhouse study. A significant increase in plant tissue Sb was observed as organically complexed Fe increased, which was not predicted by methods commonly used to assess bioavailable Sb. Extraction of soils with organic acids common to the maize rhizosphere suggested that organic acid exudation can readily mobilize Sb bound by organic Fe complexes. PMID:26076768

  20. Antimony isotopic composition in river waters affected by ancient mining activity.

    Science.gov (United States)

    Resongles, Eléonore; Freydier, Rémi; Casiot, Corinne; Viers, Jérôme; Chmeleff, Jérôme; Elbaz-Poulichet, Françoise

    2015-11-01

    In this study, antimony (Sb) isotopic composition was determined in natural water samples collected along two hydrosystems impacted by historical mining activities: the upper Orb River and the Gardon River watershed (SE, France). Antimony isotope ratio was measured by HG-MC-ICP-MS (Hydride Generation Multi-Collector Inductively Coupled Plasma Mass Spectrometer) after a preconcentration and purification step using a new thiol-cellulose powder (TCP) procedure. The external reproducibility obtained for δ(123)Sb measurements of our in-house Sb isotopic standard solution and a certified reference freshwater was 0.06‰ (2σ). Significant isotopic variations were evident in surface waters from the upper Orb River (-0.06‰≤δ(123)Sb≤+0.11‰) and from the Gardon River watershed (+0.27‰≤δ(123)Sb≤+0.83‰). In particular, streams that drained different former mining sites exploited for Sb or Pb-Zn exhibited contrasted Sb isotopic signature, that may be related to various biogeochemical processes occurring during Sb transfer from rocks, mine wastes and sediments to the water compartment. Nevertheless, Sb isotopic composition appeared to be stable along the Gardon River, which might be attributed to the conservative transport of Sb at distance from mine-impacted streams, due to the relative mobile behavior of Sb(V) in natural oxic waters. This study suggests that Sb isotopic composition could be a useful tool to track pollution sources and/or biogeochemical processes in hydrologic systems. PMID:26452900

  1. One-step synthesis of antimony-doped tin dioxide nanocrystallites and their property

    Institute of Scientific and Technical Information of China (English)

    ZHENG Min; WANG Bao

    2009-01-01

    Antimony-doped tin dioxide(ATO) nanoparticles with primary diameter in the range of 9-10 nm were rapidly synthesized via a novel combustion technique, starting with antimony trichloride and tin tetrachloride as metal sources and self-assembly compounds as fuels. The combustion phenomena and characteristics of products were controlled by assembling components in fuel compounds according to appropriate molar ratio. The as-synthesized products were characterized by XRD, SEM, TEM and XPS, respectively. The electrical conductivity was evaluated through measuring the antistatic property of polyester fiber treated by the as-synthesized products. The results show that a mild combustion phenomena without release of smoke can be taken on and perfect azury rutile ATO crystal with complete substitution can be formed rapidly under the appropriate synthetic conditions. The antistatic property of the polyester fiber treated by the as-synthesized ATO products is enhanced remarkably. The triboelectricity voltage below 1.0 kV, half life below 1.0 s and surface resistance below 1.0×106 Ω can be attained.

  2. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic

    International Nuclear Information System (INIS)

    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. - Highlights: ► We examined the distribution of antimony in topsoil and moss in Ny-Ålesund, Arctic. ► The distribution of Sb is associated with traffic and historical mining activities. ► The weathering of coal bed cannot lead to the Sb increase in the surface environment. ► The distribution of Sb in moss could reflect the accumulation of Sb pollution. ► Moss can be a useful tool for monitoring Sb in highly and lightly polluted areas. - The distribution of Sb in Ny-Ålesund is partially associated with traffic and historical mining activities, and moss can be a useful tool for monitoring Sb in both highly and lightly polluted areas.

  3. Determination of antimony in nail and hair by thermal neutron activation analysis

    International Nuclear Information System (INIS)

    The concentration of antimony in nail and hair was determined by thermal neutron activation analysis. Samples were collected from the workers of an antimony refinery, inhabitants near the refinery, and residents in control area. They were irradiated by Kyoto University 5000 kW Reactor for 1 h, and cooled for 30 to 100 days. After cooling, the concentration of Sb in nail and hair was estimated by measuring the intensity of γ-ray from 124Sb of the samples, then the samples were washed by 0.1 % aqueous solution of nonionic surface active agent in an ultrasonic cleaner. The γ-ray spectrometry was done again (after washing). The concentration of Sb in nail before washing was 730 ppm for the workers, 2.46 ppm for habitants near the refinery, and 0.19 ppm for the control; after washing, it became 230 ppm for the workers, 0.63 ppm for habitants, and 0.09 ppm for the control. The concentration of Sb in hair before and after washing was 222 ppm and 196 ppm for the workers, and 0.21 ppm and 0.15 ppm for the control, respectively. (author)

  4. Morphology-controlled growth of crystalline antimony sulfide via a refluxing polyol process

    Science.gov (United States)

    Zhang, Rui; Chen, Xiangying; Mo, Maosong; Wang, Zhenghua; Zhang, Meng; Liu, Xinyuan; Qian, Yitai

    2004-02-01

    By refluxing antimony trichloride (SbCl 3) and thiourea in various solvents at suitable reaction conditions, antimony sulfide (Sb 2S 3) crystallites with a diversity of well-defined morphologies were synthesized. Sb 2S 3 rods with the average diameter of 800 nm and the length of 7 μm, as well as microtubes with the average outer diameter of 1.2 μm, the average inner diameter of 800 nm and the length of 8 μm, were obtained in 1,2-propanediol at 180°C for 10 min. In contrast, a series of experiments under different conditions were carried out to investigate the influencing factors on the reaction. The as-synthesized products were characterized by powder X-ray diffraction, field-emission scanning electron microscopy, transmission electron microscope and X-ray photoelectron spectra. The results indicate Sb 2S 3 crystals with different morphologies, including rod-like, tube-like, bowknot-like, flower-like, straw-bundled-like, taken under different experimental conditions. It is found that the reaction temperature, time, solvent and poly(vinyl pyrrolidone) (as a polymer capping reagent) play important roles in the formation of the final Sb 2S 3 crystallites with different morphologies. Also, the possible growth mechanism is discussed.

  5. Cytotoxic activities of Euphorbia kopetdaghi against OVCAR-3 and EJ-138 cell lines

    Directory of Open Access Journals (Sweden)

    Aghaei Mahmoud

    2015-04-01

    Full Text Available Introduction: Over the centuries, the genus Euphorbia was known to be toxic to humans and animals. Recently, in a primary study significant suppressive activity against phytohemagglutinin activated T-cell proliferation has been reported from this plant. Therefore, this study was designed to evaluate the cytotoxic effects of different parts of E. kopetdaghi against cancer cell lines. Methods: Filtration and in vacuo concentration resulted in a green gum which was subjected on silica gel CC (hexane/Acetone, 0→50 to several fractions: F1-F8. The inhibitory effects of obtained fractions with 5, 50, and 500 μg/ml concentrations were evaluated on proliferation and viability of cancer cells (OVCAR and EJ-138 in 48 hours treatment. Finally, cell viability was determined at a wavelength of 570 by 3-4,5-dimethylthiazol-2-yl-2,5-diphenyl tetrazolium bromide (MTT method. Results: Based on studies of microscopic observation and viability testing, F1, F2, F4, F5, F6, and F7 showed significant cytotoxic effect at concentration of 50 and 500 μg/ml against EJ-138 and OVCAR-3 cell lines. These fractions inhibited growth of EJ-138 and OVCAR-3 cells in a concentration-dependent manner. Fraction of F8 induced tumor promotion significantly in EJ-138 and OVCAR-3 cells, respectively. Conclusion: Due to the inhibitory properties of E. kopetdaghi extract and its fractions on cancer cells of OVCAR3 and EJ-13, isolation, purification and identification of compounds presented in the fractions possessing cytotoxic effects are recommended which were the area of our future research.

  6. Radioiodine therapy in management of thyroid carcinoma - A review of 138 patients

    International Nuclear Information System (INIS)

    Differentiated thyroid carcinomas are being treated by using a widely accepted protocol of surgery and radioiodine therapy followed by supplementation of thyroid hormones in the Nuclear Medicine Centre (NMC), Dhaka Medical College Hospital (DMCH) since 1990. In the present study 138 patients(Male-54, Female-84) with differentiated thyroid cancers received radioiodine therapy for ablation of residual thyroid tissue with a dose of 2.77-3.7 GBq (75-100 mCi), for lymph node metastases 5.55-6.5 GBq(150-175mCi), for lung metastases 5.55 GBq(150 mCi) and for bony metastases 7.4 GBq (200 mCi). Among 138 patients papillary carcinoma was observed in 94 cases (68%; Male-42, Female-52), follicular type was found in 30 cases (22%; Male-8, Female-22) and mixed type in 14 patients (10%, Male-4, Female-10). Single dose of 2.77-3.7 GBq(75-100 mCi) of radioiodine was received by all 138 patients. Among the unablated patients 62 received double doses totalling 9.25 GBq (250 mCi), 44 received three doses 12.95 GBq (350 mCi) and one patient received 8 doses 33.3 GBq (900 mCi). Out of 138 patients single dose ablated 76 cases and 62 remain unablated. Multiple doses ablated 28 patients and 34 still remain unablated and is under follow up. The success and failure in management of patients with differentiated thyroid cancer over 8 years period have been discussed here revealing a satisfactory outcome. (author)

  7. Microwelding of various metallic materials under ultravacuum (AO 138-10)

    Science.gov (United States)

    Assie, Jean Pierre; Conde, Eric

    1991-01-01

    The first finding from the AO 138-10 is that cold welding never occurred, and that microwelds didn't even affect the reference (presumably microweld prone) pairs of metals consisting of gold, silver, and chromium. The scientific disappointment from these results must be tempered by the notion of a static AO 138-10 experiment, reflecting the passive character of the global Long Duration Exposure Facility (LDEF) flight. Thus far, it has been theorized that cold welding results from the peeling of the oxide layer, that is formed in an earth environment, by the space environment since such a layer no longer grows in space. In fact, such stripping of the oxide layer supposes relative motion of the contacting materials. In the absence of such motion, as in this experiment, oxidation will preserve its integrity and continue to prevent microwelding. More bewildering is that there was no microwelding of the reference pairs. Even though AO 138-10 failed scientific expectations, as did the LDEF structure with cold welding, the positive, functional aspect to keep in mind is the safe operation of single-shot (appendage releasing and/or latching) mechanisms, unhindered by microwelding in a space vacuum, as now demonstrated by the statically representative pairs of materials. Other aspects of the experiment are discussed.

  8. Cirrus Removal in Multispectral Datawithout 1.38μM Spectral Data

    Science.gov (United States)

    Makarau, Aliaksei; Richter, Rudolf; Zekoll, Viktoria; Reinartz, Peter

    2016-06-01

    Cirrus is one of the most common artifacts in the remotely sensed optical data. Contrary to the low altitude (1-3 km) cloud the cirrus cloud (8-20 km) is semitransparent and the extinction (cirrus influence) of the upward reflected solar radiance can be compensated. The widely employed and almost 'de-facto' method for cirrus compensation is based on the 1.38μm spectral channel measuring the upwelling radiance reflected by the cirrus cloud. The knowledge on the cirrus spatial distribution allows to estimate the per spectral channel cirrus attenuation and to compensate the spectral channels. A wide range of existing and expected sensors have no 1.38μm spectral channel. These sensors data can be corrected by the recently developed haze/cirrus removal method. The additive model of the estimated cirrus thickness map (CTM) is applicable for cirrus-conditioned extinction compensation. Numeric and statistic evaluation of the CTM-based cirrus removal on more than 80 Landsat-8 OLI and 30 Sentinel-2 scenes demonstrates a close agreement with the 1.38μm channel based cirrus removal.

  9. miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

    Energy Technology Data Exchange (ETDEWEB)

    He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail: xiaoyb@vip.sina.com

    2013-11-29

    Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

  10. Highly conducting nanosized monodispersed antimony-doped tin oxide particles synthesized via nanoaqueous sol-gel method

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rathouský, Jiří; Rasp, M.; Štefanić, G.; Günther, S.; Niederberger, M.; Fattakhova-Rohlfing, D.

    Vol. 1. Boca Raton : Taylor-Francis, 2010, s. 340-343. ISBN 978-1-4398-3401-5. - ( Nanotech 2010) R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * TCO * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry

  11. Ambulatory oesophageal pH monitoring : a comparison between antimony, ISFET, and glass pH electrodes

    NARCIS (Netherlands)

    Hemmink, Gerrit J. M.; Weusten, Bas L. A. M.; Oors, Jac; Bredenoord, Albert J.; Timmer, Robin; Smout, Andre J. P. M.

    2010-01-01

    Background and aim Ambulatory oesophageal pH-impedance monitoring is a widely used test to evaluate patients with reflux symptoms. Several types of pH electrodes are available: antimony, ion sensitive field effect transistor (ISFET), and glass electrodes. These pH electrodes have not been compared d

  12. Determination of antimony in environment samples by gas phase chemiluminescence detection following flow injection hydride generation and cryotrapping.

    Science.gov (United States)

    Ye, Yousheng; Sang, Jianchi; Ma, Hongbing; Tao, Guanhong

    2010-06-15

    A novel method for the determination of antimony in environmental samples was developed with gas phase chemiluminescence detection following flow injection hydride generation and cryotrapping. The stibine, generated from samples by borohydride reduction of antimony using flow injection technique, was separated by using a new gas-liquid separator, dried with an ice-salt cryogenic bath and concentrated in a glass U-tube immersed in liquid nitrogen. Re-vaporization of stibine based on its boiling point was achieved by allowing the tube to warm at room temperature. A gas phase chemiluminescence signal was produced during the ozonation of the hydride in a reflective chamber. Under optimal conditions, the proposed method was characterized by a wide linear calibration range from 1.0microgL(-1) to 10.0mgL(-1) with a detection limit of 0.18microgL(-1) (n=11). The relative standard deviation for 10.0microgL(-1) antimony was 3.56% (n=11) and the sampling rate was 15 samples h(-1). Blank signal was reduced by the purification of reagents and the interference from transition metal ions was eliminated by the addition of L-cysteine into samples. The method was applied to the determination of antimony in environmental samples with satisfactory results. PMID:20441930

  13. Comparative phytotoxicity of methylated and inorganic arsenic- and antimony species to Lemna minor, Wolffia arrhiza and Selenastrum capricornutum

    NARCIS (Netherlands)

    L. Duester; H.G. van der Geest; S. Moelleken; A.V. Hirner; K. Kueppers

    2011-01-01

    The alkylation of metalloids through the transfer of methyl groups is an important factor in the biogeochemical cycling of elements like arsenic and antimony. In the environment, many different organic and inorganic forms of these elements can therefore be found in soils, sediments or organisms. Stu

  14. A cloud point extraction for spectrophotometric determination of ultra- trace antimony without chelating agent in environmental and biological samples

    International Nuclear Information System (INIS)

    We report on a simple, sensitive and reliable method for the cloud point extraction of antimony (Sb) and its subsequent spectrophotometric detection. It is based on the color reaction of Sb (III) with iodide in acidic medium and subsequent micelle-mediated extraction of tetraiodoantimonate using a non-ionic surfactant in the absence of any chelating agent. The effects of reaction and extraction parameters were optimized. The calibration plot is linear in the range of 0.80-95 ng mL-1 of antimony in the sample solution, with a regression coefficient (r) of 0.9994 (for n=9). The detection limit (at SNR=3) is 0.23 ng mL-1, and the relative standard deviations at 10 and 70 ng mL-1 of antimony are 3.32 and 1.85 % (at n=8), respectively. The method compared favorably to other methods and was applied to determine antimony in seawater, anti-leishmania drug (glucantime), and human serum. (author)

  15. Effect of Annealing on the Properties of Antimony Telluride Thin Films and Their Applications in CdTe Solar Cells

    Directory of Open Access Journals (Sweden)

    Zhouling Wang

    2014-01-01

    Full Text Available Antimony telluride alloy thin films were deposited at room temperature by using the vacuum coevaporation method. The films were annealed at different temperatures in N2 ambient, and then the compositional, structural, and electrical properties of antimony telluride thin films were characterized by X-ray fluorescence, X-ray diffraction, differential thermal analysis, and Hall measurements. The results indicate that single phase antimony telluride existed when the annealing temperature was higher than 488 K. All thin films exhibited p-type conductivity with high carrier concentrations. Cell performance was greatly improved when the antimony telluride thin films were used as the back contact layer for CdTe thin film solar cells. The dark current voltage and capacitance voltage measurements were performed to investigate the formation of the back contacts for the cells with or without Sb2Te3 buffer layers. CdTe solar cells with the buffer layers can reduce the series resistance and eliminate the reverse junction between CdTe and metal electrodes.

  16. The use of colloidal nano gold as an effective modifier for the determination of antimony, arsenic and lead by ETAAS

    International Nuclear Information System (INIS)

    Complete text of publication follows. Colloidal nano gold was prepared and used as a modifier for the determination of antimony, arsenic and lead by electrothermal atomic absorption spectrometry. The effects of pyrolysis and atomization temperature, the amounts of interferants and modifier on the sensitivities of antimony, arsenic and lead in the presence of modifier were investigated. In addition, the contribution of another modifying reagent Mg(NO3)2 mixed with colloidal nano gold was also investigated. The modifier allows the use of pyrolysis temperatures between 1200 deg C and 1300 deg C for antimony, arsenic and lead. In the presence of colloidal nano gold modifier, the tolerance limits of NaCl and Na2SO4 for the quantitative recoveries of antimony, arsenic and lead were investigated. After optimization of experimental conditions, the three elements were successfully determined in some model solutions containing some sulphate and chloride salts as well as in CRM water samples at 95% confidence level using pure aqueous standards. The effectiveness of modifier was compared with that of the mixed universal modifier (Mg+Pd).

  17. Targeting Glioma Stem Cells by Functional Inhibition of a Prosurvival OncomiR-138 in Malignant Gliomas

    Directory of Open Access Journals (Sweden)

    Xin Hui Derryn Chan

    2012-09-01

    Full Text Available Malignant gliomas are the most aggressive forms of brain tumors, associated with high rates of morbidity and mortality. Recurrence and tumorigenesis are attributed to a subpopulation of tumor-initiating glioma stem cells (GSCs that are intrinsically resistant to therapy. Initiation and progression of gliomas have been linked to alterations in microRNA expression. Here, we report the identification of microRNA-138 (miR-138 as a molecular signature of GSCs and demonstrate a vital role for miR-138 in promoting growth and survival of bona fide tumor-initiating cells with self-renewal potential. Sequence-specific functional inhibition of miR-138 prevents tumorsphere formation in vitro and impedes tumorigenesis in vivo. We delineate the components of the miR-138 regulatory network by loss-of-function analysis to identify specific regulators of apoptosis. Finally, the higher expression of miR-138 in GSCs compared to non-neoplastic tissue and association with tumor recurrence and survival highlights the clinical significance of miR-138 as a prognostic biomarker and a therapeutic target for treatment of malignant gliomas.

  18. Cerebellum proteomics addressing the cognitive deficit of rats perinatally exposed to the food-relevant polychlorinated biphenyl 138.

    Science.gov (United States)

    Campagna, Roberta; Brunelli, Laura; Airoldi, Luisa; Fanelli, Roberto; Hakansson, Helen; Heimeier, Rachel A; De Boever, Patrick; Boix, Jordi; Llansola, Marta; Felipo, Vicente; Pastorelli, Roberta

    2011-09-01

    Developmental exposure to polychlorinated biphenyls (PCBs) has been associated with cognitive deficits in humans and laboratory animals by mechanisms that remain unknown. Recently, it has been shown that developmental exposure to 2,2',3,4,4',5'-hexachlorobiphenyl (PCB138), a food-relevant PCB congener, decreases the learning ability of young rats. The aim of this study was to characterize the effect of perinatal exposure to PCB138 on the brain proteome profile in young rats in order to gain insight into the mechanisms underlying PCB138 neurotoxicity. Comparison of the cerebellum proteome from 3-month-old unexposed and PCB138-exposed male offspring was performed using state-of-the-art label-free semiquantitative mass spectrometry method. Biological pathways associated with Ca(2+) homeostasis and androgen receptor signaling pathways were primarily disrupted. These perturbations may contribute toward a premature ageing-like proteome profile of the cerebellum that is triggered by PCB138 exposure in males. Our proteomic data provide insights into the phenomena that may be contributing to the PCB138 neurotoxicity effects observed in laboratory rodents and correlate with PCB exposure and decreased cognitive functions in humans. As such, this study highlights the importance of PCB138 as a risk factor in developmental neurotoxicity in laboratory rodents and humans. PMID:21673325

  19. Determination of natural isotopic variation in antimony using inductively coupled plasma mass spectrometry for an uncertainty estimation of the standard atomic weight of antimony

    International Nuclear Information System (INIS)

    The isotopic variation of industrially produced antimony was estimated using multiple-collector inductively coupled plasma mass spectrometry. A reproducible 123Sb/121Sb ratio of ±0.004% (2 standard deviations) was routinely obtained using a Sn doping mass discrimination correction technique. Only a small isotopic variation of about 0.05% was observed among industrially important Sb materials (five commercially available reagents and two ore minerals). The degree of Sb isotopic variation to determine the uncertainty in Sb atomic weight can be reduced by this new analytical technique to 0.00025 compared to the currently accepted IUPAC isotopic variation determined by conventional mass spectrometry of ±0.001. Heavy isotope enrichment of Sb in a drainage water sample from a stibnite mining area was found. This heavy isotope enrichment tendency in an aqueous environment may be useful in detecting anthropogenic Sb input from industrial emission by the smelting process via air because Sb of anthropogenic origin will have lighter isotope enrichment features. (author)

  20. Spin dynamics of complex oxides, bismuth-antimony alloys, and bismuth chalcogenides

    Science.gov (United States)

    Sahin, Cuneyt

    The emerging field of spintronics relies on the manipulation of electron spin in order to use it in spin-based electronics. Such a paradigm change has to tackle several challenges including finding materials with sufficiently long spin lifetimes and materials which are efficient in generating pure spin currents. This thesis predicts that two types of material families could be a solution to the aforementioned challenges: complex oxides and bismuth based materials. We derived a general approach for constructing an effective spin-orbit Hamiltonian which is applicable to all nonmagnetic materials. This formalism is useful for calculating spin-dependent properties near an arbitrary point in momentum space. We also verified this formalism through comparisons with other approaches for III-V semiconductors, and its general applicability is illustrated by deriving the spin-orbit interaction and predicting spin lifetimes for strained strontium titanate (STO) and a two-dimensional electron gas in STO (such as at the LAO/STO interface). Our results suggest robust spin coherence and spin transport properties in STO related materials even at room temperature. In the second part of the study we calculated intrinsic spin Hall conductivities for bismuth-antimony (BISb) semimetals with strong spin-orbit couplings, from the Kubo formula and using Berry curvatures evaluated throughout the Brillouin zone from a tight-binding Hamiltonian. Nearly crossing bands with strong spin-orbit interaction generate giant spin Hall conductivities in these materials, ranging from 474 ((h/e)O--1cm--1) for bismuth to 96((h/e)O--1cm --1) for antimony; the value for bismuth is more than twice that of platinum. The large spin Hall conductivities persist for alloy compositions corresponding to a three-dimensional topological insulator state, such as Bi0.83Sb0.17. The spin Hall conductivity could be changed by a factor of 5 for doped Bi, or for Bi0.83Sb0.17, by changing the chemical potential by 0.5 e

  1. Antimony: a traffic-related element in the atmosphere of Buenos Aires, Argentina.

    Science.gov (United States)

    Gómez, Darío R; Fernanda Giné, María; Claudia Sánchez Bellato, Ana; Smichowski, Patricia

    2005-12-01

    Vehicular traffic is one of the main sources of antimony in highly populated urban areas like Buenos Aires where an overall traffic density of 1 500 000 vehicles per day (corresponding to 7500 vehicles km(-2)) is estimated. In this context, a study was undertaken to ascertain the levels of Sb and other traffic-related elements (TRE) in the atmosphere of this city. To this end, sixty-seven samples of PM-10 particulate matter were collected during eight days in nine representative sampling sites located downtown Buenos Aires and spread over an area of about 30 km2. The collection of particulate matter was performed on ash-free glass-fibre filters using high volume samplers with PM-10 sampling heads. A combination of aqua regia and perchloric acid was used for leaching metals from filters. The resulting solutions were evaporated and then diluted with 0.1 mol l(-1) HCl. Antimony was determined by inductively coupled plasma-quadrupole mass spectrometry (ICP-QMS) at ng g(-1) levels. Concentrations of Sb varied from 12.9 +/- 0.9 to 375 +/- 23 microg g(-1)(equivalent to 0.87 +/- 0.06 to 15.3 +/- 0.8 ng m(-3)). Statistical analysis was performed on the data set including the measured PM-10 mass and Sb concentrations for the monitored period. Correlations of Sb with other TRE namely, Cu and Mo were also assessed. The highest concentrations of Sb were detected at two sites (Hospital Alemán and Casa Rapallini) located in streets with traffic consisting mostly of passenger cars and showing a "stop-and-go" pattern in peak hours. Antimony levels in the Buenos Aires PM-10 are by far below the level of 0.5 mg m(-3)(for an 8 hour workday, 40 hour work week) set by the US Occupational Safety and Health Administration (OSHA) for occupational exposure. However, monitoring of Sb and other TRE should be carried out in a systematic fashion to detect the possibility of increases in from the present levels. PMID:16307067

  2. The electrical characterizations of selenium (Se) doped gallium antimony (GaSb) single crystal

    Science.gov (United States)

    Choudhari, Rashmi; Deshpande, Manisha; Maske, Dilip; Gadkari, Dattatray

    2016-05-01

    The growth of Se doped GaSb bulk crystal is carried out using Vertical directional solidification (VDS) technique. High purity Gallium and Antimony is taken as source material and selenium as doping material. From grown ingot substrate were obtained in wafer form using diamond cutter. The electrical characteristics such as Hall measurement is used to find the carrier concentration and mobility, while Van der pauw for measuring resistivity of the sample The GaSb:Se sample shows high resistivity and mobility. The grown crystal was detached from the ampoule wall with high crystal quality. The measured resistivity of GaSb:Se is 9.9×10-3ohm-cm, the mobility is 1464cm3/Vsec and carrier concentration is 5.08×1017 per cm3.

  3. Sequential solvent extraction for forms of antimony in five selected coals

    Science.gov (United States)

    Qi, C.; Liu, Gaisheng; Kong, Y.; Chou, C.-L.; Wang, R.

    2008-01-01

    Abundance of antimony in bulk samples has been determined in five selected coals, three coals from Huaibei Coalfield, Anhui, China, and two from the Illinois Basin in the United States. The Sb abundance in these samples is in the range of 0.11-0.43 ??g/g. The forms of Sb in coals were studied by sequential solvent extraction. The six forms of Sb are water soluble, ion changeable, organic matter bound, carbonate bound, silicate bound, and sulfide bound. Results of sequential extraction show that silicate-bound Sb is the most abundant form in these coals. Silicate- plus sulfide-bound Sb accounts for more than half of the total Sb in all coals. Bituminous coals are higher in organic matterbound Sb than anthracite and natural coke, indicating that the Sb in the organic matter may be incorporated into silicate and sulfide minerals during metamorphism. ?? 2008 by The University of Chicago. All rights reserved.

  4. Supermolecular template route to fabrication of well crystallized hollow antimony microspheres

    Institute of Scientific and Technical Information of China (English)

    GU Li; CHEN Shu-da; WEI Xiao-yan

    2006-01-01

    Hollow spheres of elemental antimony (Sb) with good crystallinity, high contrast and thin wall were prepared in the solutions of poly(ethylene glycol) (PEG) and oleic acid(OA) associations at the refluxed temperature. The complexes of Sb3+ with tartaric acid were used as precursors, which can avoid the hydrolysis of SbCl3 and the resulting impurity of products. The average diameter and thickness of the as-prepared hollow sphere are about 300 nm and less than 20 nm, respectively. The formation of hollow spheres depends on the template function of PEG and OA associations, which can be confirmed through the theoretical analysis and results of control experiments. The specific surface area reaches 34.669 m2/g.

  5. Surface morphology of crystalline antimony islands on graphite at room temperature

    International Nuclear Information System (INIS)

    Antimony islands of different shapes and dimensions were grown on highly oriented pyrolytic graphite (HOPG) at room temperature in ultrahigh vacuum. Three-dimensional (3D) spherical, 2D thin films and 1D nanorods of Sb on graphite were studied using in situ scanning tunnelling microscopy. Sb was evaporated in the form of Sb4, which interacts with HOPG weakly and exhibits a high surface mobility, resulting in preferential nucleation of 3D spherical islands at defect sites. Surface diffusion and aggregation lead to the formation of nanoparticles with various shapes and sizes. The shape and size of islands depend on growth parameters, i.e. flux and deposition time. The 3D and 2D structures of Sb on graphite have the same bulk crystalline rhombohedral (α-Sb) structure, but the 1D nanorods show a highly compressed structure different from the α-Sb lattice

  6. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Directory of Open Access Journals (Sweden)

    Zhimeng Liu

    2016-05-01

    Full Text Available A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2/carbon aerogel (CA for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  7. Focused ion beam induced synthesis of a porous antimony nanowire network

    International Nuclear Information System (INIS)

    We present a focused ion beam-based approach for the synthesis of an antimony nanofiber network. The nanofibers, with a homogeneous distribution of diameters of about 25 nm and lengths up to several microns, are synthesized in a self-assembling process without any additional material source at room temperature. It is possible to recrystallize the as-grown amorphous nanofibers by moderate rapid thermal annealing at 473 K. These results have been verified by means of scanning electron microscopy, Auger electron spectroscopy, high-resolution transmission electron microscopy, selected area electron diffraction, and energy dispersive x-ray analysis. As this approach is not limited solely to the material discussed here, other substrates (e.g., GaSb and Ge) and ion sources should extend this method to other materials, which offers a great potential for future nanoscale devices and applications

  8. Novel fabrication of an electrochromic antimony-doped tin oxide film using a nanoparticle deposition system

    Science.gov (United States)

    Kim, Hyungsub; Park, Yunchan; Choi, Dahyun; Ahn, Sung-Hoon; Lee, Caroline Sunyong

    2016-07-01

    Novel deposition method of Antimony-doped tin oxide (ATO) thin films was introduced using a nanoparticle deposition system (NPDS) to fabricate an electrochromic (EC) device. NPDS is a dry deposition method that simplifies the ATO deposition process by eliminating the need for solvents or binders. In this study, an ATO EC layer was deposited using NPDS. The surface morphology and electrochemical and optical transmittance properties were characterized. The optical transmittance change in the ATO EC device was ∼35% over the wavelength range of 350-800 nm, and the cyclic transmittance was stable. The ATO film deposited using NPDS, exhibited a coloration efficiency of 15.5 cm2 C-1. Therefore, our results suggest that ATO EC devices can be fabricated using a simple, cost-effective NPDS, which allows nanoparticles to be deposited directly without pre- or post-processing.

  9. Microbial diversity and community structure in an antimony-rich tailings dump.

    Science.gov (United States)

    Xiao, Enzong; Krumins, Valdis; Dong, Yiran; Xiao, Tangfu; Ning, Zengping; Xiao, Qingxiang; Sun, Weimin

    2016-09-01

    To assess the impact of antimony (Sb) on microbial community structure, 12 samples were taken from an Sb tailings pile in Guizhou Province, Southwest China. All 12 samples exhibited elevated Sb concentrations, but the mobile and bioaccessible fractions were small in comparison to total Sb concentrations. Besides the geochemical analyses, microbial communities inhabiting the tailing samples were characterized to investigate the interplay between the microorganisms and environmental factors in mine tailings. In all samples, Proteobacteria and Actinobacteria were the most dominant phyla. At the genus level, Thiobacillus, Limnobacter, Nocardioides, Lysobacter, Phormidium, and Kaistobacter demonstrated relatively high abundances. The two most abundant genera, Thiobacillus and Limnobacter, are characterized as sulfur-oxidizing bacteria and thiosulfate-oxidizing bacteria, respectively, while the genus Lysobacter contains arsenic (As)-resistant bacteria. Canonical correspondence analysis (CCA) indicates that TOC and the sulfate to sulfide ratio strongly shaped the microbial communities, suggesting the influence of the environmental factors in the indigenous microbial communities. PMID:27188777

  10. Nuclear quadrupole resonance of iodine pentafluoride and its complexes with antimony pentafluoride

    International Nuclear Information System (INIS)

    The spectra of nuclear quadrupole resonance (NQR) have been obtained at 77 deg K for I127 and Sbsup(121,128) in the IF5, IF5xSbF5, IF5x2SbF5, CsIF6, and RbIF6 compounds. An agreement between quadrupole spectra and structural data have been observed. The results of studying IF5 by NQR, gamma resonance and microwave spectroscopy have been compared. It has been established that unshared electron pair of an iodine atom is stereochemically active which leads to a considerable distortion of octahedral symmetry of coordination polyhedron of the iodine atoms. The structure of complexes of iodine pentafluoride with antimony pentafluoride is given

  11. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic.

    Science.gov (United States)

    Jia, Nan; Sun, Liguang; He, Xin; You, Kehua; Zhou, Xin; Long, Nanye

    2012-12-01

    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. PMID:22885219

  12. A novel composite material based on antimony(III) oxide and amorphous silica

    Energy Technology Data Exchange (ETDEWEB)

    Zemnukhova, Ludmila A. [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation); Panasenko, Alexander E., E-mail: panasenko@ich.dvo.ru [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation)

    2013-05-01

    The composite material nSb₂O₃·mSiO₂·xH₂O was prepared by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. It has been shown that the composition of the material is influenced by the ratio of the initial components and the acidity of the reaction medium. The morphology of the material particles and its specific surface area have been determined. The thermal and optic properties were also investigated. - Graphical abstract: Novel composite material containing amorphous silica and crystal antimony(III) oxide has been synthesized by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. Highlights: • The composite material nSb₂O₃·mSiO₂·xH₂O was prepared in an aqueous medium. • The composition of the material is controllable by a synthesis conditions. • The morphology of the material and its optic properties have been determined.

  13. Evaluations of antimony and strontium interaction in an Al–Si–Cu–Zn die cast alloy

    Energy Technology Data Exchange (ETDEWEB)

    Farahany, Saeed, E-mail: saeedfarahany@gmail.com; Idris, Mohd Hasbullah; Ourdjini, Ali

    2014-05-01

    Graphical abstract: - Highlights: • Probable interactions between Sb and Sr in a complex Al–Si alloy were evaluated. • Sequence of addition did not affect thermal and microscopical characteristics. • Threshold ratio for the Sb and Sr interaction is proposed. - Abstract: The interaction between antimony and strontium in an ADC12 die casting alloy is investigated comprehensively by using a computer aided cooling curve thermal analysis coupled with microstructure inspection. The results of the thermal analysis show significant changes in Al–Si eutectic reaction based on different concentrations of Sb and Sr. Sb reduces the efficiency of Sr in modifying the eutectic Si. Based upon the data obtained in this study, the threshold Sr/Sb ratio should exceed about 0.5 in order to obtain fully modified structure. Moreover, a pre-eutectic reaction of Al{sub 2}Si{sub 2}Sr intermetallic was detected for high concentrations of Sr.

  14. Synthesis and optical properties of antimony oxide glasses doped with holmium trioxide

    Science.gov (United States)

    Raghunatha, S.; Eraiah, B.

    2016-05-01

    Holmium doped lithium-antimony-lead borate glasses having 1mol% AgNO3 with composition 50B2O3-20PbO-25Sb2O3-5Li2O have been prepared using single step melt quenching technique. The XRD spectrum confirms amorphous nature of glasses. The optical absorbance studies were carried out on these glasses. The optical direct band gap energies were found to be in the range of 3.10 eV to 3.31 eV and indirect band gap energies were found to be in the range of 2.28 eV to 3.00 eV. The refractive indexes have been calculated by using Lorentz-Lorenz formula and the calculated values in the range of 2.31 to 2.37.

  15. Properties of antimony doped ZnO thin films deposited by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Sadananda Kumar, N., E-mail: sadanthara@gmail.com; Bangera, Kasturi V.; Shivakumar, G. K. [National Institute of Technology Karnataka, Surathkal, Thin Films Laboratory, Department of Physics (India)

    2015-07-15

    Antimony (Sb) doped zinc oxide (ZnO) thin films were deposited on the glass substrate at 450°C using spray pyrolysis technique. Effect of Sb doping on surface morphology structural, optical and electrical properties were studied. X-ray diffraction (XRD) analysis showed that both the undoped and doped ZnO thin films are polycrystalline in nature with (101) preferred orientation. SEM analysis showed a change in surface morphology of Sb doped ZnO thin films. Doping results in a marked increase in conductivity without affecting the transmittance of the films. ZnO films prepared with 3 at % Sb shows the lowest resistivity of 0.185 Ohm cm with a Hall mobility of 54.05 cm{sup 2} V{sup –1} s{sup –1}, and a hole concentration of 6.25 × 10{sup 17} cm{sup –3}.

  16. Decay schemes for mass separated 136I, 138I, and 137Xe

    International Nuclear Information System (INIS)

    A study of the gamma-ray de-excitation following the beta decay of 136I, 138I and 137Xe using the TRISTAN on-line isotope separator facility is reported. Gamma-ray singles and gamma-gamma coincidence measurements were made for all three decays using Ge(Li) detectors. In addition, gamma-ray multiscale measurements were made for the decay of 136I. A total of 142 gamma rays were observed in the decay of the 45-and 85-second isomers of 136I. Of these 115 were placed in a level scheme for 136Xe consisting of 50 excited states up to 6624 keV. A total of 8 gamma rays were assigned to the decay of 138I all of which were placed in a level scheme for 138Xe consisting of 6 excited states at 589, 1073, 1464, 1867, 1903, and 2398 keV. Of the 94 gamma rays observed in the decay of 137Xe, 83 were placed in a level scheme for 137Cs consisting of 34 excited states up to 3976 keV. Gamma-ray multiscale measurements confirmed that 136I has only two isomers. The half-life values obtained were 44.8 +- 1.0 and 85.2 +- 1.8 seconds. Spin and parity assignments were deduced, whenever possible, on the basis of gamma-ray transition probabilities and beta transition log ft values. The 136I and 137Xe decay schemes are compared with earlier decay studies and with results from (p,p') and proton transfer experiments. A possible correspondence of levels strongly populated by beta decay with neutron particle-hole states observed in (p,p') experiments is noted for 136I levels around 4 MeV. The systematics associated with these level schemes are discussed and a comparison is made with recent shell-model calculations

  17. First-Principles Study of Antimony Doping Effects on the Iron-Based Superconductor CaFe(SbxAs1-x)2

    Science.gov (United States)

    Nagai, Yuki; Nakamura, Hiroki; Machida, Masahiko; Kuroki, Kazuhiko

    2015-09-01

    We study antimony doping effects on the iron-based superconductor CaFe(SbxAs1-x)2 by using the first-principles calculation. The calculations reveal that the substitution of a doped antimony atom into As of the chainlike As layers is more stable than that into FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers, which only exist in the novel 112 system, is responsible for rising up the critical temperature. We discuss antimony doping effects on the electronic structure. It is found that the calculated band structures with and without the antimony doping are similar to each other within our framework.

  18. First-principles study of antimony doping effects on the iron-based superconductor CaFe(SbxAs1−x)2

    International Nuclear Information System (INIS)

    We study antimony doping effects on the iron-based superconductor CaFe(SbxAs1−x)2 by using the first-principles calculation. The calculations reveal that the substitution of a doped antimony atom into As of the chainlike As layers is more stable than that into FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers, which only exist in the novel 112 system, is responsible for rising up the critical temperature. We discuss antimony doping effects on the electronic structure. It is found that the calculated band structures with and without the antimony doping are similar to each other within our framework. (author)

  19. Optical properties of Eu3+-doped antimony-oxide-based low phonon disordered matrices

    Science.gov (United States)

    Som, Tirtha; Karmakar, Basudeb

    2010-01-01

    A new series of monolithic Eu2O3-doped high antimony oxide (40-80 mol%) content disordered matrices (glasses) of low phonon energy (about 600 cm-1) in the K2O-B2O3-Sb2O3 (KBS) system was prepared by the melt-quench technique. Infrared reflection spectroscopy was used to establish the low phonon energy of the glasses. Amorphicity and devitrification of the glasses were confirmed by x-ray diffraction analysis. UV-vis absorption spectra of Eu3+ have been measured and the band positions have been justified with quantitative calculation of the nephelauxetic parameter and covalent bonding characteristics of the host. These Eu2O3-doped glasses upon excitation at 393 nm radiation exhibit six emission bands in the range 500-750 nm due to their low phonon energy. Of these, the magnetic dipole ^{5}\\mathrm {D}_{0} \\to {}^{7} \\mathrm {F_{1}} transition shows small Stark splitting while the electric dipole ^{5}\\mathrm {D}_{0} \\to {}^{7}\\mathrm {F}_{2} transition undergoes remarkable Stark splitting into two components. They have been explained by the crystal field effect. The Judd-Ofelt parameters, Ωt = 2,4,6, were also evaluated and the change of Ωt with the glass composition was correlated with the asymmetric effect at Eu3+ ion sites and the fundamental properties like covalent character and optical basicity. We are the first to report the spectroscopic properties of the Eu3+ ion in KBS low phonon antimony glasses.

  20. Impact of arsenic on uptake and bio-accumulation of antimony by arsenic hyperaccumulator Pteris vittata

    International Nuclear Information System (INIS)

    Individual uptake of As and Sb species in Pteris vittata have been investigated, but little information is available how uptake is affected if both metalloids are simultaneously present in different amounts. We investigated the uptake of antimony and its speciation in Pteris vittata cultivated in quartz substrate with, versus without, co-contamination with arsenic and a contaminated soil for 7 weeks. Applying HPLC-ICP-MS technique Sb(V), Sb(III), As(III), and As(V) could be identified as main species in aqueous extracts of roots and fronds with up to 230 mg kg−1 of total Sb in the roots. Adding increasing amounts of As to the quartz substrate resulted in increasing uptake of Sb. In contrast to As, which is readily transferred to the fronds, Sb is primarily accumulated in the roots with Sb(V) being the dominant species (>90% of Sb). The addition of As doesn't result in enhanced translocation of Sb into the fronds. Highlights: ► Antimonate is bioavailable to P. vittata grown for 7 weeks in different substrates. ► Antimony is primarily accumulated in the roots with Sb(V) being the dominant species. ► Sb(III) is present to a somewhat higher portion in the fronds than in the roots. ► Increasing amounts of As(V) in substrate resulted in increasing uptake of Sb(V). ► Addition of As is not accompanied by any alteration of Sb translocation to fronds. -- Roots of Pteris vittata cultivated under green-house conditioned in substrates containing antimonate accumulates Sb(V). This was promoted by As(V)

  1. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    International Nuclear Information System (INIS)

    A new antimony-based glass system (K2O-B2O3-Sb2O3) having low phonon energy (about 600 cm-1) doped with Sm3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm2O3. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the 4G5/2→6H5/2, 4G5/2→6H7/2 and 4G5/2→6H9/2 transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G5/2) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1)

  2. 1.38 W tunable high-power narrow-linewidth external-cavity tapered amplifier at 670 nm

    DEFF Research Database (Denmark)

    Chi, Mingjun; Erbert, G.; Sumpf, B.;

    2010-01-01

    A diffraction-limited narrow-linewidth diode laser system based on a tapered amplifier in external cavity is demonstrated. 1.38 W output power is obtained. The laser system is tunable from 659 to 675 nm.......A diffraction-limited narrow-linewidth diode laser system based on a tapered amplifier in external cavity is demonstrated. 1.38 W output power is obtained. The laser system is tunable from 659 to 675 nm....

  3. 40 CFR 125.138 - As an owner or operator of a new offshore oil and gas extraction facility, must I keep records...

    Science.gov (United States)

    2010-07-01

    ... offshore oil and gas extraction facility, must I keep records and report? 125.138 Section 125.138... Intake Structures for New Offshore Oil and Gas Extraction Facilities Under Section 316(b) of the Act § 125.138 As an owner or operator of a new offshore oil and gas extraction facility, must I keep...

  4. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    OpenAIRE

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt; Gammelgaard, Bente; Stürup, Stefan; Hansen, Helle Rüsz

    2011-01-01

    In solution antimony exists either in the pentavalent or trivalent oxidation state. As Sb(III) is more toxic than Sb(V), it is important to be able to perform a quantitative speciation analysis of Sb’s oxidation state. The most commonly applied chromatographic methods used for this redox speciation analysis do, however, often show a low chromatographic Sb recovery when samples of environmental or biological origin are analysed. In this study we explored basal chemistry of antimony and found t...

  5. Decreased antimony uptake and overexpression of genes of thiol metabolism are associated with drug resistance in a canine isolate of Leishmania infantum.

    Science.gov (United States)

    Gómez Pérez, Verónica; García-Hernandez, Raquel; Corpas-López, Victoriano; Tomás, Ana M; Martín-Sanchez, Joaquina; Castanys, Santiago; Gamarro, Francisco

    2016-08-01

    Visceral leishmaniasis (VL) caused by the protozoan parasite Leishmania infantum, is one of the most important zoonotic diseases affecting dogs and humans in the Mediterranean area. The presence of infected dogs as the main reservoir host of L. infantum is regarded as the most significant risk for potential human infection. We have studied the susceptibility profile to antimony and other anti-leishmania drugs (amphotericin B, miltefosine, paromomycin) in Leishmania infantum isolates extracted from a dog before and after two therapeutic interventions with meglumine antimoniate (subcutaneous Glucantime(®), 100 mg/kg/day for 28 days). After the therapeutic intervention, these parasites were significantly less susceptible to antimony than pretreatment isolate, presenting a resistance index of 6-fold to Sb(III) for promastigotes and >3-fold to Sb(III) and 3-fold to Sb(V) for intracellular amastigotes. The susceptibility profile of this resistant L. infantum line is related to a decreased antimony uptake due to lower aquaglyceroporin-1 expression levels. Additionally, other mechanisms including an increase in thiols and overexpression of enzymes involved in thiol metabolism, such as ornithine decarboxylase, trypanothione reductase, mitochondrial tryparedoxin and mitochondrial tryparedoxin peroxidase, could contribute to the resistance as antimony detoxification mechanisms. A major contribution of this study in a canine L. infantum isolate is to find an antimony-resistant mechanism similar to that previously described in other human clinical isolates. PMID:27317865

  6. Geologic interpretation of seismic data, relocation of Route 2, Stations 138-155 in Lancaster, Mass.

    Science.gov (United States)

    May, James E.; Linehan, Rev. Daniel

    1950-01-01

    The proposed relocation of the Concord-Westminster Highway, Route 2, in Lancaster, Mass., requires a long, deep cut between stations 138 and 155. A preliminary seismic survey was made of the site in October 1949. At that time five transverses were made along the base-line, and three transverse to it. This work showed an anomalous situation in the vicinity of shot point E. In order to obtain the required additional data to resolve these anomalies, four more seismic transverses were made in November 1949. Two of these were run along the base-line between station 138+52 and station 145+12 in such a way as to yield, in conjugation with the preliminary survey, depth data of a 660-foot transverse. One of the primary functions of this long line was to obtain a reliable bedrock velocity. The other two transverses were transverse to the long transverse. This report comprises all of the seismic and geologic work performed at this site. The work was done as a part of a cooperative program of the Massachusetts Department of Public Works and the United States Geological Survey.

  7. Evaluation of microstructure anisotropy on room and medium temperature ECAP deformed F138 steel

    Energy Technology Data Exchange (ETDEWEB)

    De Vincentis, N.S., E-mail: devincentis@ifir-conicet.gov.ar [Instituto de Física Rosario, FCEIA-UNR-CONICET, Bv. 27 de Febrero 210 bis, S2000EZP Rosario (Argentina); Kliauga, A.; Ferrante, M. [Departamento de Engenharia de Materiais — Universidade Federal de São Carlos, Rodovia Washington Luís, km 235 — SP-310, São Carlos, SP 13565-905 (Brazil); Avalos, M. [Instituto de Física Rosario, FCEIA-UNR-CONICET, Bv. 27 de Febrero 210 bis, S2000EZP Rosario (Argentina); Brokmeier, H.-G. [Institut für Werkstoffkunde und Werkstofftechnik, TU Clausthal, Agricolastr.6, 38678 Clausthal-Zellerfeld. Helmholtz-Zentrum Geesthacht, GEMS Outstation, Notkestr. 85, 22607 Hamburg (Germany); Bolmaro, R.E. [Instituto de Física Rosario, FCEIA-UNR-CONICET, Bv. 27 de Febrero 210 bis, S2000EZP Rosario (Argentina)

    2015-09-15

    The microstructure developed during severe plastic deformation results in improved mechanical properties because of the decrease in domain sizes and accumulation of defects, mainly dislocation arrays. The characteristic deformation stages observed in low stacking fault energy (SFE) face centered cubic (FCC) materials are highly influenced by the development of the primary and secondary twinning that compete with dislocation glide. In this paper, a low SFE F138 stainless steel is deformed by equal channel angular pressing (ECAP) up to 4 passes at room temperature (RT) and at 300 °C to compare the grain refinement and twin boundary development with increasing deformation. Tensile tests were performed to determine the deformation stages reached by the material before and after ECAP deformation, and the resulting microstructure was observed by TEM. X-ray diffraction and EBSD, average technique the first and local the second one, were used to quantify the microstructural changes, allowing the determination of diffraction domain sizes, dislocation and stacking fault densities and misorientation indices, which lead to a complete analysis of the deformation introduced in the material, with comparative correlations between various microstructural parameters. - Highlights: • The microstructure of ECAP pressed F138 steel was studied using TEM, EBSD and XRD. • Increasing deformation reduced domain sizes and increased dislocation densities. • Dislocation array compactness and misorientation increased with higher deformation. • Largest dislocation densities, mostly screw, match with simultaneous activation of twins. • Several correlations among microstructural features and parameters have been disclosed.

  8. The mass of the Mars-sized exoplanet Kepler-138 b from transit timing.

    Science.gov (United States)

    Jontof-Hutter, Daniel; Rowe, Jason F; Lissauer, Jack J; Fabrycky, Daniel C; Ford, Eric B

    2015-06-18

    Extrasolar planets that pass in front of their host star (transit) cause a temporary decrease in the apparent brightness of the star, providing a direct measure of the planet's size and orbital period. In some systems with multiple transiting planets, the times of the transits are measurably affected by the gravitational interactions between neighbouring planets. In favourable cases, the departures from Keplerian orbits (that is, unaffected by gravitational effects) implied by the observed transit times permit the planetary masses to be measured, which is key to determining their bulk densities. Characterizing rocky planets is particularly difficult, because they are generally smaller and less massive than gaseous planets. Therefore, few exoplanets near the size of Earth have had their masses measured. Here we report the sizes and masses of three planets orbiting Kepler-138, a star much fainter and cooler than the Sun. We determine that the mass of the Mars-sized inner planet, Kepler-138 b, is 0.066(+0.059)(-0.037) Earth masses. Its density is 2.6(+2.4)(-1.5) grams per cubic centimetre. The middle and outer planets are both slightly larger than Earth. The middle planet's density (6.2(+5.8)(-3.4) grams per cubic centimetre) is similar to that of Earth, and the outer planet is less than half as dense at 2.1(+2.2)(-1.2) grams per cubic centimetre, implying that it contains a greater portion of low-density components such as water and hydrogen. PMID:26085271

  9. An Overview of the 13:8 Mean Motion Resonance between Venus and Earth

    CERN Document Server

    Bazsó, Ákos; Dvorak, Rudolf; Pilat-Lohinger, Elke; Lhotka, Christoph

    2009-01-01

    It is known since the seminal study of Laskar (1989) that the inner planetary system is chaotic with respect to its orbits and even escapes are not impossible, although in time scales of billions of years. The aim of this investigation is to locate the orbits of Venus and Earth in phase space, respectively to see how close their orbits are to chaotic motion which would lead to unstable orbits for the inner planets on much shorter time scales. Therefore we did numerical experiments in different dynamical models with different initial conditions -- on one hand the couple Venus-Earth was set close to different mean motion resonances (MMR), and on the other hand Venus' orbital eccentricity (or inclination) was set to values as large as e = 0.36 (i = 40deg). The couple Venus-Earth is almost exactly in the 13:8 mean motion resonance. The stronger acting 8:5 MMR inside, and the 5:3 MMR outside the 13:8 resonance are within a small shift in the Earth's semimajor axis (only 1.5 percent). Especially Mercury is strongly...

  10. Rotation Curve with MOND and Dark Matter Halo profile for ESO138-G014

    CERN Document Server

    Hashim, Norsiah; Abidin, Zamri Zainal; Salucci, Paolo

    2014-01-01

    This paper is devoted to solve the galactic rotation problem for ESO138-G014 galaxy based on two theories: dark matter and Modified Newtonian Dynamics. Here we did the rotation curve analysis with two possible choices for the dark matter density profile, namely Burkert and Navarro, Frenk and White profiles. The analysis shows the dark matter distribution favored to Burkert profile (cored dark matter). The standard hypothesis for most spiral galaxies are known to be embedded in dark matter haloes has now been overshadowed by Modified Newtonian Dynamics, known as MOND, the leading alternative of dark matter. MOND addresses the problem of a new fundamental constant $a_0$, called the acceleration constant, at which acceleration scale of Newton second law fails to hold. In this respect, we investigate this issue by testing the rotation curve within the MOND framework with the observations to obtain the reliable disk mass, $M_D$. We investigate whether ESO138-G014 is compatible with MOND or dark matter is still fav...

  11. Remediation of antimony-rich mine waters: Assessment of antimony removal and shifts in the microbial community of an onsite field-scale bioreactor.

    Science.gov (United States)

    Sun, Weimin; Xiao, Enzong; Kalin, Margarete; Krumins, Valdis; Dong, Yiran; Ning, Zengping; Liu, Tong; Sun, Min; Zhao, Yanlong; Wu, Shiliang; Mao, Jianzhong; Xiao, Tangfu

    2016-08-01

    An on-site field-scale bioreactor for passive treatment of antimony (Sb) contamination was installed downstream of an active Sb mine in Southwest China, and operated for one year (including a six month monitoring period). This bioreactor consisted of five treatment units, including one pre-aerobic cell, two aerobic cells, and two microaerobic cells. With the aerobic cells inoculated with indigenous mine water microflora, the bioreactor removed more than 90% of total soluble Sb and 80% of soluble antimonite (Sb(III)). An increase in pH and decrease of oxidation-reduction potential (Eh) was also observed along the flow direction. High-throughput sequencing of the small subunit ribosomal RNA (SSU rRNA) gene variable (V4) region revealed that taxonomically diverse microbial communities developed in the bioreactor. Metal (loid)-oxidizing bacteria including Ferrovum, Thiomonas, Gallionella, and Leptospirillum, were highly enriched in the bioreactor cells where the highest total Sb and Sb(III) removal occurred. Canonical correspondence analysis (CCA) indicated that a suite of in situ physicochemical parameters including pH and Eh were substantially correlated with the overall microbial communities. Based on an UPGMA (Unweighted Pair Group Method with Arithmetic Mean) tree and PCoA (Principal Coordinates Analysis), the microbial composition of each cell was distinct, indicating these in situ physicochemical parameters had an effect in shaping the indigenous microbial communities. Overall, this study was the first to employ a field-scale bioreactor to treat Sb-rich mine water onsite and, moreover, the findings suggest the feasibility of the bioreactor in removing elevated Sb from mine waters. PMID:27208755

  12. Sodium Antimony Gluconate Induces Generation of Reactive Oxygen Species and Nitric Oxide via Phosphoinositide 3-Kinase and Mitogen-Activated Protein Kinase Activation in Leishmania donovani-Infected Macrophages

    OpenAIRE

    Mookerjee Basu, Jayati; Mookerjee, Ananda; Sen, Prosenjit; Bhaumik, Suniti; Sen, Pradip; Banerjee, Subha; Naskar, Ksudiram; Choudhuri, Soumitra K.; Saha, Bhaskar; Raha, Sanghamitra; Roy, Syamal

    2006-01-01

    Pentavalent antimony complexes, such as sodium stibogluconate and sodium antimony gluconate (SAG), are still the first choice for chemotherapy against various forms of leishmaniasis, including visceral leishmaniasis, or kala-azar. Although the requirement of a somewhat functional immune system for the antileishmanial action of antimony was reported previously, the cellular and molecular mechanism of action of SAG was not clear. Herein, we show that SAG induces extracellular signal-regulated k...

  13. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    Energy Technology Data Exchange (ETDEWEB)

    Sehmel, G.A.

    1989-05-01

    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ..delta..G/sub f,298//sup o/, ..delta..H/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (..delta..H/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs.

  14. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    International Nuclear Information System (INIS)

    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ΔG/sub f,298//sup o/, ΔH/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (ΔH/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs

  15. Interest of lymphoscintigraphy with 99sup(m)Tc-labelled antimony sulfide in the arms after breast carcinoma treatment

    International Nuclear Information System (INIS)

    2 mCi of antimony sulfide colloid labelled with sup(99m)Tc were injected subcutaneously between the digits in 25 patients with postoperative lymphoedema of the arm for breast carcinoma. The two arms are examined successively, the normal one being used as control. The lymphoscintigraphy is realised with a gamma camera during an hour. The information obtained is threefoled; on the peripheral block's importance, the place where the lymphatic flow is stopped, and the presence in 40% of patients of axillary lymph nodes. The diminution of the lymphatic flow is not in correlation with the lymphoedema's importance. Lymphoscintigraphy with sup(99m)Tc antimony sulfide colloid is a simple examination but some side effects may occur. In 7 patients, post-injection lymphangitis was observed, with favorable evolution under antibiotic treatment. The lymphoscintigraphy can give some interesting information on the evolution of treated lymphoedema

  16. Antimony incorporation in InAs quantum dots grown on GaAs substrate by molecular beam epitaxy

    Science.gov (United States)

    Rihani, J.; Sallet, V.; Christophe, H. J.; Oueslati, M.; Chtourou, R.

    2008-01-01

    We have grown InAs(Sb) quantum dots (QDs) on GaAs (0 0 1) substrates by molecular beam epitaxy (MBE) using two different antimony exposures ( ΦSb). Atomic force microscopy (AFM) and photoluminescence (PL) spectroscopy were carried out to investigate the dot size evolution as function of the incorporated antimony content in InAs/GaAs QDs material. Anomalous asymmetric-band feature was observed in room temperature photoluminescence (RTPL) spectra of the investigated QD samples grown at relatively high temperature (490 °C). From the temperature-dependent PL measurements, it was found that the asymmetric-band feature is associated with the ground-states transitions from QDs with bimodal size distribution. The analysis of the pump power dependent PL spectra allows us to suggest a type II band lineup for the InAsSb/GaAs QDs materials system.

  17. Co-administration of glycyrrhizic acid with the antileishmanial drug sodium antimony gluconate (SAG) cures SAG-resistant visceral leishmaniasis.

    Science.gov (United States)

    Bhattacharjee, Amrita; Majumder, Saikat; Majumdar, Suchandra Bhattacharyya; Choudhuri, Soumitra Kumar; Roy, Syamal; Majumdar, Subrata

    2015-03-01

    Since there are very few affordable antileishmanial drugs available, antimonial resistance has crippled antileishmanial therapy, thereby emphasising the need for development of novel therapeutic strategies. This study aimed to evaluate the antileishmanial role of combined therapy with sodium antimony gluconate (SAG) and the triterpenoid glycyrrhizic acid (GA) against infection with SAG-resistant Leishmania (GE1F8R). Combination therapy with GA and SAG successfully limited infection with SAG-resistant Leishmania in a synergistic manner (fractional inhibitory concentration index resistant Leishmania and co-treated with GA and SAG exhibited a significant reduction in hepatic and splenic parasite burden. In probing the mechanism, it was observed that GA treatment suppressed the expression and efflux activity of P-glycoprotein (P-gp) and multidrug resistance-associated protein 1 (MRP1), two host ABC transporters responsible for antimony efflux from host cells infected with SAG-resistant parasites. This suppression correlated with greater intracellular antimony retention during SAG therapy both in vitro and in vivo, which was reflected in the reduced parasite load. Furthermore, co-administration of GA and SAG induced a shift in the cytokine balance towards a Th1 phenotype by augmenting pro-inflammatory cytokines (such as IL-12, IFNγ and TNFα) and inducing nitric oxide generation in GE1F8R-infected macrophages as well as GE1F8R-infected mice. This study aims to provide an affordable leishmanicidal alternative to expensive antileishmanial drugs such as miltefosine and amphotericin B. Furthermore, this report explores the role of GA as a resistance modulator in MRP1- and P-gp-overexpressing conditions. PMID:25600891

  18. The Potential Impact of Biofield Energy Treatment on the Atomic and Physical Properties of Antimony Tin Oxide Nanopowder

    OpenAIRE

    Trivedi, Mahendra Kumar

    2015-01-01

    Antimony tin oxide (ATO) is known for its high thermal conductivity, optical transmittance, and wide energy band gap, which makes it a promising material for the display devices, solar cells, and chemical sensor industries. The present study was undertaken to evaluate the effect of biofield energy treatment on the atomic and physical properties of ATO nanopowder. The ATO nanopowder was divided into two parts: control and treated. The treated part was subjected to Mr. Trivedi’s biofield ...

  19. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony

    OpenAIRE

    D. Medlen; D. Bolibruchova

    2012-01-01

    The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eut...

  20. EFFECT OF GRAIN BOUNDARY SEGREGATION OF ANTIMONY ON RELAXATION AT GRAIN BOUNDARIES IN SILICON-IRON ALLOYS

    OpenAIRE

    Iwasaki, Y.; Fujimoto, K

    1981-01-01

    A sharp grain boundary peak appears in both 2 and 3% silicon-iron alloys due to a substitutional solute of silicon. This peak is highly sensitive to the segregation of the third element of antimony and, contrary to orthodox solute peaks in binary and ternary alloys, largely decreases in magnitude on heating after a segregation treatment. The subsequent measurement on cooling returns the peak to the ordinary magnitude. As a function of annealing time at a temperature of segregation, the height...

  1. Exploring screen printing technology on thermoelectric energy harvesting with printing copper-nickel and bismuth-antimony thermocouples

    OpenAIRE

    Cao, Zhuo; Koukharenko, Elena; Torah, R; Beeby, SP

    2013-01-01

    This paper reports the fabrication and testing of copper (Cu) - nickel (Ni) and bismuth (Bi) - antimony (Sb) based thermocouples fabricated using screen printing technology. The transport properties of the printed thermoelectric material were measured in room temperature while the Seebeck voltage and power output of the printed thermocouples were tested under a variety temperature gradient. Initial thermoelectric materials have been integrated in inks and then deposited on substrate by the si...

  2. Potentiometric stripping analysis of antimony based on carbon paste electrode modified with hexathia crown ether and rice husk

    International Nuclear Information System (INIS)

    Highlights: → Potentiometric stripping analysis (PSA) employed for the determination of antimony. → Hexathia-18C6 and rice husk modified carbon paste electrode developed for the analysis. → Lowest detection limit obtained for the determination of Sb(III) using PSA. → Analysis of Sb in pharmaceutical formulations, human hair, blood serum, urine and sea water. → Rice husk used as a modifier for the first time in electrochemistry. - Abstract: An electrochemical method based on potentiometric stripping analysis (PSA) employing a hexathia 18C6 (HT18C6) and rice husk (RH) modified carbon paste electrode (HT18C6-RH-CPE) has been proposed for the subnanomolar determination of antimony. The characterization of the electrode surface has been carried out by means of scanning electron microscopy, cyclic voltammetry, electrochemical impedance spectroscopy and chronocoulometry. By employing HT18C6-RH-CPE, a 12-fold enhancement in the PSA signal (dt/dE) was observed as compared to plain carbon paste electrode (PCPE). Under the optimized conditions, dt/dE (s V-1) was proportional to the Sb(III) concentration in the range of 1.42 x 10-8 to 6.89 x 10-11 M (r = 0.9944) with the detection limit (S/N = 3) of 2.11 x 10-11 M. The practical analytical utilities of the modified electrode were demonstrated by the determination of antimony in pharmaceutical formulations, human hair, sea water, urine and blood serum samples. The prepared modified electrode showed several advantages, such as simple preparation method, high sensitivity, very low detection limit and excellent reproducibility. Moreover, the results obtained for antimony analysis in commercial and real samples using HT18C6-RH-CPE and those obtained by inductively coupled plasma-atomic emission spectrometry (ICP-AES) are in agreement at the 95% confidence level.

  3. Potentiometric stripping analysis of antimony based on carbon paste electrode modified with hexathia crown ether and rice husk

    Energy Technology Data Exchange (ETDEWEB)

    Gadhari, Nayan S.; Sanghavi, Bankim J. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India); Srivastava, Ashwini K., E-mail: aksrivastava@chem.mu.ac.in [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India)

    2011-10-03

    Highlights: {yields} Potentiometric stripping analysis (PSA) employed for the determination of antimony. {yields} Hexathia-18C6 and rice husk modified carbon paste electrode developed for the analysis. {yields} Lowest detection limit obtained for the determination of Sb(III) using PSA. {yields} Analysis of Sb in pharmaceutical formulations, human hair, blood serum, urine and sea water. {yields} Rice husk used as a modifier for the first time in electrochemistry. - Abstract: An electrochemical method based on potentiometric stripping analysis (PSA) employing a hexathia 18C6 (HT18C6) and rice husk (RH) modified carbon paste electrode (HT18C6-RH-CPE) has been proposed for the subnanomolar determination of antimony. The characterization of the electrode surface has been carried out by means of scanning electron microscopy, cyclic voltammetry, electrochemical impedance spectroscopy and chronocoulometry. By employing HT18C6-RH-CPE, a 12-fold enhancement in the PSA signal (dt/dE) was observed as compared to plain carbon paste electrode (PCPE). Under the optimized conditions, dt/dE (s V{sup -1}) was proportional to the Sb(III) concentration in the range of 1.42 x 10{sup -8} to 6.89 x 10{sup -11} M (r = 0.9944) with the detection limit (S/N = 3) of 2.11 x 10{sup -11} M. The practical analytical utilities of the modified electrode were demonstrated by the determination of antimony in pharmaceutical formulations, human hair, sea water, urine and blood serum samples. The prepared modified electrode showed several advantages, such as simple preparation method, high sensitivity, very low detection limit and excellent reproducibility. Moreover, the results obtained for antimony analysis in commercial and real samples using HT18C6-RH-CPE and those obtained by inductively coupled plasma-atomic emission spectrometry (ICP-AES) are in agreement at the 95% confidence level.

  4. MicroRNA-138 promotes acquired alkylator resistance in glioblastoma by targeting the Bcl-2-interacting mediator BIM.

    Science.gov (United States)

    Stojcheva, Nina; Schechtmann, Gennadi; Sass, Steffen; Roth, Patrick; Florea, Ana-Maria; Stefanski, Anja; Stühler, Kai; Wolter, Marietta; Müller, Nikola S; Theis, Fabian J; Weller, Michael; Reifenberger, Guido; Happold, Caroline

    2016-03-15

    Glioblastoma is the most aggressive brain tumor in adults with a median survival below 12 months in population-based studies. The main reason for tumor recurrence and progression is constitutive or acquired resistance to the standard of care of surgical resection followed by radiotherapy with concomitant and adjuvant temozolomide (TMZ/RT→TMZ). Here, we investigated the role of microRNA (miRNA) alterations as mediators of alkylator resistance in glioblastoma cells. Using microarray-based miRNA expression profiling of parental and TMZ-resistant cultures of three human glioma cell lines, we identified a set of differentially expressed miRNA candidates. From these, we selected miR-138 for further functional analyses as this miRNA was not only upregulated in TMZ-resistant versus parental cells, but also showed increased expression in vivo in recurrent glioblastoma tissue samples after TMZ/RT→TMZ treatment. Transient transfection of miR-138 mimics in glioma cells with low basal miR-138 expression increased glioma cell proliferation. Moreover, miR-138 overexpression increased TMZ resistance in long-term glioblastoma cell lines and glioma initiating cell cultures. The apoptosis regulator BIM was identified as a direct target of miR-138, and its silencing mediated the induced TMZ resistance phenotype. Altered sensitivity to apoptosis played only a minor role in this resistance mechanism. Instead, we identified the induction of autophagy to be regulated downstream of the miR-138/BIM axis and to promote cell survival following TMZ exposure. Our data thus define miR-138 as a glioblastoma cell survival-promoting miRNA associated with resistance to TMZ therapy in vitro and with tumor progression in vivo. PMID:26887050

  5. Separation of Lead from Crude Antimony by Pyro-Refining Process with NaPO3 Addition

    Science.gov (United States)

    Ye, Longgang; Hu, Yuejie; Xia, Zhimei; Chen, Yongming

    2016-06-01

    The main purpose of this study was to separate lead from crude antimony through an oxidation pyro-refining process and by using sodium metaphosphate as a lead elimination reagent. The process parameters that will affect the refining results were optimized experimentally under controlled conditions, such as the sodium metaphosphate charging dosage, the refining temperature and duration, and the air flow rate, to determine their effect on the lead content in refined antimony and the lead removal rate. A minimum lead content of 0.0522 wt.% and a 98.6% lead removal rate were obtained under the following optimal conditions: W_{{{NaPO}_{{3}} }} = 15% W Sb (where W represents weight), a refining temperature of 800°C, a refining time of 30 min, and an air flow rate of 3 L/min. X-ray diffractometry and scanning electron microscopy showed that high-purity antimony was obtained. The smelting operation is free from smoke or ammonia pollution when using monobasic sodium phosphate or ammonium dihydrogen phosphate as the lead elimination reagent. However, this refining process can also remove a certain amount of sulfur, cobalt, and silicon simultaneously, and smelting results also suggest that sodium metaphosphate can be used as a potential lead elimination reagent for bismuth and copper refining.

  6. Evaluation of potential dietary toxicity of heavy metals in some common Nigerian beverages: A look at antimony, tin and mercury

    Directory of Open Access Journals (Sweden)

    I.I. Roberts

    2011-11-01

    Full Text Available There is currently little information on the composition of heavy metals in beverages imported and locally produced in Nigeria. The study quantitatively determined the composition of antimony (Sb, tin (Sn and mercury (Hg in 50 different beverage samples and evaluated the extent of violation of guideline values. Analysis of the beverage samples for the presence of Sb, Sn, and Hg was carried out using an atomic absorption spectrophotometer (AAS 929. The mean values detected for mercury, tin and antimony (±SE in fruit juices and soft drinks were 2.39±0.25, 3.66±0.22 and 0.49±0.048 μg/l; 2.93±0.34, 3.60±0.46 and 0.49±0.10 μg/l in dairy drinks and 0.94±0.02, 4.34±0.48 and 0.48±0.05 μg/l in bottled water samples respectively. While antimony detected in all products was below guideline values, mercury and tin were above the acceptable levels established by the World Health Organization, United States Environmental Protection Agency and European Union in most samples tested.

  7. Distribution, speciation and availability of antimony (Sb) in soils and terrestrial plants from an active Sb mining area

    International Nuclear Information System (INIS)

    Here, we present one of the first studies investigating the mobility, solubility and the speciation-dependent in-situ bioaccumulation of antimony (Sb) in an active Sb mining area (Xikuangshan, China). Total Sb concentrations in soils are high (527-11,798 mg kg-1), and all soils, including those taken from a paddy field and a vegetable garden, show a high bioavailable Sb fraction (6.3-748 mg kg-1), dominated by Sb(V). Elevated concentrations in native plant species (109-4029 mg kg-1) underpin this. Both chemical equilibrium studies and XANES data suggest the presence of Ca[Sb(OH)6]2, controlling Sb solubility. A very close relationship was found between the citric acid extractable Sb in plants and water or sulfate extractable Sb in soil, indicating that citric acid extractable Sb content in plants may be a better predictor for bioavailable Sb in soil than total acid digestible Sb plant content. - Highlights: → Antimony (Sb) in soils from an active Sb mining area is highly bioavailable. → Sb occurs mainly as Sb(V) in Sb mining impacted soils and plants. → Sb solubility in Sb mining impacted soils is governed by Ca[Sb(OH)6]2. → Citric acid extractable Sb in plants and bioavailable Sb in soils are strongly correlated. - Antimony (Sb) in soils from an active Sb mining area is highly bioavailable and controlled by the solubility of calcium antimonate.

  8. Distribution, speciation and availability of antimony (Sb) in soils and terrestrial plants from an active Sb mining area

    Energy Technology Data Exchange (ETDEWEB)

    Okkenhaug, Gudny, E-mail: go@ngi.no [Norwegian University of Life Sciences, Department of Plant and Environmental Sciences, P.O. Box 5003, N-1432 As (Norway); Norwegian Geotechnical Institute, P.O. Box 3930, Ullevaal Stadion, NO-0806 Oslo (Norway); Zhu Yongguan [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Luo Lei [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Lei Ming [College of Resource and Environment, Hunan Agricultural University, Changsha 410128 (China); Li Xi [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Mulder, Jan [Norwegian University of Life Sciences, Department of Plant and Environmental Sciences, P.O. Box 5003, N-1432 As (Norway)

    2011-10-15

    Here, we present one of the first studies investigating the mobility, solubility and the speciation-dependent in-situ bioaccumulation of antimony (Sb) in an active Sb mining area (Xikuangshan, China). Total Sb concentrations in soils are high (527-11,798 mg kg{sup -1}), and all soils, including those taken from a paddy field and a vegetable garden, show a high bioavailable Sb fraction (6.3-748 mg kg{sup -1}), dominated by Sb(V). Elevated concentrations in native plant species (109-4029 mg kg{sup -1}) underpin this. Both chemical equilibrium studies and XANES data suggest the presence of Ca[Sb(OH){sub 6}]{sub 2}, controlling Sb solubility. A very close relationship was found between the citric acid extractable Sb in plants and water or sulfate extractable Sb in soil, indicating that citric acid extractable Sb content in plants may be a better predictor for bioavailable Sb in soil than total acid digestible Sb plant content. - Highlights: > Antimony (Sb) in soils from an active Sb mining area is highly bioavailable. > Sb occurs mainly as Sb(V) in Sb mining impacted soils and plants. > Sb solubility in Sb mining impacted soils is governed by Ca[Sb(OH){sub 6}]{sub 2}. > Citric acid extractable Sb in plants and bioavailable Sb in soils are strongly correlated. - Antimony (Sb) in soils from an active Sb mining area is highly bioavailable and controlled by the solubility of calcium antimonate.

  9. Precipitation of antimony from the solution of sodium thioantimonite by air oxidation in the presence of catalytic agents

    Institute of Scientific and Technical Information of China (English)

    杨天足; 赖琼琳; 唐建军; 楚广

    2002-01-01

    The behavior of antimony oxidation in the solution of sodium thioantimonite was studied in the presence of catalytic agents. The catalytic effects of the respective addition of cupric sulfate, sodium tartrate, potassium permanganate, phenol, 1,2-dihydroxybenzene and their combination on the oxidation of sodium thioantimonite were investigated. A pilot test was carried out. The results show that the respective use of sodium tartrate, cupric sulfate, potassium permanganate, phenol and 1,2-dihydroxybenzene have little catalytic effect on the oxidation of sodium thioantimonite. However there exists obvious catalytic oxidation by the combination of 0.25 g/L 1,2-dihydroxybenzene, 0.5 g/L potassium permanganate and 1.0 g/L phenol. Moreover, high blast intensity, the increase of temperature and NaOH concentration favor the oxidation of antimony. The oxidation process of antimony has such advantages as quick reaction and low operation costs. The results of the pilot test are consistent with those of laboratory experiments.

  10. PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

    DEFF Research Database (Denmark)

    Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie

    2000-01-01

    The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all...... environmental matrixes including human adipose tissue, blood and milk. In most biological extracts PCB#138 (2,2',3,4,4',5-hexaCB), PCB#153 (2,2',4,4',5,5'-hexaCB), and PCB#180 (2,2',3,4,4',5,5'-heptaCB) are the dominating components. Depending on the position and number of chlorine substitutions, different...... classes of PCB congeners elicit a complex spectrum of biological and toxic responses in in vivo and in vitro models. Some PCBs exert dioxin-like activities mediated through the aryl hydrocarbon receptor (Ah receptor) giving rise to health risk such as organ toxicity and carcinogenesis. Although reports on...

  11. Significant decrease in yield under future climate conditions: Stability and production of 138 spring barley accessions

    DEFF Research Database (Denmark)

    Ingvordsen, Cathrine Heinz; Backes, Gunter; Lyngkjær, Michael Foged;

    2015-01-01

    The response in production parameters to projected future levels of temperature, atmospheric carbondioxide ([CO2]), and ozone ([O3]) was investigated in 138 spring barley accessions. The comprehensive setof landraces, cultivars, and breeder-lines, were during their entire life cycle exposed to a...... two-factor treat-ment of combined elevated temperature (+5◦C day/night) and [CO2] (700 ppm), as well as single-factortreatments of elevated temperature (+5◦C day/night), [CO2] (700 ppm), and [O3] (100–150 ppb). Thecontrol treatment was equivalent to present average South Scandinavian climate...... (temperature: 19/12◦C(day/night), [CO2]: 385 ppm). Overall grain yield was found to decrease 29% in the two-factor treatmentwith concurrent elevation of [CO2] and temperature, and this response could not be predicted from theresults of treatments with elevated [CO2] and temperature as single factors, where...

  12. Investigation of thermal neutron capture in 23Na, 138Ba, 140Ce and 142Ce

    International Nuclear Information System (INIS)

    A measurement of the angular correlation of γ-rays emitted in the capture of thermal neutrons in 23Na has been used to determine the multipole mixing ratio delta for seventeen transitions in 24Na, of which seven are primary transitions. For these primary transitions also the capture state spin admixture α has been derived. The neutron capture reaction proceeds predominantly through the Jsup(π)=1+ channel, as expected from previous cross-section measurements. A measurement of the circular polarization of γ-rays resulting from the capture of polarized thermal neutrons in 138Ba, 140Ce and 142Ce has yielded spin assignments for p-states in the final nuclei. Excitation energies and reaction Q-values have been obtained from the analysis of singles spectra taken with unpolarized neutrons. (Auth.)

  13. Interactions of collective and particle excitations in the nucleus 138Ce

    International Nuclear Information System (INIS)

    The nucleus 138Ce was produced by the compound-nucleus reactions 139La(p,2n), Ep = 18-27 MeV, 136Ba(α,2n), Eα = 24-25 MeV, and 124Sn(18O,4n), EO = 62-74 MeV. By means of these reactions each γ-γ coincidences, angular distributions, conversion electrons, and excitation functions (except the (α,2n) reaction) were measured. A term scheme resulting from these measurement was established. 14 new states and 10 new spins below 3.5 MeV and 13 new states and 6 new spins above 3.5 MeV were determined. A life-time measurement was performed with the (p,2n) reaction at 18 MeV. New isomers with half-lives between 3 ns and 50 ns could not be detected. By means of angular distribution, conversion and excitation function spin and parity of the level at 3539 keV could be fixed to 10+. By this a reduced transition probability for the 430-keV transition from the 3539-keV level to the 3109-keV level of B(E2) = 0.46(1) e2(fm)4 respectively 0.01 Weisskopf units results. By means of a Coulomb excitation the reduced transition probability of the ground-state transition in 138Ce was determined to B(E2) = 910(70)e2(fm)4. (orig./HSI)

  14. Preparation of antimony sulfide semiconductor nanoparticles by pulsed laser ablation in liquid

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Ren-De, E-mail: son003@sekisui.com [Research & Development Institute, High Performance Plastics Company, Sekisui Chemical Co., Ltd. 2-1 Hyakuyama, Shimamoto-Cho, Mishima-Gun, Osaka, 618-0021 (Japan); Tsuji, Takeshi [Interdisciplinary Graduate School of Science and Engineering, Shimane University, 1060 Nishikawatsu-Cho, Matsue, 690-8504 (Japan)

    2015-09-01

    Highlights: • Pulsed laser ablation in liquid (LAL) was applied to prepare antimony sulfide nanoparticles (Sb{sub 2}S{sub 3} NPs). • Sb{sub 2}S{sub 3} NPs with a stoichiometric composition were successfully prepared by LAL in water without using any surfactants or capping agents. • Thus-prepared Sb{sub 2}S{sub 3} NPs showed low-temperature crystallization and melting at a temperature low as 200 °C. • The NPs-coated Sb{sub 2}S{sub 3} thin film showed comparable semiconductor properties (carrier mobility and carrier density) to the vacuum deposited one. • Byproducts such as CS{sub 2}, CH{sub 4} and CO were detected by GC-MS analysis when LAL was performed in organic solvent. • The LAL-induced decomposition mechanism of Sb{sub 2}S{sub 3} and organic solvents was discussed based on the GC-MS results. - Abstract: In this paper, we report on the synthesis of antimony sulfide (Sb{sub 2}S{sub 3}) semiconductor nanoparticles by pulsed laser ablation in liquid without using any surfactants or capping agents. Different results were obtained in water and organic solvents. In the case of water, Sb{sub 2}S{sub 3} nanoparticles with chemical compositions of stoichiometry were successfully prepared when laser irradiation was performed under the condition with the dissolved oxygen removed by argon gas bubbling. It was shown that thus-obtained Sb{sub 2}S{sub 3} nanoparticles exhibit features of not only low-temperature crystallization but also low-temperature melting at a temperature as low as 200 °C. Nanoparticle-coated Sb{sub 2}S{sub 3} thin films were found to show good visible light absorption and satisfying semiconductor properties (i.e., carrier mobility and density), which are essential for photovoltaic application. On the other hand, in the case of organic solvents (e.g., acetone, ethanol), such unexpected byproducts as CS{sub 2}, CO and CH{sub 4} were detected from the reaction system by GC-MS analysis, which suggests that both Sb{sub 2}S{sub 3} and organic

  15. Efficient green and red fluorescence upconversion in erbium doped new low phonon antimony glasses

    Science.gov (United States)

    Som, Tirtha; Karmakar, Basudeb

    2009-02-01

    New K 2O-B 2O 3-Sb 2O 3 (KBS) glass system having low phonon energy (about 600 cm -1) doped with Er 3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K 2O-15B 2O 3-70Sb 2O 3 (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Er 2O 3. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 798 nm at room temperature. Three upconverted bands originating from the 2H 11/2 → 4I 15/2, 4S 3/2 → 4I 15/2 and 4F 9/2 → 4I 15/2 transitions are found to be centered at 522 (green, very weak), 536 (green, medium) and 645 (red, strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (down conversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross relaxation (CR) mechanisms involving population of the metastable (storage) energy levels ( 2H 11/2, 4S 3/2 and 4F 9/2) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their high intense low phonon energy (602 cm -1) which is very close to that of fluoride glasses (500-600 cm -1). We are the first to report the upconversion fluorescence of Er 3+ ions in KBS antimony glasses.

  16. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India)], E-mail: basudebk@cgcri.res.in

    2008-12-15

    A new antimony-based glass system (K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3}) having low phonon energy (about 600 cm{sup -1}) doped with Sm{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm{sub 2}O{sub 3}. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 5/2}, {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} and {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 9/2} transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 5/2}) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  17. A study on low cost-high conducting fluorine and antimony-doped tin oxide thin films

    International Nuclear Information System (INIS)

    Thin films of undoped, fluorine- and antimony-doped tin oxide on glass at 400 deg. C was prepared by spray pyrolysis technique. Tin chloride (SnCl2), ammonium fluoride (NH4F), and antimony trichloride (SbCl3) were used as source for tin (Sn), fluorine (F), and antimony (Sb), respectively. To ensure the control of solution concentration on growth rate, fluorine-doped tin oxide (SnO2:F) thin films were first prepared with different amount of tin precursor, in the range of 5-12g, which has resulted in deposition of films with different thickness values. The optimum amount of tin precursor found from this study (11g) was fixed constant for preparing SnO2 films with different doping levels of F and Sb. From the X-ray diffraction analyses, it is understood that the preferred orientation of SnO2:F films is dependent on their thickness and the solution concentration. The variation in the solution concentration and orientation of the films was reflected in their morphology as examined by scanning electron microscopy (SEM) and atomic force microscopy (AFM). SEM studies showed that the variation in the solution concentration lead to different grain shapes for different orientations. The AFM study showed that the RMS roughness of undoped films reduced considerably from 86 to 24nm due to fluorine doping (15wt.%), whereas the antimony doping (2wt.%) has no significance effect on RMS roughness (93nm). The electrical properties of the films were examined by a Hall measurements setup in van der Pauw configuration. A minimum sheet resistance of 1.75 and 2.17Ω/ were obtained for F and Sb doped films, respectively. From the optical studies, it is found that the transmittance of undoped films increased from 42% to a maximum 85% on 30wt.% fluorine doping, whereas that has been decreased to a minimum of 12% on 4wt.% antimony doping (800nm). A discussion on the effect of type of dopants and their concentration on the structural, electrical and optical properties of the SnO2 film have

  18. Development of a MSFIA system for sequential determination of antimony, arsenic and selenium using hydride generation atomic fluorescence spectrometry.

    Science.gov (United States)

    de Santana, Fernanda A; Portugal, Lindomar A; Serra, Antonio M; Ferrer, Laura; Cerdà, Víctor; Ferreira, Sergio L C

    2016-08-15

    This paper proposed a multisyringe flow injection analysis (MSFIA) system for antimony, arsenic and selenium determination in peanut samples by hydride generation atomic fluorescence spectrometry (HG-AFS). The optimization step of the hydride generation was performed using a two-level full factorial design involving the parameters: hydrochloric acid, sodium tetrahydroborate and potassium iodide concentrations. So, using the chemical conditions optimized, this method allows the determination of these elements employing the external calibration technique using aqueous standards with limits of detection and quantification of 0.04 and 0.14µgL(-1) for antimony, 0.04 and 0.14µgL(-1) for arsenic and 0.14 and 0.37µgL(-1) for selenium, respectively. Additionally, the effect of vanadium, chromium, cobalt, nickel, zinc, copper, iron and molybdenum on the generation of chemical vapour was also studied. The precision expressed as relative standard deviation varied from 1.2 to 3.6% for antimony, 1.8-3.9% for arsenic and 1.8-2% for selenium. The accuracy for arsenic and selenium was confirmed using the certified peach leaves reference material SRM 1547 produced by National Institute of Standard and Technology. The proposed method showed 45 injection throughput (h(-1)) using 1.6mL sample volume for each element, 0.8mL NaBH4 0.5% (w/v) containing NaOH 0.05% (w/v), 0.8mL HCl 5M and 0.4mL KI 14% (w/v) containing L-ascorbic acid 2.5% (w/v). The method was applied to the determination of antimony, arsenic and selenium in peanut samples, which were firstly lyophilized and afterward digested using microwave assisted radiation. Six samples were analyzed and the contents of the elements found were: 28.7-41.3µgkg(-1) for arsenic, 86.4-480.1µgkg(-1) for selenium and 32.6-52.4µgkg(-1) for antimony. Addition/recovery tests were also performed to confirm the method accuracy for the three elements. PMID:27260431

  19. Cirrus cloud detection from airborne imaging spectrometer data using the 1.38 micron water vapor band

    Science.gov (United States)

    Gao, Bo-Cai; Goetz, Alexander F. H.; Wiscombe, Warren J.

    1993-01-01

    Using special images acquired by the Airborne Visible/Infrared Imaging Spectrometer (AVIRIS) at 20 km altitude, we show that wavelengths close to the center of the strong 1.38 micron water vapor band are useful for detecting thin cirrus clouds. The detection makes use of the fact that cirrus clouds are located above almost all the atmospheric water vapor. Because of the strong water vapor absorption in the lower atmosphere, AVIRIS channels near 1.38 micron receive little scattered solar radiance from the surface of low level clouds. When cirrus clouds are present, however, these channels receive large amounts of scattered solar radiance from the cirrus clouds. Our ability to determine cirrus cloud cover using space-based remote sensing will be improved if channels near the center of the 1.38 micron water vapor band are added to future satellites.

  20. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    International Nuclear Information System (INIS)

    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with ∼0.45 and 0.021 mmol L-1 total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb2O3. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  1. Suppression of the vapor-liquid-solid growth of silicon nanowires by antimony addition.

    Science.gov (United States)

    Nimmatoori, Pramod; Zhang, Qi; Dickey, Elizabeth C; Redwing, Joan M

    2009-01-14

    The effect of Sb addition on the growth rate and structural properties of Si nanowires synthesized by vapor-liquid-solid growth was investigated. The nanowire growth rate was reduced by an order of magnitude following the addition of a low concentration pulse of trimethylantimony (TMSb) to the gas phase during growth. Transmission electron microscopy analysis revealed that the wires had a thick amorphous coating ( approximately 8 nm) around the catalyst particle and a distorted catalyst shape. Energy-dispersive x-ray spectroscopy showed the presence of trace amounts of Sb in the amorphous coating around the catalyst and at the catalyst-wire interface. Antimony was also found to be incorporated in the Si nanowires with a peak in the Sb concentration measured at the initial point where the TMSb pulse was added to the gas stream. The significant reduction in wire growth rate was attributed to Sb segregation at the vapor-liquid and liquid-solid interfaces which results in a change in interfacial energies and a reduction in the rate of Si incorporation at these interfaces. PMID:19417276

  2. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells.

    Science.gov (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya

    2015-08-17

    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells. PMID:26237216

  3. Assessment and distribution of antimony in soils around three coal mines, Anhui, China

    Science.gov (United States)

    Qi, C.; Liu, Gaisheng; Kang, Y.; Lam, P.K.S.; Chou, C.

    2011-01-01

    Thirty-three soil samples were collected from the Luling, Liuer, and Zhangji coal mines in the Huaibei and Huainan areas of Anhui Province, China. The samples were analyzed for antimony (Sb) by inductively coupled plasmaoptical emission spectrometry (ICP-OES) method. The average Sb content in the 33 samples was 4 mg kg-1, which is lower than in coals from this region (6.2 mg kg-1). More than 75% of the soils sampled showed a significant degree of Sb pollution (enrichment factors [EFs] 5-20). The soils collected near the gob pile and coal preparation plant were higher in Sb content than those collected from residential areas near the mines. The gob pile and tailings from the preparation plant were high in mineral matter content and high in Sb. They are the sources of Sb pollution in surface soils in the vicinity of coal mines. The spatial dispersion of Sb in surface soil in the mine region shows that Sb pollution could reach out as far as 350 m into the local environment conditions. Crops in rice paddies may adsorb some Sb and reduce the Sb content in soils from paddyfields. Vertical distribution of Sb in two soil profiles indicates that Sb is normally relatively immobile in soils. ?? 2011 Air & Waste Management Association.

  4. Antimony nanoparticles anchored in three-dimensional carbon network as promising sodium-ion battery anode

    Science.gov (United States)

    Luo, Wen; Zhang, Pengfei; Wang, Xuanpeng; Li, Qidong; Dong, Yifan; Hua, Jingchen; Zhou, Liang; Mai, Liqiang

    2016-02-01

    A novel composite with antimony (Sb) nanoparticles anchored in three-dimensional carbon network (denoted as SbNPs@3D-C) is successfully synthesized via a NaCl template-assisted self-assembly strategy, followed by freeze-drying and one-step in-situ carbonization. The three-dimensional interconnected macroporous carbon framework can not only stabilize the architecture and buffer the volume expansion for Sb nanoparticles, but also provide high electrical conductivity for the whole electrode. Consequently, as a sodium-ion battery anode, the SbNPs@3D-C delivers a high reversible capacity (456 mAh g-1 at 100 mA g-1), stable cycling performance (94.3% capacity retention after 500 cycles at 100 mA g-1) as well as superior rate capability (270 mAh g-1 at 2000 mA g-1). When compared with commercial Sb particles, the SbNPs@3D-C exhibits dramatically enhanced electrochemical performance. Free from expensive template sources and complex manipulation, this work might shed some light on the synthesis of low-cost and high-performance materials for the next "beyond lithium" battery generation.

  5. Antimony uptake, translocation and speciation in rice plants exposed to antimonite and antimonate.

    Science.gov (United States)

    Ren, Jing-Hua; Ma, Lena Q; Sun, Hong-Jie; Cai, Fei; Luo, Jun

    2014-03-15

    Antimony (Sb) accumulation in rice is a potential threat to human health, but its uptake mechanisms are unclear. A hydroponic experiment was conducted to investigate uptake, translocation, speciation and subcellular distribution of Sb in rice plants exposed to antimonite (SbIII) and antimonate (SbV) at 0.2, 1.0 or 5.0 mg/L for 4h. More Sb was accumulated in iron plaque than in the plant, with both the roots (~10-12 times) and Fe plaque (~28-54 times) sequestering more SbIII than SbV. The presence of iron plaque decreased uptake of both SbV and SbIII. SbIII uptake kinetics fitted better to the Michaelis-Menten function than SbV. Antimonate (56 to 98%) was the predominant form in rice plant with little methylated species being detected using HPLC-ICP-MS. Cell walls accumulated more Sb than organelles and cytosol, which were considered as the first barrier against Sb entering into cells. Sb transformation and subcellular distribution can help to understand the metabolic mechanisms of Sb in rice. PMID:24419289

  6. A new method for antimony speciation in plant biomass and nutrient media using anion exchange cartridge.

    Science.gov (United States)

    Tisarum, Rujira; Ren, Jing-Hua; Dong, Xiaoling; Chen, Hao; Lessl, Jason T; Ma, Lena Q

    2015-11-01

    A selective separation method based on anion exchange cartridge was developed to determine antimony (Sb) speciation in biological matrices by graphite furnace atomic absorption spectrophotometry (GFAAS). The selectivity of the cartridge towards antimonite [Sb(III)] and antimonate [Sb(V)] reversed in the presence of deionized (DI) water and 2mM citric acid. While Sb(V) was retained by the cartridge in DI water, Sb(III) was retained in citric acid media. At pH 6, Sb(III) and Sb(V) formed Sb(III)- and Sb(V)-citrate complexes, but the cartridge had higher affinity towards the Sb(III)-citrate complex. Separation of Sb(III) was tested at various concentrations in fresh and spent growth media and plant tissues. Our results showed that cartridge-based Sb speciation was successful in plant tissues, which was confirmed by HPLC-ICP-MS. The cartridge retained Sb(III) and showed 92-104% Sb(V) recovery from arsenic hyperaccumulator Pteris vittata roots treated with Sb(III) and Sb(V). The cartridge procedure is an effective alternative for Sb speciation, offering low cost, reproducible results, and simple Sb analysis using GFAAS. PMID:26452943

  7. Antimony release from contaminated mine soils and its migration in four typical soils using lysimeter experiments.

    Science.gov (United States)

    Shangguan, Yu-Xian; Zhao, Long; Qin, Yusheng; Hou, Hong; Zhang, Naiming

    2016-11-01

    Antimony (Sb) can pose great risks to the environment in mining and smelting areas. The migration of Sb in contaminated mine soil was studied using lysimeter experiments. The exchangeable concentration of soil Sb decreased with artificial leaching. The concentrations of Sb retained in the subsoil layers (5-25cm deep) were the highest for Isohumosol and Ferrosol and the lowest for Sandy soil. The Sb concentrations in soil solutions decreased with soil depth, and were adequately simulated using a logarithmic function. The Sb migration pattern in Sandy soil was markedly different from the patterns in the other soils which suggested that Sb may be transported in soil colloids. Environmental factors such as water content, soil temperature, and oxidation-reduction potential of the soil had different effects on Sb migration in Sandy soil and Primosol. The high Fe and Mn contents in Ferrosol and Isohumosol significantly decreased the mobility of Sb in these soils. The Na and Sb concentrations in soils used in the experiments positively correlated with each other (PPrimosol>Isohumosol>Ferrosol, and we concluded that the Sb mobility in the soils also decreased in that order. PMID:27395817

  8. Enhanced hematite water electrolysis using a 3D antimony-doped tin oxide electrode.

    Science.gov (United States)

    Moir, Jonathon; Soheilnia, Navid; O'Brien, Paul; Jelle, Abdinoor; Grozea, Claudia M; Faulkner, Daniel; Helander, Michael G; Ozin, Geoffrey A

    2013-05-28

    We present herein an example of nanocrystalline antimony-doped tin oxide (nc-ATO) disordered macroporous "inverse opal" 3D electrodes as efficient charge-collecting support structures for the electrolysis of water using a hematite surface catalyst. The 3D macroporous structures were created via templating of polystyrene spheres, followed by infiltration of the desired precursor solution and annealing at high temperature. Using cyclic voltammetry and electrochemical impedance spectroscopy, it was determined that the use of this 3D transparent conducting oxide with a hematite surface catalyst allowed for a 7-fold increase in active surface area for water splitting with respect to its 2D planar counterpart. This ratio of surface areas was evaluated based on the presence of oxidized trap states on the hematite surface, as determined from the equivalent circuit analysis of the Nyquist plots. Furthermore, the presence of nc-ATO 2D and 3D "underlayer" structures with hematite deposited on top resulted in decreased charge transfer resistances and an increase in the number of available active surface sites at the semiconductor-liquid junction when compared to hematite films lacking any nc-ATO substructures. Finally, absorption, transmission, and reflectance spectra of all of the tested films were measured, suggesting the feasibility of using 3D disordered structures in photoelectrochemical reactions, due to the high absorption of photons by the surface catalyst material and trapping of light within the structure. PMID:23581965

  9. Spark Plasma Sintering and Densification Mechanisms of Antimony-Doped Tin Oxide Nanoceramics

    Directory of Open Access Journals (Sweden)

    Junyan Wu

    2013-01-01

    Full Text Available Densification of antimony-doped tin oxide (ATO ceramics without sintering aids is very difficult, due to the volatilization of SnO2, formation of deleterious phases above 1000°C, and poor sintering ability of ATO particles. In this paper, monodispersed ATO nanoparticles were synthesized via sol-gel method, and then ATO nanoceramics with high density were prepared by spark plasma sintering (SPS technology using the as-synthesized ATO nanoparticles without the addition of sintering aids. The effect of Sb doping content on the densification was investigated, and the densification mechanisms were explored. The results suggest that ATO nanoparticles derived from sol-gel method show good crystallinity with a crystal size of 5–20 nm and Sb is incorporated into the SnO2 crystal structure. When the SPS sintering temperature is 1000°C and the Sb doping content is 5 at.%, the density of ATO nanoceramics reaches a maximum value of 99.2%. Densification mechanisms are explored in detail.

  10. Leaching of Antimony (Sb)from Municipal Solid Waste Incineration (MSWI) Residues

    Energy Technology Data Exchange (ETDEWEB)

    Herrmann, Inga

    2004-07-01

    The mobility of antimony (Sb) in municipal solid waste incineration (MSWI) residues often exceeds the limit values stipulated by the European Union. As an ash treatment by washing is conceivable, this work investigated the Sb release from Swedish bottom ash and fly ash when mixed with water. The leaching experiments revealed the factors significantly (a = 0.05) affecting Sb release from the ashes. The following factors were investigated: Liquid to solid ratio (L/S), time, pH, carbonation (treatment with CO{sub 2}), ultrasonics and temperature. The data were evaluated using multiple linear regression (MLR). The impact of the factors could be quantified. The maximum Sb release calculated was 13 mg/kg DM for bottom ash and 51 mg/kg DM for fly ash. The derived models explained the observed data well. Nevertheless, the calculated values were subject to a high uncertainty. For bottom ash, a lowering of the Sb total content of approximately 22% could be achieved. If this also involves a sufficient lowering of the Sb mobility to meet EU limit values could not yet be assessed. Chemical equilibrium calculations were performed to explain the empirical results. However, no solid phases controlling Sb release from the ashes could be identified.

  11. Controlled n-doping in chemical vapour deposition grown graphene by antimony

    International Nuclear Information System (INIS)

    We have studied the effects of antimony (Sb) doping on graphene grown by chemical vapour deposition without any significant change in its electrical properties. By increasing the metal thickness from 1 to 5 nm, we found a shift in the wave numbers of Raman G and two-dimensional (2D) peaks consistent with n-doping and a change in the Fermi level of the graphene into the conduction band. The relative intensity of the D peak to the G peak did not show a significant change and that of the 2D peak to the G peak remained at a large enough number as a function of metal thickness, implying little degradation by the metal dopants. Transport measurements also confirm the n-doping of graphene through a shift of Dirac point in the transfer characteristics and the quality preservation with little changes in mobility. We also report on the formation of a p–n junction by metal doping on selected areas of the graphene and their electrical properties with transfer characteristics and Hall measurements. (paper)

  12. Evaluation of atmospheric inputs as possible sources of antimony in pregnant women from urban areas.

    Science.gov (United States)

    Fort, Marta; Grimalt, Joan O; Querol, Xavier; Casas, Maribel; Sunyer, Jordi

    2016-02-15

    Antimony and copper are common components of brake linings. The occurrence of these two metals in urban atmospheric aerosols has been related to vehicular use. Urine samples (n=466) taken during the 32nd week of pregnancy were analyzed for Sb and Cu in pregnant women from an urban area (Sabadell, Catalonia, Spain). The geometric mean levels were 0.28 and 13 μg/g creatinine, respectively. Positive significant associations between urine concentrations of Sb and seasonality, intensity of physical exercise, working activities and traffic intensity at their home streets were observed. Cu showed the same trends but without statistical significance. In both cases, the estimated dietary ingestion of these two metals was larger than the inhalation inputs but the difference was much higher for Cu than for Sb. While Sb has no dietary role, Cu is an essential element which is also incorporated into humans through diet. The results suggest that inhalation of atmospheric particles may also constitute a source of Sb in pregnant women and general population of urban areas. PMID:26657384

  13. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, J.T. [Department of Geological Sciences, The University of Texas, Austin, TX 78759 (United States); Bennett, P.C., E-mail: pbennett@mail.utexas.edu [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States); Engel, A.S. [Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803 (United States); Alsina, M.A.; Pasten, P.A. [Departamento de Ingenieria Hidraulica y Ambiental, Pontificia Universidad Catolica de Chile, Santiago (Chile); Milliken, K. [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States)

    2009-04-15

    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with {approx}0.45 and 0.021 mmol L{sup -1} total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb{sub 2}O{sub 3}. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  14. Comparison of arsenic and antimony biogeochemical behavior in water, soil and tailings from Xikuangshan, China.

    Science.gov (United States)

    Fu, Zhiyou; Wu, Fengchang; Mo, Changli; Deng, Qiujing; Meng, Wei; Giesy, John P

    2016-01-01

    Although similar geochemical behaviors of arsenic (As) and antimony (Sb) in the environment has been assumed and widely reported, growing evidence suggests the two elements cannot, under some conditions, be assumed to behave similarly. In this four-year study (samples collected in each year), comparative investigation of the biogeochemistry of As and Sb in water/fish, soil/vegetable, tailings/plant samples were carried out at the world's largest active Sb mine area (Xikuangshan, China). Depending on duration the tailings had been stacked, significant differences in spatial distributions between As and Sb were found, and these were associated with change in pH over time. Bio-accumulation factors (BAFs) of As were approximately 10-fold greater than those of Sb in fish/water, plant/tailing, and vegetable/soil systems. Sb had higher BAF in non-fatty tissues such as gills of fishes and shells of crabs. BAFs of Sb in vegetable/soil exhibited insignificantly, but different from As, positive correlation with pH in soil. PMID:26356182

  15. DFT Study on the Carrier Concentration and Temperature-Dependent Thermoelectric Properties of Antimony Selenide

    Directory of Open Access Journals (Sweden)

    Aditya Jayaraman

    2016-01-01

    Full Text Available We present the thermoelectric properties of Antimony Selenide (Sb2Se3 obtained using first principles calculations. We investigated the electronic band structure using the FP-LAPW method within the sphere of the density functional theory. Thermoelectric properties were calculated using BoltzTrap code using the constant relaxation time (τ approximation at three different temperatures 300 K, 600 K, and 800 K. Seebeck coefficient (S was found to decrease with increasing temperature, electrical conductivity (σ/τ was almost constant in the entire temperature range, and electronic thermal conductivity (κ/τ increased with increasing temperature. With increase in temperature S decreased from 1870 μV/K (at 300 K to 719 μV/K (at 800 K, electronic thermal conductivity increased from 1.56 × 1015 W/m K s (at 300 K to 3.92 × 1015 W/m K s (at 800 K, and electrical conductivity decreased from 22 × 1019/Ω m s (at 300 K to 20 × 1019/Ω m s (at 800 K. The thermoelectric properties were also calculated for different hole concentrations and the optimum concentration for a good thermoelectric performance over a large range of temperatures (from 300 K to 1000 K was found for hole concentration around 1019 cm−3.

  16. Validation of methodology and uncertainty assessment of antimony determination in environmental materials using Neutron Activation Analysis

    International Nuclear Information System (INIS)

    Antimony is an element found in low concentrations in the environment. However, its determination has attracted great interest because of the knowledge of its toxicity and increasing application. Neutron activation analysis (NAA) is a suitable method for the determination of several elements in different types, but in case of Sb, the analysis presents some difficulties due to spectral interferences. The objective of this research was to validate the method of NAA and uncertainty assessment for Sb determination in environmental samples. The experimental procedure consisted of irradiating twelve certified reference samples of different kind of matrices. The samples were irradiated in the nuclear research reactor IEA R1 IPEN/CNEN/SP followed by measurement of induced radioactivity, using a hyperpure germanium detector coupled to a gamma ray spectrometry. The radioisotopes 122Sb and 124Sb were measured and the Sb concentrations with their respective uncertainties were obtained by the comparative method. Relative errors and values of Z scores were calculated to evaluate the accuracy of the results for Sb determination in certified reference materials. The evaluation of the components that contribute to uncertainty measurement of the Sb concentration, showed that the major uncertainty contribution is due to statistical counting. The results also indicated that the uncertainty value of the combined standard uncertainty depends on the radioisotope measured and the decay time used for counting. (author)

  17. Antimony-Doped Tin Oxide Thin Films Grown by Home Made Spray Pyrolysis Technique

    Science.gov (United States)

    Yusuf, Gbadebo; Babatola, Babatunde Keji; Ishola, Abdulahi Dimeji; Awodugba, Ayodeji O.; Solar cell Collaboration

    2016-03-01

    Transparent conducting antimony-doped tin oxide (ATO) films have been deposited on glass substrates by home made spray pyrolysis technique. The structural, electrical and optical properties of the ATO films have been investigated as a function of Sb-doping level and annealing temperature. The optimum target composition for high conductivity and low resistivity was found to be 20 wt. % SnSb2 + 90 wt. ATO. Under optimized deposition conditions of 450oC annealing temperature, electrical resistivity of 5.2×10-4 Ω -cm, sheet resistance of 16.4 Ω/sq, average optical transmittance of 86% in the visible range, and average optical band-gap of 3.34eV were obtained. The film deposited at lower annealing temperature shows a relatively rough, loosely bound slightly porous surface morphology while the film deposited at higher annealing temperature shows uniformly distributed grains of greater size. Keywords: Annealing, Doping, Homemade spray pyrolysis, Tin oxide, Resistivity

  18. A functional screen implicates microRNA-138-dependent regulation of the depalmitoylation enzyme APT1 in dendritic spine morphogenesis

    DEFF Research Database (Denmark)

    Siegel, Gabriele; Obernosterer, Gregor; Fiore, Roberto; Oehmen, Martin; Bicker, Silvia; Christensen, Mette; Khudayberdiev, Sharof; Leuschner, Philipp F; Busch, Clara J L; Kane, Christina; Hübel, Katja; Dekker, Frank; Hedberg, Christian; Rengarajan, Balamurugan; Drepper, Carsten; Waldmann, Herbert; Kauppinen, Sakari; Greenberg, Michael E; Draguhn, Andreas; Rehmsmeier, Marc; Martinez, Javier; Schratt, Gerhard M

    2009-01-01

    The microRNA pathway has been implicated in the regulation of synaptic protein synthesis and ultimately in dendritic spine morphogenesis, a phenomenon associated with long-lasting forms of memory. However, the particular microRNAs (miRNAs) involved are largely unknown. Here we identify specific mi......RNAs that function at synapses to control dendritic spine structure by performing a functional screen. One of the identified miRNAs, miR-138, is highly enriched in the brain, localized within dendrites and negatively regulates the size of dendritic spines in rat hippocampal neurons. miR-138 controls the...

  19. The NK-1 Receptor Antagonist L-732,138 Induces Apoptosis and Counteracts Substance P-Related Mitogenesis in Human Melanoma Cell Lines

    International Nuclear Information System (INIS)

    It has been recently demonstrated that substance P (SP) and neurokinin-1 (NK-1) receptor antagonists induce cell proliferation and cell inhibition in human melanoma cells, respectively. However, the antitumor action of the NK-1 receptor antagonist L-732,138 on such cells is unknown. The aim of this study was to demonstrate an antitumor action of L-732,138 against three human melanoma cell lines (COLO 858, MEL HO, COLO 679). We found that L-732,138 elicits cell growth inhibition in a concentration dependent manner in the melanoma cells studied. Moreover, L-732,138 blocks SP mitogen stimulation. The specific antitumor action of L-732,138 occurred through the NK-1 receptor and melanoma cell death was by apoptosis. These findings indicate that the NK-1 receptor antagonist L-732,138 could be a new antitumor agent in the treatment of human melanoma

  20. Gold and Antimony Mixed Flotation on a Micrite Gold Antimony ore in Guizhou%贵州某泥晶灰岩型含锑金矿金锑混浮试验

    Institute of Scientific and Technical Information of China (English)

    石贵明; 周意超

    2015-01-01

    贵州某泥晶灰岩型含锑金矿石为块状构造,金属矿物主要为黄铁矿、针铁矿,含量小于1%,非金属矿物以方解石为主,另有少量石英、有机质等;金含量为6.04 g/t,显微镜下未见自然金粒,74.34%的金赋存在硫化矿中,游离金仅占总金的7.14%;硅酸盐、碳酸盐包裹金分别占11.96%和6.56%;锑主要以辉锑矿的形式存在。为高效、低成本回收矿石中的金、锑,对混合浮选工艺进行了试验研究。结果表明,在一段磨矿细度为-0.074 mm占71%的情况下1粗2扫混浮、尾矿再磨细度为-0.074 mm占92.7%的情况下再1粗2扫混浮、两粗精矿合并后3次精选、中矿顺序返回流程处理,最终获得了金品位为47.60 g/t、锑品位为9.81%、金回收率为76.68%、锑回收率为85.22%的金锑混合精矿,金锑混浮效果较理想。尾矿中金的回收及金锑分离工艺研究将另文介绍。%The micrite type antimony-containing gold ore in Guizhou is in blocky construction. Its metallic minerals are mainly pyrite and goethite,with content of less than 1%. Non-metallic minerals are calcite,and few of quartz,organic matter, etc. It contains gold of 6. 04 g/t,and natural gold grains were not seen in microscope,74. 34% of the gold occurred in sulfide ore,free gold accounted for only 7. 14%,wrapped gold in silicate and carbonate accounted for 11. 96% and 6. 56% respective-ly. Antimony mainly existed in the form of stibnite. Bulk flotation process was studied to make high efficient recovery of gold and antimony at low costs. The results indicated that,at the grinding fineness of 71% passing 0. 074 mm,through one roughing and two scavenging bulk flotation,one roughing and two scavenging bulk flotation after regrinding the tailings to 92. 7% passing 0. 074 mm,three cleaning flotation for the two mixed rough concentrate,and then middles back to the flow-sheet in turn,rough gold-antimony concentrate with gold grade of 47. 60 g

  1. Crystal structure and tautomerism of Pigment Yellow 138 determined by X-ray powder diffraction and solid-state NMR

    DEFF Research Database (Denmark)

    Gumbert, Silke D.; Körbitzer, Meike; Alig, Edith;

    2016-01-01

    The crystal structure of C.I. Pigment Yellow 138 was determined from X-ray powder diffraction data using real-space methods with subsequent Rietveld refinements. The tautomeric state was investigated by solid-state 1D and 2D multinuclear NMR experiments. In the crystals, the compound exhibits the...

  2. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    DEFF Research Database (Denmark)

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt;

    2011-01-01

    low chromatographic recoveries. A combination of HPLC-ICP-MS, AFFF-ICP-MS and spinfiltration was applied for analysis of model compounds and biological samples. Quantitative chromatographic Sb redox speciation analysis was possible by acidic hydrolysis of the antimony polymers prior to analysis......In solution antimony exists either in the pentavalent or trivalent oxidation state. As Sb(III) is more toxic than Sb(V), it is important to be able to perform a quantitative speciation analysis of Sb’s oxidation state. The most commonly applied chromatographic methods used for this redox speciation...... analysis do, however, often show a low chromatographic Sb recovery when samples of environmental or biological origin are analysed. In this study we explored basal chemistry of antimony and found that formation of macromolecules, presumably oligomeric and polymeric Sb(V) species, is the primary cause of...

  3. Changes induced by gamma radiation in nanocomposites based on copper II and antimony sulfides in commercial poly(methyl methacrylate) matrix

    International Nuclear Information System (INIS)

    Poly (methyl methacrylate) (PMMA) is a polymer with wide application in the manufacture of medical devices that is exposed to gamma irradiation. Currently the use of composite materials has been disseminated and PMMA is an excellent polymer matrix to package various materials. This study aimed to analyze the changes induced by gamma irradiation (25 kGy) on the properties of PMMA nanocomposites with nanoparticles of copper II sulfide (250nm-900nm) and antimony sulfite (300-500 nm). The nanoparticles were added to the polymer in different concentrations and synthesized by ultrasonic irradiation from the corresponding chlorides with thioacetamide. Viscometric results showed a good radioprotective effect of nanoparticles of copper and antimony. It was found a good protection of nanoparticles on PMMA matrix in the concentration of 0.3% wt. The protections of 75% and 50% were calculated for nanoparticles of antimony and copper II, respectively. (author)

  4. Isolation of Human CD138+ Microparticles from the Plasma of Patients with Multiple Myeloma

    Directory of Open Access Journals (Sweden)

    Sabna Rajeev Krishnan

    2016-01-01

    Full Text Available The confinement of multiple myeloma (MM to the bone marrow microenvironment requires an invasive bone marrow biopsy to monitor the malignant compartment. The existing clinical tools used to determine treatment response and tumor relapse are limited in sensitivity mainly because they indirectly measure tumor burden inside the bone marrow and fail to capture the patchy, multisite tumor infiltrates associated with MM. Microparticles (MPs are 0.1- to 1.0-μm membrane vesicles, which contain the cellular content of their originating cell. MPs are functional mediators and convey prothrombotic, promalignant, proresistance, and proinflammatory messages, establishing intercellular cross talk and bypassing the need for direct cell-cell contact in many pathologies. In this study, we analyzed plasma cell–derived MPs (CD138+ from deidentified MM patients (n = 64 and normal subjects (n = 18 using flow cytometry. The morphology and size of the MPs were further analyzed using scanning electron microscopy. Our study shows the proof of a systemic signature of MPs in MM patients. We observed that the levels of MPs were significantly elevated in MM corresponding to the tumor burden. We provide the first evidence for the presence of MPs in the peripheral blood of MM patients with potential applications in personalized MM clinical monitoring.

  5. Dry deposition of 88Rb and 138Cs from a boiling water reactor plume

    International Nuclear Information System (INIS)

    Double tracer experiments were made in May 1981 at the Ringhals nuclear power plant in Sweden to investigate atmospheric-dispersion and dose models. Sulphurhexafluoride (SF6) and radioactive noble gases were released simultaneously from a 110-m stack and detected downwind at distances of 3-4 km. The experiments were made under near-neutral conditions. One-hour measurements at ground level yielded cross-wind profiles of SF6 concentrations and gamma radiation from the plume. In-situ gamma spectrometric measurements demonstrated a significant surplus of gamma rays from the noble gas daughters (88Rb and 138Cs) compared with those from the noble gases. This surplus was interpreted as due to dry deposition from the plume, and deposition velocities were estimated at 0.02-0.10 m s-1. These values are very high when compared with values recommended for calculating consequences of nuclear accidents. The high values are believed to be due to the very small size of the daughter particles

  6. Deep X-ray spectroscopy and imaging of the Seyfert 2 galaxy, ESO 138-G001

    CERN Document Server

    De Cicco, M; Bianchi, S; Piconcelli, E; Violino, G; Vignali, C; Nicastro, F

    2015-01-01

    We present a spectral and imaging analysis of the XMM-Newton and Chandra observations of the Seyfert 2 galaxy ESO138-G001, with the aim of characterizing the circumnuclear material responsible for the soft (0.3-2.0 keV) and hard (5-10 keV) X-ray emission. We confirm that the source is absorbed by Compton-thick gas. However, if a self-consistent model of reprocessing from cold toroidal material is used (MYTorus), a possible scenario requires the absorber to be inhomogenous, its column density along the line of sight being larger than the average column density integrated over all lines- of-sight through the torus. The iron emission line may be produced by moderately ionised iron (FeXII-FeXIII), as suggested by the shifted centroid energy and the low K{\\beta}/K{\\alpha} flux ratio. The soft X-ray emission is dominated by emission features, whose main excitation mechanism appears to be photoionisation, as confirmed by line diagnostics and the use of self-consistent models (CLOUDY).

  7. Developmental exposure to polychlorinated biphenyls 52, 138 or 180 affects differentially learning or motor coordination in adult rats. Mechanisms involved.

    Science.gov (United States)

    Boix, J; Cauli, O; Felipo, V

    2010-06-01

    Exposure to polychlorinated biphenyls (PCBs) during pregnancy and lactation leads to cognitive impairment and motor disorders in children by mechanisms which remain unknown. It also remains unclear whether different non-dioxin-like PCBs have similar or different mechanisms of neurotoxicity. The main aims of this work were: (1) to assess whether developmental exposure to non-dioxin-like-PCBs 52, 138 or 180 affect cognitive function or motor coordination in 3-4 months-old rats; (2) to shed light on the underlying mechanisms. Female rats were treated with PCBs (1 mg/kg day) in food from gestational-day 7 to postnatal-day 21. The ability to learn a Y maze conditional discrimination task was reduced in rats exposed to PCBs 138 or 180, but not in rats exposed to PCB52. The function of the glutamate-nitric oxide-cGMP pathway (NMDA-induced increase in extracellular cGMP) in cerebellum in vivo was reduced by 33-59% in rats exposed to PCBs 138 or 180, but not by PCB52. The amount of NR1 subunit of NMDA receptors was reduced by 41-49% in rats exposed to PCBs 138 or 180, but not by PCB 52. PCB52 but not 138 or 180 increases extracellular GABA in cerebellum and impairs motor coordination. The effects were similar in males and females. Developmental exposure to different non-dioxin-like PCBs induces different behavioural alterations by different mechanisms. PCB52 impairs motor coordination but not learning while PCB138 or 180 impair learning but not motor coordination. These data are consistent with the following possible mechanisms: (1) developmental exposure to PCBs 138 or 180 reduces the amount of NMDA receptors in cerebellum, which would contribute to reduced function of the glutamate-NO-cGMP pathway, which, in turn, would be a main contributor to the impairment of the ability to learn the Y maze task. (2) Developmental exposure to PCB52 increases extracellular GABA in cerebellum, which would contribute to motor coordination impairment. PMID:20223283

  8. Cobalt doped antimony oxide nano-particles based chemical sensor and photo-catalyst for environmental pollutants

    International Nuclear Information System (INIS)

    Graphical abstract: A dichloromethane chemical sensor using cobalt antimony oxides has been fabricated. This sensor showed high sensitivity and will be a useful candidate for environmental and health monitoring. Also it showed high photo-catalytic activity and can be a good candidate as a photo-catalyst for organic hazardous materials. Highlights: ► Reusable chemical sensor. ► Green environmental and eco-friendly chemi-sensor. ► High sensitivity. ► Good candidate for environmental and health monitoring. - Abstract: Cobalt doped antimony oxide nano-particles (NPs) have been synthesized by hydrothermal process and structurally characterized by utilizing X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM) and Fourier transforms infrared spectrophotometer (FT-IR) which revealed that the synthesized cobalt antimony oxides (CoSb2O6) are well crystalline nano-particles with an average particles size of 26 ± 10 nm. UV–visible absorption spectra (∼286 nm) were used to investigate the optical properties of CoSb2O6. The chemical sensing of CoSb2O6 NPs have been primarily investigated by I–V technique, where dichloromethane is used as a model compound. The analytical performance of dichloromethane chemical sensor exhibits high sensitivity (1.2432 μA cm−2 mM−1) and a large linear dynamic range (1.0 μM–0.01 M) in short response time (10 s). The photo catalytic activity of the synthesized CoSb2O6 nano-particles was evaluated by degradation of acridine orange (AO), which degraded 58.37% in 200 min. These results indicate that CoSb2O6 nano-particles can play an excellent research impact in the environmental field.

  9. Cobalt doped antimony oxide nano-particles based chemical sensor and photo-catalyst for environmental pollutants

    Energy Technology Data Exchange (ETDEWEB)

    Jamal, Aslam [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Rahman, Mohammed M. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Khan, Sher Bahadar, E-mail: drkhanmarwat@gmail.com [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Faisal, Mohd. [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Akhtar, Kalsoom [Division of Nano Sciences and Department of Chemistry, Ewha Womans University, Seoul 120-750 (Korea, Republic of); Rub, Malik Abdul; Asiri, Abdullah M.; Al-Youbi, Abdulrahman O. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia)

    2012-11-15

    Graphical abstract: A dichloromethane chemical sensor using cobalt antimony oxides has been fabricated. This sensor showed high sensitivity and will be a useful candidate for environmental and health monitoring. Also it showed high photo-catalytic activity and can be a good candidate as a photo-catalyst for organic hazardous materials. Highlights: Black-Right-Pointing-Pointer Reusable chemical sensor. Black-Right-Pointing-Pointer Green environmental and eco-friendly chemi-sensor. Black-Right-Pointing-Pointer High sensitivity. Black-Right-Pointing-Pointer Good candidate for environmental and health monitoring. - Abstract: Cobalt doped antimony oxide nano-particles (NPs) have been synthesized by hydrothermal process and structurally characterized by utilizing X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM) and Fourier transforms infrared spectrophotometer (FT-IR) which revealed that the synthesized cobalt antimony oxides (CoSb{sub 2}O{sub 6}) are well crystalline nano-particles with an average particles size of 26 {+-} 10 nm. UV-visible absorption spectra ({approx}286 nm) were used to investigate the optical properties of CoSb{sub 2}O{sub 6}. The chemical sensing of CoSb{sub 2}O{sub 6} NPs have been primarily investigated by I-V technique, where dichloromethane is used as a model compound. The analytical performance of dichloromethane chemical sensor exhibits high sensitivity (1.2432 {mu}A cm{sup -2} mM{sup -1}) and a large linear dynamic range (1.0 {mu}M-0.01 M) in short response time (10 s). The photo catalytic activity of the synthesized CoSb{sub 2}O{sub 6} nano-particles was evaluated by degradation of acridine orange (AO), which degraded 58.37% in 200 min. These results indicate that CoSb{sub 2}O{sub 6} nano-particles can play an excellent research impact in the environmental field.

  10. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate

    Science.gov (United States)

    Robayo, Marta L.; Lopez, Myriam C.; Daza, Carlos D.; Bedoya, Angela; Mariño, Maria L.; Saavedra, Carlos H.

    2016-01-01

    Background American cutaneous leishmaniasis (ACL) is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate) under systemic administration. According to different authors, pentavalent antimonial derivatives as treatment for ACL show a healing rate of about 75% and reasons for treatment failure are not well known. Methods In order to characterise the clinical and parasitological features of patients with ACL that did not respond to Glucantime, a cross-sectional observational study was carried out in a cohort of 43 patients recruited in three of the Colombian Army National reference centers for complicated ACL. Clinical and paraclinical examination, and epidemiological and geographic information were recorded for each patient. Parasitological, histopathological and PCR infection confirmation were performed. Glucantime IC50 and in vitro infectivity for the isolated parasites were estimated. Results Predominant infecting Leishmania species corresponds to L. braziliensis (95.4%) and 35% of the parasites isolated showed a significant decrease in in vitro Glucanatime susceptibility associated with previous administration of the medicament. Lesion size and in vitro infectivity of the parasite are negatively correlated with decline in Glucantime susceptibility (Spearman: r = (-)0,548 and r = (-)0,726; respectively). Conclusion A negative correlation between lesion size and parasite resistance is documented. L. braziliensis was found as the main parasite species associated to lesion of patients that underwent treatment failure or relapse. The indication of a second round of treatment in therapeutic failure of ACL, produced by L. braziliensis, with pentavalent antimonial

  11. Characterization of circulating lymphocyte subpopulations in canine leishmaniasis throughout treatment with antimonials and allopurinol.

    Science.gov (United States)

    Miranda, Sonia; Martorell, Susanna; Costa, Manuela; Ferrer, Lluis; Ramis, Antonio

    2007-03-31

    Canine leishmaniasis (CL) is a systemic parasitic disease with a wide variability of response to specific therapy: the majority of patients apparently improve with treatment, some of them respond but later relapse, and few of them do not respond at all. It has been demonstrated that the immune response plays a key role in the development and outcome of Leishmania infection in the dog and in the response to the treatment, although this response is not well understood. Some authors have suggested that ill dogs show a reduction in the percentage of circulating CD4+ lymphocytes and in the CD4+/CD8+ ratio, both of which normalize after treatment and clinical recovery. The present paper discusses the variation of the different lymphocyte subpopulations (CD3, CD4, CD8, CD21) of peripheral blood mononuclear cells (PBMC) in 28 dogs diagnosed with CL and submitted to conventional treatment with meglumine antimoniate (Glucantime) for 1 month and with allopurinol (Zyloric) for 1 year, in order to evaluate the usefulness of these parameters as indicators of the immunological condition of the ill animals and of the prognosis of their evolution during the treatment. It is concluded that circulating lymphocyte subpopulations are similar in dogs with leishmaniasis and in healthy dogs and that there is no correlation between the clinical status or response to therapy and the values of the counts of the different lymphocyte subpopulations. Therefore, the percentage of different lymphocyte subpopulations cannot be used as a parameter to predict the evolution of an individual patient in a clinical context. PMID:17110042

  12. Radiation-induced reactions of antimony and tellurium compounds in sulfuric acid solutions

    International Nuclear Information System (INIS)

    In deaerated 0.4 M H2SO4 solutions containing both Sb(III) and Sb(V), Sb(III) was oxidized to Sb(V) and Sb(V) was reduced to Sb(III) by γ rays. The initial yield of reduction G/sub i/(Sb(V) → Sb(III)) increased linearly with the ratio [Sb(V)]0/[Sb(III)]0, that of oxidation G/sub i/(Sb(III) → Sb(V)) increased with increasing G/sub i/(Sb(V) → Sb(III)), and the overall yield of oxidation G/sub i/(Sb(V)) = G/sub i/(Sb(III) → Sb(V)) - G/sub i/(Sb(V) → Sb(III)) was constant and equivalent to the primary yield of hydrogen g/sub H2/ = 1/2(g/sub OH/ - g/sub H/) + g/sub H2O2/. A possible mechanism of γ-ray-induced reactions in deaerated solutions was proposed in which Sb(III) was reduced by H and oxidized by OH, Sb(II) was oxidized by H2O2, and Sb(IV), and the disproportionation of Sb(IV) to Sb(III) and Sb(V) followed. In the presence of Sb(V), reduction of Sb(V) by H gives the same stoichiometry. The results on Te(IV) and Te(VI) in 0.02 M H2SO4 solutions support a similar sequence to that of the antimony system, in which the unstable valence states Te(III) and Te(V) play an important part

  13. Semimetal-semiconductor transitions in bismuth-antimony films and nanowires induced by size quantization

    International Nuclear Information System (INIS)

    In this paper we present the experimental results of an investigation of the electrical transport, thermoelectrical properties, the Shubnikov de Haas oscillations of Bi1-xSbx films (0 < x < 0.04) grown by the vacuum thermal evaporation and nanowires prepared by a modified Ulitovsky - Teilor technique. The results of the X-ray diffraction indicate that the trigonal axes were perpendicular to the film plane and the single Bi-2at%Sb nanowires with the diameter 100-1000 nm were represented by single crystals in a glass capillary with (1011) orientation along the wire axis. The investigations of the Shubnikov de Haas oscillations on Bi-2at%Sb wires with d > 600 nm show that overlapping of L and T bands was twice smaller than that in pure Bi. The temperature dependences of thin semimetallic Bi-3at%Sb films and Bi-2at%Sb wires show a semiconducting behavior. The semimetal semiconductor transition induced by the quantum confinement effect is observed in semimetal Bi1-xSbx films and nanowires at the diameters up to five times greater than those in the pure Bi. That experimental fact, on the one hand, will allow observing the display quantum confinement effect at higher temperatures on nanowires of the same diameters, and, on the other hand, will allows separating effects connected with the surface state and the quantum size effects. In addition, the thermoelectric properties and thermoelectric efficiency of bismuth-antimony wires are considered and a possibility to use them in thermoelectric converters of energy is discussed. (authors)

  14. Contamination of bottled waters with antimony leaching from polyethylene terephthalate (PET) increases upon storage.

    Science.gov (United States)

    Shotyk, William; Krachler, Michael

    2007-03-01

    Antimony concentrations were determined in 132 brands of bottled water from 28 countries. Two of the brands were at or above the maximum allowable Sb concentration for drinking water in Japan (2 microg/L). Elevated concentrations of Sb in bottled waters are due mainly to the Sb2O3 used as the catalyst in the manufacture of polyethylene terephthalate (PET(E)). The leaching of Sb from PET(E) bottles shows variable reactivity. In 14 brands of bottled water from Canada, Sb concentrations increased on average 19% during 6 months storage at room temperature, but 48 brands of water from 11 European countries increased on average 90% under identical conditions. A mineral water from France in PET(E), purchased in Germany, yielded 725 ng/L when first tested, but 1510 ng/L when it was stored for 6 months at room temperature; the same brand of water, purchased in Hong Kong, yielded 1990 ng/L Sb. Pristine groundwater containing 1.7+/-0.4 ng/L Sb (n = 6) yielded 26.6+/-2.3 ng/L Sb (n = 3) after storage in PET(E) bottles from Canada for 6 months versus 281+/-38 ng/L Sb (n = 3) in PET(E) bottles from Germany. Tap water bottled commercially in PET(E) in December 2005 contained 450+/-56 ng/L Sb (n = 3) versus 70.3+/-0.3 ng/L Sb (n = 3) when sampled from a household faucet in the same village (Bammental, Germany), and 25.7+/-1.5 ng/L Sb (n = 3) from a local artesian flow. PMID:17396641

  15. EPR, optical absorption and luminescence studies of Cr3+-doped antimony phosphate glasses

    Science.gov (United States)

    De Vicente, F. S.; Santos, F. A.; Simões, B. S.; Dias, S. T.; Siu Li, M.

    2014-12-01

    Antimony phosphate glasses (SbPO) doped with 3 and 6 mol% of Cr3+ were studied by Electron Paramagnetic Resonance (EPR), UV-VIS optical absorption and luminescence spectroscopy. The EPR spectra of Cr3+-doped glasses showed two principal resonance signals with effective g values at g = 5.11 and g = 1.97. UV-VIS optical absorption spectra of SbPO:Cr3+ presented four characteristics bands at 457, 641, 675, and 705 nm related to the transitions from 4A2(F) to 4T1(F), 4T2(F), 2T1(G), and 2E(G), respectively, of Cr3+ ions in octahedral symmetry. Optical absorption spectra of SbPO:Cr3+ allowed evaluating the crystalline field Dq, Racah parameters (B and C) and Dq/B. The calculated value of Dq/B = 2.48 indicates that Cr3+ ions in SbPO glasses are in strong ligand field sites. The optical band gap for SbPO and SbPO:Cr3+ were evaluated from the UV optical absorption edges. Luminescence measurements of pure and Cr3+-doped glasses excited with 350 nm revealed weak emission bands from 400 to 600 nm due to the 3P1 → 1S0 electronic transition from Sb3+ ions. Cr3+-doped glasses excited with 415 nm presented Cr3+ characteristic luminescence spectra composed by two broad bands, one band centered at 645 nm (2E → 4A2) and another intense band from 700 to 850 nm (4T2 → 4A2).

  16. Metagenomic approach reveals variation of microbes with arsenic and antimony metabolism genes from highly contaminated soil.

    Directory of Open Access Journals (Sweden)

    Jinming Luo

    Full Text Available Microbes have great potential for arsenic (As and antimony (Sb bioremediation in heavily contaminated soil because they have the ability to biotransform As and Sb to species that have less toxicity or are more easily removed. In this study, we integrated a metagenomic method with physicochemical characterization to elucidate the composition of microbial community and functional genes (related to As and Sb in a high As (range from 34.11 to 821.23 mg kg-1 and Sb (range from 226.67 to 3923.07 mg kg-1 contaminated mine field. Metagenomic analysis revealed that microbes from 18 phyla were present in the 5 samples of soil contaminated with high As and Sb. Moreover, redundancy analysis (RDA of the relationship between the 18 phyla and the concentration of As and Sb demonstrated that 5 phyla of microbes, i.e. Actinobacteria, Firmicutes, Nitrospirae, Tenericutes and Gemmatimonadetes were positively correlated with As and Sb concentration. The distribution, diversity and abundance of functional genes (including arsC, arrA, aioA, arsB and ACR3 were much higher for the samples containing higher As and Sb concentrations. Based on correlation analysis, the results showed a positive relationship between arsC-like (R2 = 0.871 and aioA-like (R2 = 0.675 gene abundance and As concentration, and indicated that intracellular As(V reduction and As(III oxidation could be the dominant As detoxification mechanism enabling the microbes to survive in the environment. This study provides a direct and reliable reference on the diversity of microbial community and functional genes in an extremely high concentration As- and Sb-contaminated environment.

  17. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    International Nuclear Information System (INIS)

    A new K2O-B2O3-Sb2O3 (KBS) glass system having low phonon energy (about 600 cm-1) doped with Nd3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd2O3. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the 4G7/2 → 4I9/2 and 4G7/2 → 4I13/2 transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G7/2) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1).

  18. Effect of external energy on atomic, crystalline and powder characteristics of antimony and bismuth powders

    Indian Academy of Sciences (India)

    Vikram V Dabhade; Rama Mohan R Tallapragada; Mahendra Kumar Trivedi

    2009-10-01

    Next to atoms and molecules the powders are the smallest state of matter available in high purities and large quantities. The effect of any external energy on the shape, morphology and structure can thus be studied with relative ease. The present investigation deals with the effect of a non-contact external energy on the powders of antimony and bismuth. The characteristics of powders treated by external energy are compared with the as received powders (control). The average particle sizes, 50 and 99, the sizes below which 99% of the particles are present showed significant increase and decrease indicating that the energy had caused deformation and fracture as if the powders have been subjected to high energy milling. To be able to understand the reasons for these changes the powders are characterized by techniques such as X-ray diffraction (XRD), surface area determination (BET), thermal analytical techniques such as DTA–DTG, DSC–TGA and SDTA and scanning electron microscopy (SEM). The treated powder samples exhibited remarkable changes in the powder characteristics at all structural levels starting from polycrystalline particles, through single crystal to atoms. The external energy had changed the lattice parameters of the unit cell which in turn changed the crystallite size and density. The lattice parameters are then used to compute the weight and effective nuclear charge of the atom which showed significant variation. It is speculated that the external energy is acting on the nucleus through some reversible weak interaction of larger cross section causing changes in the proton to neutron ratios. Thus the effect is felt by all the atoms, and hence the unit cell, single crystal grain and grain boundaries. The stresses generated in turn may have caused deformation or fracture of the weak interfaces such as the crystallite and grain boundaries.

  19. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony

    Directory of Open Access Journals (Sweden)

    D. Medlen

    2012-01-01

    Full Text Available The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eutectic phase particle shape and improve the mechanical properties of the final cast products and Al-Si alloys cast properties.

  20. Flow analysis-hydride generation-gas phase derivative molecular absorption spectrophotometric determination of antimony in antileishmanial drugs

    Directory of Open Access Journals (Sweden)

    Máximo Gallignani

    2009-01-01

    Full Text Available In the present work, the development of a method based on the coupling of flow analysis (FA, hydride generation (HG, and derivative molecular absorption spectrophotometry (D-EAM in gas phase (GP, is described in order to determine total antimony in antileishmanial products. Second derivative order (D²224nm of the absorption spectrum (190 - 300 nm is utilized as measurement criterion. Each one of the parameters involved in the development of the proposed method was examined and optimized. The utilization of the EAM in GP as detection system in a continuous mode instead of atomic absorption spectrometry represents the great potential of the analytic proposal.

  1. Influence of antimony on the mechanical properties and gas content of alloy AlSi6Cu4

    OpenAIRE

    D. Medlen; D. Bolibruchova

    2011-01-01

    Aluminium alloys based on Al-Si are used in automotive and aerospace industries. AlSi6Cu4 alloy is used the complicated castings, whichmust comply high strength requirements. Strength characteristics can also be affected by the modifiers: Na, Sr, Sb. In the li terature ismentioned, that AlSi6Cu4 modified by sodium and strontium has negative effect - increases of the gas absorption. Modification of AlSi6Cu4 alloy by antimony, is still not mentioned in the literature. The article gives the effe...

  2. First-principle study of antimony doping effects on the iron-based superconductor CaFe(Sb$_{x}$As$_{1-x}$)$_{2}$

    OpenAIRE

    Nagai, Yuki; Nakamura, Hiroki; Machida, Masahiko; Kuroki, Kazuhiko

    2015-01-01

    We study antimony doping effects in the iron-based superconductor CaFe(Sb$_{x}$As$_{1-x}$)$_{2}$ by using the first-principle calculation. The calculations reveal that the substitution of the doped antimony atom into As of the chainlike As layers is more stable than that in FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers existing only in novel 112 system is responsible for rising up the critical tempe...

  3. Mechanism of adenylate kinase. Structural and functional demonstration of arginine-138 as a key catalytic residue that cannot be replaced by lysine

    International Nuclear Information System (INIS)

    Replacement of the arginine-138 of adenylate kinase (AK) by lysine or methionine resulted in a decrease in kcat by a factor of 104, increases in Km by a factor of 10-20, and relatively little changes in dissociation constants. Proton nuclear magnetic resonance (NMR) studies were then undertaken to obtain structural information for quantitative interpretation of the kinetic data. Since the lysine mutant (R138K) represents a conservative mutation with surprisingly large effects on kinetics, structural studies were focused on the wild type (WT) and R138K. The results and conclusions are summarized as follows: (i) The aromatic spin systems of WT and R138K were assigned from total correlated spectroscopy (TOCSY). (ii) Proton NMR titrations with AMP and MgATP suggested that substrate binding affinities and substrate-induced conformational changes are nearly identical between WT and R138K. (iii) Notable differences were observed between the proton NMR spectra of the WT and R138K complexes with the reaction mixture, which agrees with the perturbation in the Km values of R138K. (iv) Qualitative comparison of the NOESY cross peaks between aliphatic side chains and aromatic protons indicates that the patterns are almost identical between free WT and free R138K. (v) The above kinetic and structural results led to the conclusion that Arg-138 stabilizes the ternary complexes by 1.4-1.8 kcal/mol and stabilizes the transition state by at least 7 kcal/mol and that the critical functional role of Arg-138 cannot be replaced by lysine. (vi) Since Arg-138 is distant from the substrate sites proposed from previous NMR studies serious revision will be required for this model

  4. 42 CFR 435.138 - Disabled widows and widowers aged 60 through 64 who would be eligible for SSI except for early...

    Science.gov (United States)

    2010-10-01

    ... would be eligible for SSI except for early receipt of social security benefits. 435.138 Section 435.138... SSI except for early receipt of social security benefits. (a) If the agency provides Medicaid to aged, blind, or disabled individuals receiving SSI or State supplements, the agency must provide Medicaid...

  5. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

    Directory of Open Access Journals (Sweden)

    Maurilo Monteiro Terra

    1990-01-01

    Full Text Available Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. Todos os outros porta-enxertos apresentaram desempenho inferior.A long term experiment was conducted at Monte Alegre do Sul, State of São Paulo, Brazil, to study the behaviour of wine grape cultivar IAC 138-22 Máximo on five rootstocks: RR 101 14, 'Golia', "Ripária do Traviú', IAC 313 and IAC 572 The yields of eight consecutive annual harvests (from 1974 to 1981 were analysed. The results indicated that IAC 572 was the best rootstock. IAC 313 can also be used but with fair results. "Ripária do Traviú', RR 101-14 and 'Golia' are not recommended as rootstocks for IAC 138-22. Considering the row spacing (2 x 1m which allows 5,000 plants/ha, the difference between average yields of the best and the worst rootstock was 8,475kg/ha of grapes, a considerable figure for the grape grower.

  6. Determination of Antimony (III in Real Samples by Anodic Stripping Voltammetry Using a Mercury Film Screen-Printed Electrode

    Directory of Open Access Journals (Sweden)

    Olga Domínguez-Renedo

    2009-01-01

    Full Text Available This paper describes a procedure for the determination of antimony (III by differential pulse anodic stripping voltammetry using a mercury film screen-printed electrode as the working electrode. The procedure has been optimized using experimental design methodology. Under these conditions, in terms of Residual Standard Deviation (RSD, the repeatability (3.81 % and the reproducibility (5.07 % of the constructed electrodes were both analyzed. The detection limit for Sb (III was calculated at a value of 1.27×10–8 M. The linear range obtained was between 0.99 × 10–8 – 8.26 × 10–8 M. An analysis of possible effects due to the presence of foreign ions in the solution was performed and the procedure was successfully applied to the determination of antimony levels in pharmaceutical preparations and sea water samples.

  7. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment

    Directory of Open Access Journals (Sweden)

    Miguel Guzman-Rivero

    2014-11-01

    Full Text Available Background: The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. Objective: To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Design: Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. Results: The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. Conclusions: It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  8. Treatment of air pollution control residues with iron rich waste sulfuric acid: does it work for antimony (Sb)?

    Science.gov (United States)

    Okkenhaug, Gudny; Breedveld, Gijs D; Kirkeng, Terje; Lægreid, Marit; Mæhlum, Trond; Mulder, Jan

    2013-03-15

    Antimony (Sb) in air pollution control (APC) residues from municipal solid waste incineration has gained increased focus due to strict Sb leaching limits set by the EU landfill directive. Here we study the chemical speciation and solubility of Sb at the APC treatment facility NOAH Langøya (Norway), where iron (Fe)-rich sulfuric acid (∼3.6M, 2.3% Fe(II)), a waste product from the industrial extraction of ilmenite, is used for neutralization. Antimony in water extracts of untreated APC residues occurred exclusively as pentavalent antimonate, even at low pH and Eh values. The Sb solubility increased substantially at pHettringite (at alkaline pH) or calcium (Ca)-antimonate. Treated APC residues, stored anoxically in the laboratory, simulating the conditions at the NOAH Langøya landfill, gave rise to decreasing concentrations of Sb in porewater, occurring exclusively as Sb(V). Concentrations of Sb decreased from 87-918μgL(-1) (day 3) to 18-69μgL(-1) (day 600). We hypothesize that an initial sorption of Sb to Fe(II)-Fe(III) hydroxides (green rust) and eventually precipitation of Ca- and Fe-antimonates (tripuhyite; FeSbO4) occurred. We conclude that Fe-rich, sulfuric acid waste is efficient to immobilize Sb in APC residues from waste incineration. PMID:23465722

  9. Complement activation-related pseudoallergy in dogs following intravenous administration of a liposomal formulation of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro

    2013-08-01

    Full Text Available The increasing use of nanotechnologies in advanced therapies has allowed the observation of specific adverse reactions related to nanostructures. The toxicity of a novel liposome formulation of meglumine antimoniate in dogs with visceral leishmaniasis after single dose has been investigated. Groups of 12 animals received by the intravenous route a single dose of liposomal meglumine antimoniate (group I [GI], 6.5 mg Sb/kg, empty liposomes (GII or isotonic saline (GIII. Evaluation of hematological and biochemical parameters showed no significant changes 4 days after administration. No undesired effects were registered in the GIII. However, adverse reactions were observed in 67.7% of dogs from both groups that received liposomal formulations. The side effects began moments after bolus administration and disappeared during the first 15 minutes after treatment. Prostation, sialorrhea and defecation were the most frequent clinical signs, registered in 33.3% and 41.6 % of animals from the groups GI and GII, respectively. Tachypnea, mydriasis, miosis, vomiting and cyanosis were also registered in both groups. The adverse reactions observed in this study were attributed to the activation of the complement system by lipid vesicles in a phenomenon known as Complement Activation-Related Pseudoallergy (CARPA. The influence of the physical-chemical characteristics of liposomal formulation in the triggering of CARPA is discussed.

  10. Detection of pathogenic bacteria in skin lesions of patients with chiclero's ulcer: reluctant response to antimonial treatment

    Directory of Open Access Journals (Sweden)

    Isaac-Márquez Angélica Patricia

    2003-01-01

    Full Text Available We investigated the bacterial flora present in skin lesions of patients with chiclero's ulcer from the Yucatan peninsula of Mexico using conventional culture methods (11 patients, and an immunocolorimetric detection of pathogenic Streptococcus pyogenes (15 patients. Prevalence of bacteria isolated by culture methods was 90.9% (10/11. We cultured, from chiclero's ulcers (60%, pathogenic bacterial such as Staphylococcus aureus (20%, S. pyogenes (1.6%, Pseudomonas aeruginosa (1.6%, Morganella morganii (1.6%, and opportunist pathogenic bacteria such as Klebsiella spp. (20.0%, Enterobacter spp. (20%, and Enterococcus spp. (20%. We also cultured coagulase-negative staphylococci in 40% (4/10 of the remaining patients. Micrococcus spp. and coagulase-negative staphylococci constituted the bacterial genuses more frequently isolated in the normal skin of patients with chiclero's ulcer and healthy individuals used as controls. We also undertook another study to find out the presence of S. pyogenes by an immunocolorimetric assay. This study indicated that 60% (9/15 of the ulcerated lesions, but not normal controls, were contaminated with S. pyogenes. Importantly, individuals with purulent secretion and holding concomitant infections with S. pyogenes, S. aureus, P. aeruginosa, M. morganii, and E. durans took longer to heal Leishmania (L. mexicana infections treated with antimonial drugs. Our results suggest the need to eliminate bacterial purulent infections, by antibiotic treatment, before starting antimonial administration to patients with chiclero's ulcer.

  11. Effect of germanium pre-amorphization on solid-phase epitaxial regrowth of antimony and arsenic ion-implanted silicon

    International Nuclear Information System (INIS)

    Shallow, low-resistive n+/p junction was investigated for sub 100-nm metal-oxide-semiconductor field-effect transistors (MOSFETs) using antimony and arsenic ion-implantation and low-temperature rapid thermal annealing-increased gate leakage current due to high-permittivity gate dielectric crystallization during high-temperature source and drain dopant activation imposes low temperature annealing for next generation devices. In contrast to arsenic implanted junctions, Sb-doped specimens showed shallower junction depth, lower sheet resistance and leakage current at low temperature processing (600 deg. C). In addition, Ge pre-amorphization prior to As-implant was used to fully amorphize Si for ideal solid-phase epitaxial regrowth. Pre-amorphized As-doped samples did not result in highly activated junctions at low temperature. Pre-amorphized Sb-doped junctions did not regrow in acceptable annealing time. The results indicated the superiority of antimony to arsenic as a dopant for ultra-shallow and low-resistive source and drain extensions. Arsenic will not be a proper candidate because of higher sheet resistance as a consequence of presence of inactive As-vacancy clusters and higher leakage current for devices that should be fabricated at low temperature with implementing of high-κ dielectric metal-electrode gate stack in next generation MOSFETs

  12. The presence and leachability of antimony in different wastes and waste handling facilities in Norway.

    Science.gov (United States)

    Okkenhaug, G; Almås, Å R; Morin, N; Hale, S E; Arp, H P H

    2015-11-01

    The environmental behaviour of antimony (Sb) is gathering attention due to its increasingly extensive use in various products, particularly in plastics. Because of this it may be expected that plastic waste is an emission source for Sb in the environment. This study presents a comprehensive field investigation of Sb concentrations in diverse types of waste from waste handling facilities in Norway. The wastes included waste electrical and electronic equipment (WEEE), glass, vehicle fluff, combustibles, bottom ash, fly ash and digested sludge. The highest solid Sb concentrations were found in WEEE and vehicle plastic (from 1238 to 1715 mg kg(-1)) and vehicle fluff (from 34 to 4565 mg kg(-1)). The type of acid used to digest the diverse solid waste materials was also tested. It was found that HNO3:HCl extraction gave substantially lower, non-quantitative yields compared to HNO3:HF. The highest water-leachable concentration for wastes when mixed with water at a 1 : 10 ratio were observed for plastic (from 0.6 to 2.0 mg kg(-1)) and bottom ash (from 0.4 to 0.8 mg kg(-1)). For all of the considered waste fractions, Sb(v) was the dominant species in the leachates, even though Sb(iii) as Sb2O3 is mainly used in plastics and other products, indicating rapid oxidation in water. This study also presents for the first time a comparison of Sb concentrations in leachate at waste handling facilities using both active grab samples and DGT passive samples. Grab samples target the total suspended Sb, whereas DGT targets the sum of free- and other chemically labile species. The grab sample concentrations (from 0.5 to 50 μg L(-1)) were lower than the predicted no-effect concentration (PNEC) of 113 μg L(-1). The DGT concentrations were substantially lower (from 0.05 to 9.93 μg L(-1)) than the grab samples, indicating much of the Sb is present in a non-available colloidal form. In addition, air samples were taken from the chimney and areas within combustible waste incinerators, as

  13. Correlation models between environmental factors and bacterial resistance to antimony and copper.

    Directory of Open Access Journals (Sweden)

    Zunji Shi

    Full Text Available Antimony (Sb and copper (Cu are toxic heavy metals that are associated with a wide variety of minerals. Sb(III-oxidizing bacteria that convert the toxic Sb(III to the less toxic Sb(V are potentially useful for environmental Sb bioremediation. A total of 125 culturable Sb(III/Cu(II-resistant bacteria from 11 different types of mining soils were isolated. Four strains identified as Arthrobacter, Acinetobacter and Janibacter exhibited notably high minimum inhibitory concentrations (MICs for Sb(III (>10 mM,making them the most highly Sb(III-resistant bacteria to date. Thirty-six strains were able to oxidize Sb(III, including Pseudomonas-, Comamonas-, Acinetobacter-, Sphingopyxis-, Paracoccus- Aminobacter-, Arthrobacter-, Bacillus-, Janibacter- and Variovorax-like isolates. Canonical correspondence analysis (CCA revealed that the soil concentrations of Sb and Cu were the most obvious environmental factors affecting the culturable bacterial population structures. Stepwise linear regression was used to create two predictive models for the correlation between soil characteristics and the bacterial Sb(III or Cu(II resistance. The concentrations of Sb and Cu in the soil was the significant factors affecting the bacterial Sb(III resistance, whereas the concentrations of S and P in the soil greatly affected the bacterial Cu(II resistance. The two stepwise linear regression models that we derived are as follows: MIC(Sb(III=606.605+0.14533 x C(Sb+0.4128 x C(Cu and MIC((Cu(II=58.3844+0.02119 x C(S+0.00199 x CP [where the MIC(Sb(III and MIC(Cu(II represent the average bacterial MIC for the metal of each soil (μM, and the C(Sb, C(Cu, C(S and C(P represent concentrations for Sb, Cu, S and P (mg/kg in soil, respectively, p<0.01]. The stepwise linear regression models we developed suggest that metals as well as other soil physicochemical parameters can contribute to bacterial resistance to metals.

  14. Growth, photosynthesis, and defense mechanism of antimony (Sb)-contaminated Boehmeria nivea L.

    Science.gov (United States)

    Chai, Li-Yuan; Mubarak, Hussani; Yang, Zhi-Hui; Yong, Wang; Tang, Chong-Jian; Mirza, Nosheen

    2016-04-01

    Ramie (Boehmeria nivea L.) is the oldest cash fiber crop in China and is widely grown in antimony (Sb) mining areas. To evaluate the extent of Sb resistance and tolerance, the growth, tolerance index (TI), Sb content in plant parts and in Hoagland solution, bioaccumulation factor (BF), photosynthesis, and physiological changes in Sb-contaminated B. nivea (20, 40, 80, and 200 mg L(-1) Sb) grown hydroponically were investigated. The Sb tolerance and resistance of ramie were clearly revealed by growth inhibition, a TI between 13 and 99 %, non-significant changes in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (photosystem II (PSII)) and single-photon avalanche diode (SPAD) value, a significant increase in Sb in plant parts, BF >1, and an increase in catalase (CAT) and malondialdehyde (MDA) at 200 mg L(-1) Sb. Under increasing Sb stress, nearly the same non-significant decline in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (PSII), relative quantum yield of photosystem II (φPSII), and photochemical quenching (qP), except for F v /F m at 20 mg L(-1) Sb, were recorded. SPAD values for chlorophyll under Sb stress showed an increasing trend, except for a slight decrease, i.e., continuous increase in MDA, superoxide dismutase (SOD), peroxidase (POD), and CAT activities were suppressed under Sb addition up to 40 mg L(-1) Sb and the addition of Sb enhanced enzyme production at 80 and 200 mg L(-1) Sb. A continuous decrease in SOD, POD, and CAT up to 40 mg L(-1) Sb and enhancements at ≥80 mg L(-1), along with the continuous enhancement of MDA activity and inhibited biomass production, clearly reveal the roles of these enzymes in detoxifying Sb stress and the defense mechanism of ramie at 80 mg L(-1) Sb. Thus, B. nivea constitutes a promising candidate for Sb phytoremediation at mining sites. PMID:26711292

  15. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India)], E-mail: basudebk@cgcri.res.in

    2009-05-12

    A new K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3} (KBS) glass system having low phonon energy (about 600 cm{sup -1}) doped with Nd{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd{sub 2}O{sub 3}. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 9/2} and {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 13/2} transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 7/2}) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  16. Novel organo-colloidal synthesis, optical properties, and structural analysis of antimony sesquioxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Validzic, Ivana Lj., E-mail: validzic@vinca.rs; Abazovic, Nadica D.; Mitric, Miodrag [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Lalic, Milan V. [Universidade Federal de Sergipe, Departamento de Fisica (Brazil); Popovic, Zoran S. [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Vukajlovic, Filip R. [' Vinca' Institute of Nuclear Sciences (Serbia)

    2013-01-15

    We report the novel colloidal syntheses in organic media of antimony sesquioxide ( Sb{sub 2}O{sub 3} ) spherical nanoparticles (30-250 nm) and octahedron micro- and nanocrystals (100nm - 4{mu}) depending on the synthetic method conditions. It is observed that small differences in the synthetic procedure cause large differences in the very changeable morphology. The structure of Sb{sub 2}O{sub 3} powders was refined down to the R-factors of 9.57, 7.44, 9.19, 9.78, and 8.30 %. The refinement showed that Sb{sub 2}O{sub 3} powder belongs to the cubic crystal type with space group Fd 3-bar m (No. 227). The values of estimated standard deviations, as well as reliability factors, confirmed that the structure of Sb{sub 2}O{sub 3} was well refined. Ultraviolet and visible (UV-Vis) absorption spectroscopy and diffuse reflectance measurements (DRS) reveal that the optical band gap energies found for the Sb{sub 2}O{sub 3} octahedrons and nanoparticles, micro- and nanocrystals, respectively, are quite independent of the synthetic method conditions and synthesized morphology and is found to be between 4.1-4.4 eV. No peaks in both photoluminescence (PL) emission and excitation spectra have been observed for a broad spectral range, typical for this material. In order to discriminate between conflicting experimental results concerning the band gap energy of this compound, we investigated theoretically the electronic structure and optical properties of one of the cubic sesquioxide Sb{sub 2}O{sub 3} samples synthesized here. This has been done on the basis of density functional theory (DFT) with the generalized gradient approximation (GGA) and improved version of exchange potential suggested recently by Tran and Blaha (TB-mBJ). The main characteristic of the calculated TB-mBJ electronic structure is the significant improvement of the band gap value, which is in perfect agreement with our experimental measurements. The real and imaginary parts of the dielectric tensor are also

  17. Real-world emission factors for antimony and other brake wear related trace elements: size-segregated values for light and heavy duty vehicles.

    Science.gov (United States)

    Bukowiecki, Nicolas; Lienemann, Peter; Hill, Matthias; Figi, Renato; Richard, Agnes; Furger, Markus; Rickers, Karen; Falkenberg, Gerald; Zhao, Yongjing; Cliff, Steven S; Prevot, Andre S H; Baltensperger, Urs; Buchmann, Brigitte; Gehrig, Robert

    2009-11-01

    Hourly trace element measurements were performed in an urban street canyon and next to an interurban freeway in Switzerland during more than one month each, deploying a rotating drum impactor (RDI) and subsequent sample analysis by synchrotron radiation X-ray fluorescence spectrometry (SR-XRF). Antimony and other brake wear associated elements were detected in three particle size ranges (2.5-10, 1-2.5, and 0.1-1 microm). The hourly measurements revealed that the effect of resuspended road dust has to be taken into account for the calculation of vehicle emission factors. Individual values for light and heavy duty vehicles were obtained for stop-and-go traffic in the urban street canyon. Mass based brake wear emissions were predominantly found in the coarse particle fraction. For antimony, determined emission factors were 11 +/- 7 and 86 +/- 42 microg km(-1) vehicle(-1) for light and heavy duty vehicles, respectively. Antimony emissions along the interurban freeway with free-flowing traffic were significantly lower. Relative patterns for brake wear related elements were very similar for both considered locations. Beside vehicle type specific brake wear emissions, road dust resuspension was found to be a dominant contributor of antimony in the street canyon. PMID:19924925

  18. The CHARA Array resolves the long-period Wolf-Rayet binaries WR 137 and WR 138

    CERN Document Server

    Richardson, Noel D; Roy-Loubier, Olivier; Schaefer, Gail; Moffat, Anthony F J; St-Louis, Nicole; Gies, Douglas R; Farrington, Chris; Hill, Grant M; Williams, Peredur M; Gordon, Kathryn; Pablo, Herbert; Ramiaramanantsoa, Tahina

    2016-01-01

    We report on interferometric observations with the CHARA Array of two classical Wolf-Rayet stars in suspected binary systems, namely WR 137 and WR 138. In both cases, we resolve the component stars to be separated by a few milliarcseconds. The data were collected in the H-band, and provide a measure of the fractional flux for both stars in each system. We find that the WR star is the dominant H-band light source in both systems ($f_{\\rm WR, 137} = 0.59\\pm0.04$; $f_{\\rm WR, 138} = 0.67\\pm0.01$), which is confirmed through both comparisons with estimated fundamental parameters for WR stars and O dwarfs, as well as through spectral modeling of each system. Our spectral modeling also provides fundamental parameters for the stars and winds in these systems. The results on WR 138 provide evidence that it is a binary system which may have gone through a previous mass-transfer episode to create the WR star. The separation and position of the stars in the WR 137 system together with previous results from the IOTA inte...

  19. Synthesis and Properties of Light-tolerant Organic Antimony%耐光型有机锑的合成及其性能研究

    Institute of Scientific and Technical Information of China (English)

    高勇; 韩永和; 李建丰; 袁余斌; 王爱红

    2014-01-01

    硫醇锑稳定剂由于其耐紫外光性能很差,在存储、运输和使用方面受到很大的限制。为解决这一问题,试探性以三氯化锑和巯基酯为原料,引入抗紫外线活性基团TBP-1(2,4-二羟基二苯甲酮),合成了“晒不黑”的有机锑热稳定剂。用红外光谱对产品结构进行了确认,光敏性实验表明其7周内不变色;静态热稳定性实验结果表明其与硫醇锑热稳定剂相当。%Because of its poor ultraviolet resistance , the storage , transportation and use of antimony mercaptide stabilizer was greatly limited.In order to solve this problem , a kind of synthesized organic antimony thermal stabilizer was prepared, which was light -tolerant with antimony trichloride , isooctyl thioglycollat as raw materials and TBP -1(2,4-dihydroxybenzophenone ) , with an anti-ultraviolet agent added in.The light-tolerant performance and thermal stability of product tested showed that the color of organic antimony as -synthesized was unchangeable when under the impact of direct sunlight for 7 weeks by infrared spectroscopy spectrum that was confirmed for structure of product , and the static experimental results showed that the thermal stability was nearly equivalent to antimony mercaptide.

  20. MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Juan [Department of Gynecology, Changzhou Maternity and Children Health Hospital, Changzhou, Jiangsu 213003 (China); Li, Li; Yun, Hui-fang [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China); Han, Ye-shan, E-mail: yeshanhan123@163.com [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China)

    2015-08-07

    Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose.

  1. MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

    International Nuclear Information System (INIS)

    Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose

  2. The chemistry and behaviour of antimony in the soil environment with comparisons to arsenic: A critical review

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Susan C., E-mail: swilso24@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Lockwood, Peter V., E-mail: peter.lockwood@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Ashley, Paul M., E-mail: pashley@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Tighe, Matthew, E-mail: mtighe2@une.edu.a [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia)

    2010-05-15

    This article provides a critical review of the environmental chemistry of inorganic antimony (Sb) in soils, comparing and contrasting findings with those of arsenic (As). Characteristics of the Sb soil system are reviewed, with an emphasis on speciation, sorption and phase associations, identifying differences between Sb and As behaviour. Knowledge gaps in environmentally relevant Sb data for soils are identified and discussed in terms of the limitations this imposes on understanding the fate, behaviour and risks associated with Sb in environmental soil systems, with particular reference to mobility and bioavailability. - A critical and comparative review of Sb and As chemistry and associations in soil systems identifies research directions needed for better understanding of risks.

  3. Photoelectron imaging as a probe of the repulsive Coulomb barrier in the photodetachment of antimony tartrate dianions

    Science.gov (United States)

    West, Christopher W.; Bull, James N.; Woods, David A.; Verlet, Jan R. R.

    2016-02-01

    A photoelectron imaging study of the text-book antimony tartrate dianion is presented. The vertical and adiabatic detachment energies are determined to be 2.5 ± 0.1 eV and 2.1 ± 0.2 eV, respectively. The photoelectron spectra exhibit a typical cut-off due to the presence of the repulsive Coulomb barrier (RCB) and the photoelectron images are highly anisotropic. Using a simple model for the RCB combined with classical molecular dynamics simulations, the photoelectron images were calculated and compared with experiment. Very good overall agreement between the simulations and experiments was achieved when the photodetachment occurs along a specific molecular axis.

  4. Improving the photoluminescence properties of self-assembled InAs surface quantum dots by incorporation of antimony

    International Nuclear Information System (INIS)

    This study investigates the effects of surfactant and segregation from InAs surface quantum dots (SQDs) by incorporating antimony (Sb) into the QD layers. The Sb surfactant effect extends planar growth and suppresses dot formation. Incorporating Sb can reduce the density of SQDs by more than two orders of magnitude. Photoluminescence (PL) reveals enhancement in the optical properties of InAs SQDs as the Sb beam equivalent pressure (BEP) increases. This improvement is caused by the segregation of Sb on the surface of SQDs, which reduces non-radiative recombination and suppresses carrier loss. The dark line at the SQDs surface in the transmission electron microscopic image suggests that the incorporated Sb probably segregates close to the surface of the SQDs. These results indicate a marked Sb segregation effect that can be exploited to improve the surface-sensitive properties of SQDs for biological sensing.

  5. Pb-Sb and Pb-Sb-Bi sulfosalts and associated sulphides from Dubrava antimony deposit, Nizke Tatry Mts

    International Nuclear Information System (INIS)

    A sulfosalt study was carried out on an antimony deposit Dubrava in Western Carpathians, Slovakia. Quartz-sulphide veins are hosted by Variscan crystalline complex built by granitoid rocks with lenticular bodies of amphibolite gneisses and migmatites. Pb-Sb sulfosalts are constituents of Sb ores and occur together with stibnite, sphalerite, pyrite and other sulphides. Among the sulfosalts, identified by X-ray micro-analyses, the most abundant one is zinckenite. Other phases are chemically close to plagionite, robinsonite, heteromorphite, semseyite and boulangerite. Sulfosalts richter in Bi accompany later tetrahedrite, bournonite and chalcostibite. These include tintinaite (kobellite homologous series) and Bi zinckenite. Intermediate phases between stibnite and bismuthinite, referred to as horobetsuite, are also common. (authors)

  6. Conjugative plasmid in Corynebacterium flaccumfaciens subsp. oortii that confers resistance to arsenite, arsenate, and antimony(III)

    Energy Technology Data Exchange (ETDEWEB)

    Hendrick, C.A.; Haskins, W.P.; Vidaver, A.K.

    1984-07-01

    Gene transfer systems for phytopathogenic corynebacteria have not been reported previously. In this paper a conjugative 46-megadalton plasmid (pDG101) found in Corynebacterium flaccumfaciens subsp. oorii CO101 is described that mediates resistance to arsenite, arsenate, and antimony(III). Transfer of the plasmid from CO101 to four other strains from the C. flaccumfaciens group occurred between cells immobilized on nitrocellulose filters or on agar surfaces. Transconjugant strains expressed the same levels of metal resistance as the donor strain and were able to act as donor strains in subsequent matings. The physical presence of the plasmid was detected by agarose gel electrophoresis. Arsenite-sensitive derivatives of the donor and transconjugant strains were obtained after heat treatment; these were cured of pDG101.

  7. Antimony orthophosphate glasses with large nonlinear refractive indices, low two-photon absorption coefficients, and ultrafast response

    International Nuclear Information System (INIS)

    Antimony glasses based on the composition Sb2O3-SbPO4 were prepared and characterized. The samples present high refractive index, good transmission from 380 to 2000 nm, and high thermal stability. The nonlinear refractive index, n2, of the samples was studied using the optical Kerr shutter technique at 800 nm. The third-order correlation signals between pump and probe pulses indicate ultrafast response (2 was observed by adding lead oxide to the Sb2O3-SbPO4 composition. Large values of n2≅10-14 cm2/W and negligible two-photon absorption coefficients (smaller than 0.01 cm/GW) were determined for all samples. The glass compositions studied present appropriate figure-of-merit for all-optical switching applications

  8. Fabrication of superhydrophobic and heat-insulating antimony doped tin oxide/polyurethane films by cast replica micromolding.

    Science.gov (United States)

    Feng, Jie; Huang, Baoyuan; Zhong, Mingqiang

    2009-08-01

    A novel process for fabricating superhydrophobic and heat-insulating polymeric nanocomposite films was developed. Briefly, antimony doped tin oxide (ATO) nanoparticles that commonly endow coats heat-insulating and transparent functions were mixed into commercial waterborne polyurethane (WPU) suspensions to obtain ATO/WPU suspensions, which were then cast onto poly(dimethylsiloxane) (PDMS) stamps replicated from fresh lotus leaves. After being dried and peeled off from stamps, ATO/PU films with superhydrophobic surface and heat-insulating property were created, while PU films without ATO only showed high hydrophobicity. Scanning electron microscopy (SEM) imaging showed the surface of ATO/PU superhydrophobic films had unique micro- and nano-structures similar with those on the lotus leaf. On the contrary, no obvious nano-structures were found on the surface of pure PU films, demonstrating mixing functional nanoparticles into polymers is a necessary and feasible step in creating superhydrophobic and functional films by replica molding method. PMID:19394955

  9. Effects of Antimony Doping on Cu(In1-x,Gax)Se2 Thin Films and Solar Cells

    Science.gov (United States)

    Yatsushiro, Yuta; Nakakoba, Hiroya; Mise, Takahiro; Kobayashi, Taizo; Nakada, Tokio

    2012-10-01

    The effects of antimony (Sb) doping into Cu(In1-x,Gax)Se2 (CIGS) thin films and solar cells have been investigated. 10-50-nm-thick Sb thin layers were deposited onto Mo-coated sodalime glass (SLG) and SiOx-coated SLG substrates by vacuum evaporation. CIGS thin films were then deposited by a three-stage process at substrate temperatures of 450-550 °C. The grain growth of CIGS thin films was enhanced, and the open-circuit voltage and hence the conversion efficiency improved with the Sb doping when the SLG substrates were used. However, little or no effect was observed when the alkali barrier SiOx layer was deposited on SLG substrates. As a result, we found that Sb doping is beneficial for improving the cell performance when sodium exists simultaneously in CIGS layers.

  10. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander

    2015-12-01

    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact. PMID:26194244

  11. The chemistry and behaviour of antimony in the soil environment with comparisons to arsenic: A critical review

    International Nuclear Information System (INIS)

    This article provides a critical review of the environmental chemistry of inorganic antimony (Sb) in soils, comparing and contrasting findings with those of arsenic (As). Characteristics of the Sb soil system are reviewed, with an emphasis on speciation, sorption and phase associations, identifying differences between Sb and As behaviour. Knowledge gaps in environmentally relevant Sb data for soils are identified and discussed in terms of the limitations this imposes on understanding the fate, behaviour and risks associated with Sb in environmental soil systems, with particular reference to mobility and bioavailability. - A critical and comparative review of Sb and As chemistry and associations in soil systems identifies research directions needed for better understanding of risks.

  12. Synthesis and characterization of nanostructured Mn(II) doped antimony-tin oxide (ATO) films on glass

    International Nuclear Information System (INIS)

    Sol–gel Mn(II) doped antimony tin oxide films were developed with precursor of atomic ratio range, Sn:Sb:Mn = 68–72:23–25:9–3. The X-ray diffraction patterns depict tetragonal cassiterite phase of SnO2. Transmission electron microscopy images suggest the nanostructured form of the doped materials. The increase in crystallite size with Mn(II) concentration is reflected by the larger band gap values (4.61–4.73 eV) arising from the excitonic transitions which also respond to PL emissions. Hall effect measurements show that the carrier concentration increases but mobility decreases for Mn(II) doping. Room temperature ferromagnetism with different saturation magnetic moments (Ms) has been observed for all dopant concentrations, 3–9 at%.

  13. Novel antimony-silicate material Quasar-n for the removal of radionuclides from acidic decontamination liquids - 16157

    International Nuclear Information System (INIS)

    Novel antimony silicate material, commercially available from PQ Corporation (previously Ineos Silicas) is highly selective for the removal of several key radionuclides (Co-60, Sr-90, Cs-137, Pu-236 and Am-241) from acidic and neutral nuclear waste effluents. The paper will summarise most the key results that have been obtained in the previous studies of the material. In addition, new test results on the removal Co-60, Sr-90, Cs-137 and Am-241 from acid media are reported. Static batch experiments and column experiments show that Am can be removed efficiently from nitric and oxalic acid, indicating that Quasar is suitable e.g. for the purification of acidic decontamination solutions. (authors)

  14. lVIICROSTRUCTURE AND EUTECTIC MORPHOLOGY OF AL-12.5°/o Si ALLOY REFINED WITH ANTIMONY

    Directory of Open Access Journals (Sweden)

    Funda Kahraman

    2007-01-01

    Full Text Available Modification of Al-Si cast alloys can be achieved in two different ways, namely by additions of certain eleınents orwith rapid cooling rate. Modifications of the Al-Si al1oys are carried out extensivcly in industry to improve themechanical properties, particularly ductility. In this study, the effects of antiınony addition.s and growth rate on theınicrostructure and eutectic morphology on the directionally solidified Al- 1 2.5°/o Si cutectic all oy has beeninvestigated. The results showed that antimony can be identified as a grain refıner. Over modification occurs in Al-12.5 °/oSi alloy when modifier is present in the amount of 1 %Sb results in AISb compound.

  15. Enhanced Removal of Arsenic and Antimony in the Mining Site by Calcined γ-Fe2O3/Layered Double Hydroxide Nanocomposite

    Science.gov (United States)

    Lee, Sang-Ho; Choi, Heechul; Kim, Kyoung-Woong

    2016-04-01

    Arsenic (As) and Antimony (Sb) have been recognized as harmful contaminants in aquatic environment due to its high toxicity and carcinogenicity. Especially, the contamination of arsenic in the mining areas is considered as a serious emerging environmental issue in Korea. Due to the hazardous effect of arsenic, the United States Environmental Protection Agency (US EPA) regulated maximum contamination level of arsenic to 10 μg/L in drinking water. The harmful effect on human health by excessive intake of antimony was also reported by previous studies, and severe contamination level (100 - 7,000 μg/L) of antimony reported in surface and groundwater of abandoned mining area in China and Slovakia. Therefore, US EPA regulated maximum contaminants level of antimony in drinking water to 6 μg/L. In order to remove anionic contaminants in drinking water, various type of nanomaterials have been developed. Layered double hydroxide (LDH) is the artificial anionic clay that is based on the layered structure of positively charged brucite-like layers with interlayers of anions. The LDH is one of the promising nanomaterials for the removal of anionic contaminants because it has high selectivity for arsenic, phosphate, chromium and antimony. However, the biggest problem of LDH for wastewater treatment is that the particles cannot be easily separated after the removal of contaminants. In this study, magnetic nanoparticles (γ-Fe2O3) supported LDH nanocomposite (γ-Fe2O3/LDH) was investigated to enhance magnetic particle recovery and removal efficiency for arsenic and antimony. The calcined γ-Fe2O3/LDH nanocomposites synthesized by co-precipitation method, and the crystallographic properties of maghemite (γ-Fe2O3) and layered structure of LDH were confirmed by X-ray diffraction. The nano-sized γ-Fe2O3 (30 to 50 nm) was stably attached on the surface of LDH (100 to 150 nm) and O1s spectrum by X-ray photoelectron spectroscopy (XPS) explained that there are both physical and

  16. Growth and Characterization of Co-Doped Fluorine and Antimony in Tin Oxide Thin Films Obtained by Ultrasonic Spray Pyrolysis

    Science.gov (United States)

    Gaewdang, Thitinai; Wongcharoen, Ngamnit

    Fluorine (F)-doped, antimony (Sb)-doped, fluorine and antimony co-doped tin oxide (SnO2) thin films were prepared by ultrasonic spray pyrolysis technique using SnCl2, NH4F and SbCl3 as precursors of Sn, F and Sb elements respectively. F and Sb doping concentrations carried out from 1 to 20 wt% and 1 to 4 wt% in F-doped and Sb-doped SnO2 films respectively. In F and Sb co-doped SnO2 films, the proportions of F and Sb to Sn in starting solution were 15 and 2 wt% respectively. XRD patterns showed that the preferred orientation of SnO2:F, SnO2:Sb and SnO2:F, Sb is dependent on the doping concentration. The variation of doping concentration and preferred orientation of the films was reflected in their morphology as investigated by SEM. The electrical properties of the films were performed by Hall effect measurements in van der Pauw configuration. The minimum resistivity values of SnO2:F and SnO2:Sb were found in the films doped with 15 wt% of F and 2 wt% of Sb. However, The minimum of resistivity value of F and Sb co-doped SnO2 films is not better than neither the one of F-doped nor the one of Sb-doped SnO2 films. The optical transmission of SnO2:F films was found to increase with increasing in F doping concentration. Whereas the optical transmission of SnO2:Sb was found to decrease with increasing in Sb concentration. The F and Sb co-doped SnO2 films annealed in three different conditions at 500°C show the lower transmission values than the value obtained in the as-prepared SnO2:F, Sb films.

  17. One-step synthesis and properties of monolithic photoluminescent ruby colored cuprous oxide antimony oxide glass nanocomposites

    International Nuclear Information System (INIS)

    Research highlights: → Single-step synthesis of Cu2O, CuySb2-x(O,OH)6-7 (y ≤ 2, x ≤ 1) and Cu nanocrystals co-doped novel antimony oxide glass hybrid nanocomposites. → Yellow and orange colored nanocomposites shows size-controlled band gap shift of Cu2O. → Red nanocomposite exhibits surface plasmon resonance band due to metallic Cu. → They exhibit broad deep-red photoluminescence emission under various UV excitation wavelengths. - Abstract: Cuprous oxide (Cu2O) antimony glass (K2O-B2O3-Sb2O3) monolithic nanocomposites having brilliant yellow to ruby red color have been synthesized by a single-step melt-quench technique involving in situ thermochemical reduction of Cu2+ (CuO) by the reducing glass matrix without using any external reducing agent. The X-ray diffraction (XRD), infrared transmission and reflection spectra, and selected area electron diffraction analysis support the reduction of Cu2+ to Cu+ with the formation of Cu2O nanoclusters along with CuySb2-x(O,OH)6-7 (y ≤ 2, x ≤ 1) nanocrystalline phases while Cu0 nanoclusters are formed at very high Cu concentration. The UV-vis spectra of the yellow and orange colored nanocomposites show size-controlled band gap shift of the semiconductor (Cu2O) nanocrystallites embedded in the glasses while the red nanocomposite exhibits surface plasmon resonance band at 529 nm due to metallic Cu. Transmission electron microscopic image advocates the formation of nanocystallites (5-42 nm). Photoluminescence emission studies show broad red emission band around 626 nm under various excitation wavelengths from 210 to 270 nm.

  18. Fabrication and excellent conductive performance of antimony-doped tin oxide-coated diatomite with porous structure

    Energy Technology Data Exchange (ETDEWEB)

    Du Yucheng, E-mail: ychengdu@bjut.edu.cn [Key Lab of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing 100124 (China); Yan Jing; Meng Qi; Wang Jinshu [Key Lab of Advanced Functional Materials, Ministry of Education, College of Materials Science and Engineering, Beijing University of Technology, Beijing 100124 (China); Dai Hongxing, E-mail: hxdai@bjut.edu.cn [Laboratory of Catalysis Chemistry and Nanoscience, Department of Chemistry and Chemical Engineering, College of Environmental and Energy Engineering, Beijing University of Technology, Beijing 100124 (China)

    2012-04-16

    Graphical abstract: Antimony-doped tin oxide (ATO)-coated diatomite with porous structures are fabricated using the co-precipitation method. The porous ATO-coated diatomite material shows excellent conductive performance. Highlights: Black-Right-Pointing-Pointer Sb-doped SnO{sub 2} (ATO)-coated diatomite materials with porous structures are prepared. Black-Right-Pointing-Pointer Sn/Sb ratio, ATO coating amount, pH value, and temperature influence resistivity. Black-Right-Pointing-Pointer Porous ATO-coated diatomite materials show excellent conductive performance. Black-Right-Pointing-Pointer The lowest resistivity of the porous ATO-coated diatomite sample is 10 {Omega} cm. - Abstract: Diatomite materials coated with antimony-doped tin oxide (ATO) were prepared by the co-precipitation method, and characterized by means of the techniques, such as X-ray diffraction, Fourier transform infrared spectroscopy, scanning electron microscopy, transmission electron microscopy, selected-area electron diffraction, X-ray fluorescence spectroscopy, and N{sub 2} adsorption-desorption measurement. It was shown that the coated ATO possessed a tetragonal rutile crystal structure, and the ATO-coated diatomite materials had a multi-pore (micro- meso-, and macropores) architecture. The porous ATO-coated diatomite materials exhibited excellent electrical conductive behaviors. The best conductive performance (volume resistivity = 10 {Omega} cm) was achieved for the sample that was prepared under the conditions of Sn/Sb molar ratio = 5.2, Sn/Sb coating amount = 45 wt%, pH = 1.0, and reaction temperature = 50 Degree-Sign C. Such a conductive porous material is useful for the applications in physical and chemical fields.

  19. Synthesis and characterization of a novel mesoporous silica funtionalized whith [1,5 bis (di-2-pyridyl) methylene thiocarbohydrazide] and its application as enrichment sorbent for determination of antimony by FI-HG-ETAAS

    OpenAIRE

    Siles Cordero, María Teresa; López Guerrero, María del Mar; Vereda Alonso, Elisa Isabel; García de Torres, Amparo; Cano Pavón, José Manuel

    2014-01-01

    Antimony is an element of environmental concern due to its toxicity and biological effects and is therefore considered as a priority pollutant by the US Environmental Protection Agency (EPA). Dissolved antimony is present in seawater at very low concentration levels, typical concentrations of Sb in unpolluted water samples are less than 1 µg L-1. Since the concentration of this element in water is very low, high sensitive analytical techniques are required, The system is based on retent...

  20. Geologic and seismic investigations for relocation of Route 138 in Brockton, Mass., prospective cut, stations 169 to 180

    Science.gov (United States)

    May, James E.; Miller, Raymond

    1954-01-01

    This work was done to obtain geologic and seismic data that would aid in establishing grade for a segment of Route 138 between stations 169 and 180, and that would also be of value in estimating the nature and quantities of subsurface materials to be estimating the nature and quantities of subsurface materials to be excavated from the proposed cut. The work was performed in August 1952, as part of a cooperative program pf the Massachusetts Department of Public Works and the United States Geological Survey.

  1. Human parathyroid hormone-(1-38) restores cancellous bone to the immobilized, osteopenic proximal tibial metaphysis in rats

    Science.gov (United States)

    Ma, Y. F.; Jee, W. S.; Ke, H. Z.; Lin, B. Y.; Liang, X. G.; Li, M.; Yamamoto, N.

    1995-01-01

    The purpose of this study was to determine if human parathyroid hormone-(1-38) (hPTH(1-38)) can restore cancellous bone mass to the established osteopenic, immobilized proximal tibial metaphyses of female rats. The right hindlimbs of 6-month-old female Sprague-Dawley rats were immobilized by bandaging the right hindlimbs to the abdomen. After 30 days of right hindlimb immobilization, the rats were subcutaneously injected with 200 micrograms hPTH(1-38)/kg/day for 15 days (short-term treatment) or 75 days (longer-term treatment). Static bone histomorphometry was performed on the primary spongiosa, and both static and dynamic histomorphometry were performed on the secondary spongiosa of the right proximal tibial metaphyses. Immobilization for 30 days without treatment decreased trabecular bone area, number, and thickness in both primary and secondary spongiosa, and induced an increase in eroded perimeter and a decrease in tissue referent-bone formation rate in the secondary spongiosa. These changes reached a new steady state thereafter. Treatment with 200 micrograms hPTH(1-38)/kg/day for 15 days, beginning 30 days after immobilization, significantly increased trabecular bone area, thickness, and number in both primary and secondary spongiosa despite continuous immobilization when compared with controls. The short-term PTH treatment (15 days) significantly increased labeling perimeter, mineral apposition rate, and tissue referent-bone formation rate in the secondary spongiosa and stimulated longitudinal bone growth as compared with the controls. Longer PTH treatment (75 days) further increased trabecular bone area, thickness, and number as compared with controls and groups given short-term PTH treatment (15 days). The bone formation indices in the secondary spongiosa of the longer-term treated rats were lower than those of the short-term treated group, but they were still higher than those of controls. Our findings indicate that PTH treatment stimulates cancellous bone

  2. Does the linear Sry transcript function as a ceRNA for miR-138? The sense of antisense

    OpenAIRE

    Javier Tadeo Granados-Riveron; Guillermo Aquino-Jarquin

    2014-01-01

    Recently, the sex determining region Y ( Sry) and the cerebellar degeneration-related protein 1 ( CDR1as) RNA transcripts have been described to function as a new class of post-transcriptional regulatory RNAs that behave as circular endogenous RNA sponges for the micro RNAs (miRNAs) miR-138 and miR-7, respectively. A special feature of the Sry gene is its ability to generate linear and circular transcripts, both transcribed in the sense orientation. Here we remark that both sense (e.g. Sry RN...

  3. 47 CFR 25.138 - Blanket Licensing provisions of GSO FSS Earth Stations in the 18.3-18.8 GHz (space-to-Earth), 19...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Blanket Licensing provisions of GSO FSS Earth Stations in the 18.3-18.8 GHz (space-to-Earth), 19.7-20.2 GHz (space-to-Earth), 28.35-28.6 GHz (Earth-to-space), and 29.25-30.0 GHz (Earth-to-space) bands. 25.138 Section 25.138 Telecommunication...

  4. Single-dose anti-CD138 radioimmunotherapy: bismuth-213 is more efficient than lutetium-177 for treatment of multiple myeloma in a preclinical model

    OpenAIRE

    Fichou, Nolwenn; Gouard, Sébastien; Maurel, Catherine; Barbet, Jacques; Ferrer, Ludovic; Morgenstern, Alfred; Bruchertseifer, Frank; Faivre-Chauvet, Alain; Bigot-Corbel, Edith; Davodeau, François; Gaschet, Joëlle; Chérel, Michel

    2015-01-01

    Objectives Radioimmunotherapy (RIT) has emerged as a potential treatment option for multiple myeloma (MM). In humans, a dosimetry study recently showed the relevance of RIT using an antibody targeting the CD138 antigen. The therapeutic efficacy of RIT using an anti-CD138 antibody coupled to 213Bi, an α-emitter, was also demonstrated in a preclinical MM model. Since then, RIT with β-emitters has shown efficacy in treating hematologic cancer. In this paper, we investigate the therapeutic eff...

  5. A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

    Energy Technology Data Exchange (ETDEWEB)

    Cobben, Lodewijk [Medisch Centrum Haaglanden, Department of Radiology, Leidschendam (Netherlands); Groot, Ingrid [Medisch Centrum Haaglanden, Department of Surgery, Leidschendam (Netherlands); Kingma, Lucas; Coerkamp, Emile; Puylaert, Julien [Medisch Centrum Haaglanden, Department of Radiology, Den Haag (Netherlands); Blickman, Johan [Universitair Medisch Centrum St Radboud, Department of Radiology, Geert Grooteplein 10, GA, Nijmegen (Netherlands)

    2009-05-15

    To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

  6. A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

    International Nuclear Information System (INIS)

    To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

  7. Charge-cloud alignment in the electron-impact excitation of 138Ba( . . .6s6p 1P1)

    International Nuclear Information System (INIS)

    We have determined charge-cloud alignment parameters Pl+ and γ for electron-impact excitation of the (6s21S0) to (6s6p 1P1) transition in 138Ba by measuring the superelastic scattering of electrons from laser-excited 138Ba. Four electron-impact energies were studied and scattering-angle coverage in each case was sufficient to allow the observation of pronounced structure in the behavior of these parameters. Comparison of our measurements with two distorted-wave theories [R. E. H. Clark, J. Abdallah, Jr., G. Csanak, and S. P. Kramer, Phys. Rev. A 40, 2935 (1989); R. Srivastava, T. Zuo, R. P. McEachran, and A. D. Stauffer, J. Phys. B 25, 3709 (1992)] reveals generally excellent agreement except at the lowest impact energy studied where these theories fail completely to reproduce the observed behavior of Pl+. Our low-impact-energy data have also been compared with a close-coupling calculation [I. I. Fabrikant, Izv. Akad. Nauk Latv. SSR, Ser. Fiz. Tekhn. 6, 11 (1985)] which qualitatively reproduces the observed behavior of Pl+ and γ but fails to give quantitative agreement

  8. Study of 138 Neisseria meningitidis strains isolated from blood or cerebrospinal fluid in Lombardy between 2007 and 2010

    Directory of Open Access Journals (Sweden)

    Laura Daprai

    2012-06-01

    Full Text Available Neisseria meningitidis, Streptococcus pneumoniae, and Haemophilus influenzae type b cause the majority of cases of bacterial septicaemia in children and young adults. Disease epidemiology is evolving rapidly due to the introduction of vaccines and changing in bacterial antibiotic-resistance patterns. (Asymptomatic nasopharyngeal colonization with Neisseria meningitides occurs in 5-10% of adult. The aim of this study was to calculate the frequency of each serogroup of this pathogens involved in invasive infection and to study susceptibility to antibiotics of these strains. Between March 2007 and June 2010 we received, from 43 hospitals of Lombardy, 138 strains of Neisseria meningitidis, from 138 patients aged (2-80yrs. The most frequent serogroup was B (58%, followed by serogroup C (34%, serogroup G (4% and W 135 (2%. Serogroup A end X accounted for 1% of invasive infection, each. We observed a decrease in susceptibility towards penicillin in 38% of strains. In addition we studied, by REP- PCR, genotype of 9 strains selected on the basis of epidemiological data.Among these strains, 3 different clusters according to the 3 small epidemic outbreaks occurred between June and September 2009, were recognised. Seven of these strains, although belonged to the same serogroup, brought about two different clusters. The present findings demonstrated that phenotypic data are not sufficient to define epidemic clusters, therefore molecular genotyping is required.

  9. INTEGRATED POLARIZATION PROPERTIES OF 3C48, 3C138, 3C147, AND 3C286

    Energy Technology Data Exchange (ETDEWEB)

    Perley, R. A.; Butler, B. J., E-mail: RPerley@nrao.edu, E-mail: BButler@nrao.edu [National Radio Astronomy Observatory, P.O. Box O, Socorro, NM 87801 (United States)

    2013-06-01

    We present the integrated polarization properties of the four compact radio sources 3C48, 3C138, 3C147, and 3C286, from 1 to 50 GHz, over a 30 yr time frame spanning 1982-2012. Using the polarized emission of Mars, we have determined that the position angle of the linearly polarized emission of 3C286 rises from 33 Degree-Sign at 8 GHz to 36 Degree-Sign at 45 GHz. There is no evidence for a change in the position angle over time. Using these values, the position angles of the integrated polarized emission from the other three sources are determined as a function of frequency and time. The fractional polarization of 3C286 is found to be slowly rising, at all frequencies, at a rate of {approx}0.015% yr{sup -1}. The fractional polarizations of 3C48, 3C138, and 3C147 are all slowly variable, with the variations correlated with changes in the total flux densities of these sources.

  10. Highly active and stable Pt electrocatalysts promoted by antimony-doped SnO2 supports for oxygen reduction reactions

    DEFF Research Database (Denmark)

    Yin, Min; Xu, Junyuan; Li, Qingfeng; Jensen, Jens Oluf; Huang, Yunjie; Cleemann, Lars Nilausen; Bjerrum, Niels J.; Xing, Wei

    2014-01-01

    composite supports, which limited the mass activity of the supported catalysts. When the ATO composites were used as supports, the Pt/C-ATO catalysts showed significantly enhanced catalytic activity and durability for the ORR, attributable to the high ECSA and modified electronic structure of Pt by the ATO......Alternative composite supports for platinum catalysts were synthesized from antimony doped tin dioxide (ATO) nanoparticles. In the range of the antimony content from 0 to 11mol%, the highest electrical conductivity of 1.1Scm-1 at 130°C was obtained for the 5mol% Sb ATO, from which composite...... supports composed of oxides and carbon and supported platinum catalysts were prepared. Using the pure oxide support, the Pt/ATO catalyst displayed superior specific activity and stability for the oxygen reduction reactions (ORRs). Low surface area of ATO caused poor dispersion of Pt particles compared to...

  11. Promoting the Hydrosilylation of Benzaldehyde by Using a Dicationic Antimony-Based Lewis Acid: Evidence for the Double Electrophilic Activation of the Carbonyl Substrate.

    Science.gov (United States)

    Hirai, Masato; Cho, Junsang; Gabbaï, François P

    2016-05-01

    The concomitant activation of carbonyl substrates by two Lewis acids has been investigated by using [1,2-(Ph2 MeSb)2 C6 H4 ](2+) ([1](2+) ), an antimony-based bidentate Lewis acid obtained by methylation of the corresponding distibine. Unlike the simple stibonium cation [Ph3 MeSb](+) , dication [1](2+) efficiently catalyzes the hydrosilylation of benzaldehyde under mild conditions. The catalytic activity of this dication is correlated to its ability to doubly activate the carbonyl functionality of the organic substrate. This view is supported by the isolation of [1-μ2 -DMF][OTf]2 , an adduct, in which the DMF oxygen atom bridges the two antimony centers. PMID:26934491

  12. Antimoniais empregados no tratamento da leishmaniose: estado da arte Antimonials employed in the treatment of leishmaniaisis: the state of the art

    OpenAIRE

    Susanne Rath; Luciano Augusto Trivelin; Talitha Rebecca Imbrunito; Daniela Maria Tomazela; Marcelo Nunes de Jesús; Percy Calvo Marzal; Heitor Franco de Andrade Junior; André Gustavo Tempone

    2003-01-01

    Antimony preparations are the drugs of choice for the treatment of leishmaniasis over 90 years, a disease that currently affects 12 million people worldwide. Its introduction was based on 19th century concepts of therapeutic effects of metal salts as arsenicals and other metals, most of them abandoned due to toxic effects or better drugs. In the last three decades, there was a great improvement in the knowledge of cell biology and immunology of those infections, but chemotherapy has not been ...

  13. Arsenic and antimony determination in refined and unrefined table salts by means of hydride generation atomic absorption spectrometry--comparison of sample decomposition and determination methods

    OpenAIRE

    AKSUNER, Nur; TİRTOM, Vedia Nüket; HENDEN, Emür

    2011-01-01

    An evaluation was made of different digestion methods for the determination of arsenic and antimony in table salt samples prior to hydride generation atomic absorption spectrometric analysis. Microwave acid digestion, classical wet digestion, dry ashing, and fusion were applied to the decomposition of salt samples and optimum conditions were investigated. Samples were decomposed by changing heating time, digestion techniques, and the amount and composition of acid, and then the concen...

  14. Decreased antimony uptake and overexpression of genes of thiol metabolism are associated with drug resistance in a canine isolate of Leishmania infantum

    OpenAIRE

    Verónica Gómez Pérez; Raquel García-Hernandez; Victoriano Corpas-López; Tomás, Ana M.; Joaquina Martín-Sanchez; Santiago Castanys; Francisco Gamarro

    2016-01-01

    Visceral leishmaniasis (VL) caused by the protozoan parasite Leishmania infantum, is one of the most important zoonotic diseases affecting dogs and humans in the Mediterranean area. The presence of infected dogs as the main reservoir host of L. infantum is regarded as the most significant risk for potential human infection. We have studied the susceptibility profile to antimony and other anti-leishmania drugs (amphotericin B, miltefosine, paromomycin) in Leishmania infantum isolates extracted...

  15. Antimony determination in seawater and pore water of marine sediments by means of coprecipitation with Mg(OH)2 and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    The study of biogeochemical cycling of trace elements in inshore marine environment is of basic importance in order to understand the long-term distribution of both conventional and radioactive pollutants among the ecosystem components. Antimony is of radio- ecological interest, and its determination in some environmental matrices (seawater, pore water, biota) is always difficult from the analytical point of view. A quick method for antimony determination in seawater and interstitial water of marine sediments, by coprecipitation with Mg(OH)2 and subsequent atomic absorption measurement, is reported. Coprecipitation recovery (about 80% in optimal conditions) was evaluated using both radiotracers and the addition of known amounts of stable element, and turned out to depend on several parameters (percentage of precipitated Mg as compared to the natural content in seawater, ageing of Mg(OH)2, concomitant Fe and Mn concentrations, etc.). The total standard deviation of the proposed method is about 10%. The variance analysis showed that about 90% of total variance is due to the preconcentration procedure (sample handling and random contaminations) and only about 10% is due to the instrumental measurement. The results of antimony determinations in seawater and pore water of marine sediments collected at Montalto di Castro (Central Mediterranean Sea) are presented and discussed

  16. Mobility and chemical fate of arsenic and antimony in water and sediments of Sarouq River catchment, Takab geothermal field, northwest Iran.

    Science.gov (United States)

    Sharifi, Reza; Moore, Farid; Keshavarzi, Behnam

    2016-04-01

    Arsenic (As) and antimony (Sb) concentrations in water and sediments were determined along flow paths in the Sarouq River, Zarshuran and Agh Darreh streams. The results indicate high As and Sb concentrations in water and sediment samples. Raman spectroscopy shows hematite (α-Fe2O3), goethite [α-FeO(OH)] and lepidocrocite [γ-FeO(OH)] in sediment samples. Calculated saturation indices (SI) indicate oversaturation with respect to amorphous Fe(OH)3 for all samples, but undersaturation with respect to Al and Mn mineral and amorphous phases. Therefore, ferric oxides and hydroxides are assumed to be principal mineral phases for arsenic and antimony attenuation by adsorption/co-precipitation processes. The considerable difference between As and Sb concentration in sediment is due to strong adsorption of As(V) into the solid phase. Also, lower affinity of Sb(V) for mineral surfaces suggests a greater potential for aqueous transport. The adsorption of arsenic and antimony was examined using the Freundlich adsorption isotherm to determine their distribution model in water-sediment system and its compatibility with the existing theoretical model. The results showed that the adsorption behavior of both elements complies with the Freundlich adsorption isotherm. PMID:26820974

  17. 妊娠期糖尿病孕产妇138例妊娠结局分析%Analysis of pregnancy outcome of 138 cases women with gestational diabetes mellitus

    Institute of Scientific and Technical Information of China (English)

    覃红珍

    2014-01-01

    Objective To explore the clinical manifestations and pregnancy outcomes of various gestational diabetic mellitus, master the approaches for gestational diabetes mellitus (GDM) and the prevent the emergencies that patients may come about. Methods Investigated various indicators of 138 cases of pregnant women with GDM who were hospitalized from Jan 2013 to Jan 2014 in our hospital, and made a statistics and evaluation for the patients' complications that appeared in pregnancy and newborn's situation after childbirth, at the same time, subjected to the same survey for 138 cases of non-diabetic pregnant women, and compared the results, then analyzed the impact of diabetes on women' pregnancy process and newborns. Results The amniotic fluid index, maternal weight and neonatal birth weight of patients with GDM were higher than those of normal pregnant women, and the differences were significant(P<0.05). The cesarean section proportion of patients with GDM was higher than the normal pregnant women, the abnormal situation number of amniotic fluid volume was higher as well. Cases of preterm delivery in patients with GDM was more than that in normal pregnant women , preterm delivery rate could be as high as 6.5%. In patients with GDM, the gestational hypertension, postpartum hemorrhage and newborn complications rate were much higher than those of the normal pregnant women. Conclusion Diabetes not only affects maternal health but also effects the perinatal out-comes,it should be prevented early.%探讨妊娠期各种糖尿病患者的临床表现以及妊娠结局,从而掌握妊娠期糖尿病(GDM)的处理方式,对患者可能出现的情况进行预防。方法选取2013年1月~2014年1月我院收治的138例患有糖尿病的孕妇进行各项指标调查,对患者妊娠过程中出现的合并症及分娩后新生儿情况进行统计和评价,同时对138例非糖尿病孕妇进行同样的调查统计,将结果进行对比,分析糖尿

  18. 138例子宫腺瘤样瘤临床病理及免疫组化特征分析%Analysis of clinicopathological and immunohistochemical characteristics of 138 cases with ad-enomatoid tumor of uterus

    Institute of Scientific and Technical Information of China (English)

    周洪园; 邹燕丽; 卓俊菊; 付蓉; 李红

    2015-01-01

    目的:探讨子宫腺瘤样瘤的组织发生、临床病理、免疫组化特征及鉴别诊断,提高子宫腺瘤样瘤的诊断水平。方法回顾性分析我科2004年1月~12月138例经病理确诊的子宫腺瘤样瘤的临床、巨检及光镜检查资料及免疫组化特征。结果子宫腺瘤样瘤占同期子宫标本的1.85%(138/7460),其中合并平滑肌瘤和/或腺肌症占69.6%(96/138)。巨检肿瘤多位于肌壁间或浆膜下,平均直径2.4 cm,界限较清,但无包膜,切面呈实性,灰红或灰白色,部分呈灰黄色,部分可见细小裂隙或微囊甚至囊腔形成。光镜下见肿瘤由大小不等、形态不一的裂隙样或脉管样结构组成,腔内可见蓝染的分泌物,内衬有扁平、立方状细胞,胞质红染,核圆形或卵圆形,无明显异型性及病理性核分裂像。免疫组化显示内衬肿瘤细胞呈 pan-CK、Vim-entin、D2-40、Calretinin 阳性,CD34、CEA、CD31、PAX2/8、SMA 阴性,Ki-67增殖指数≤10%。结论免疫组化提示子宫腺瘤样瘤为间皮起源性肿瘤,多数伴有平滑肌瘤和(或)腺肌症,临床病理表现和免疫组化特征有助于该病的诊断和鉴别诊断。%Objective To analyze the histogenesis,clinicopathological and immunohistochemical features and differential diag -nosis of adenomatoid tumors (ATs)of uterus in order to improve the level of diagnosis .Methods Data of clinical information,autopsy and pathological morphology and immunohistochemical features of 138 cases with ATs of uterus diagnosed by pathology from January 2004 to December 2014 in our department were retrospectively analyzed .Results The cases of ATs of uterus were 1.85% of all uterus samples in corresponding time (138 /7460),in which uterine 1eiomyoma or adenomyoma were 69.6%(96 /138).The tumor autopsy showed that the tumors were located in the uterine muscle walls or under serosa with average size about 2.4 cm

  19. Carbide precipitates in solution-quenched PH13-8 Mo stainless steel: A small-angle neutron scattering investigation

    Indian Academy of Sciences (India)

    D Sen; A K Patra; S Mazumder; J Mittra; G K Dey; P K De

    2004-08-01

    This paper deals with the small-angle neutron scattering (SANS) investigation on solution-quenched PH13-8 Mo stainless steel. From the nature of the variation of the functionality of the profiles for varying specimen thickness and also from the transmission electron microscopy (TEM), it has been established that the small-angle scattering signal predominantly originates from the block-like metallic carbide precipitates in the specimen. The contribution due to double Bragg reflection is not significant in the present case. The single scattering profile has been extracted from the experimental profiles corresponding to different values of specimen thickness. In order to avoid complexity and non-uniqueness of the multi-parameter minimization for randomly oriented polydisperse block-like precipitate model, the data have been analyzed assuming randomly oriented polydisperse cylindrical particle model with a locked aspect ratio.

  20. Comparative analysis of CD138 antigen targeting for the treatment of multiple myeloma with bismuth-213 and Melphalan chemotherapy

    International Nuclear Information System (INIS)

    Full text of publication follows. Aim: multiple myeloma (MM) is a B-cell malignancy of terminally differentiated plasma cells within the bone marrow, with the presence of a monoclonal immunoglobulin in serum and/or urine and development of osteolytic bone lesions in human. Despite intense research to develop new treatments, cure is almost never achieved. Alpha-radioimmunotherapy (RIT) has been shown to be effective in vivo in a multiple myeloma model and seems particularly suited for disseminated tumour cells or small clusters of tumour cells. CD138 (Syndecan-1) is found mainly in epithelial cells, but has been shown to be expressed by most myeloma cells, both in human and in mouse. In order to define where alpha RIT stands in MM treatment, the aim of this study was to compare Melphalan, MM standard treatment, with alpha RIT using a bismuth-213-labelled anti-mouse CD138 rat antibody in a syngeneic mouse MM model. Material and Methods: C57BL/KaLwRij mice were grafted with 106 5T33 cells (murine myeloma cells). Luciferase transfected 5T33 were used for in vivo localization of the cells during the course of disease. The first step of the study was to assess the dose-response of Melphalan (100, 200 et 300 μg/mouse), 21 days after engraftment. The second step consisted in therapeutic association: Melphalan followed by RIT at d22 et d25 after engraftment. Toxicity (animal weight, blood cell counts) and treatment efficacy were studied in animals receiving no treatment, injected with Melphalan alone (200 μg), RIT alone at d22 and d25 (3.7 MBq of 213Bi-anti-CD138) and Melphalan combined with alpha RIT. Results: fifty percent of untreated mice died by d64 after MM engraftment. In mice treated with Melphalan alone, only the 200 μg dose improved median survival. No animal was cured after Melphalan treatment whereas 60% of the mice survived with RIT alone at d22 after tumour engraftment. However, the therapeutic window seems to be narrow, indeed no effect was observed with

  1. 2011年全球管理安全服务市场将达138亿美元

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    据通信市场研究公司Infonetics Research最新发表的研究报告“安全和加密的虚拟专用网服务”称,2011年全球管理的安全服务市场收入将达到138亿美元,比2007年增长近一倍。管理的安全服务市场包括基于客户端设备和网络的管理的防火墙、内容安全和其它安全服务。

  2. Vertical Sizing of Cirrus Clouds using the 1.38 μm Spectral Lines and MODIS Data

    Science.gov (United States)

    Wang, X.; Liou, K.; Ou, S.

    2006-12-01

    Atmospheric albedo and heating rates in cloudy conditions are dependent on the vertical inhomogeneity of clouds. For example, small ice crystal sizes aloft coupled with larger sizes at the cloud base would reflect more solar radiation as compared to the use of an averaged ice crystal size for the same cloud. Significant variability of the heating rate also occurs in association with vertical inhomogeneity. In situ measurements from the airborne optical probe, replicator, and cloud scope clearly illustrate the vertical distribution of ice crystal size and shape. We have developed an approach to infer the vertical profile of mean effective particle size on the basis of the spectral line reflectance of the 1.38 μm water vapor band. In it, seventeen narrow bands of various water vapor absorption strengths have been selected. The physical principle for this approach is based on the fact that the reflectance in strong absorptive wavelengths is most sensitive to cloud top properties, whereas the reflectance in less absorptive wavelengths senses the microphysical properties deeper into the cloud. To test this concept, we have prescribed several cloud vertical structures and used an adding-doubling radiative transfer program coupled with the correlated k-distribution method to calculate the look-up tables of reflectance for a variety of cloud settings. We show some success of hypothetical retrieval exercises by applying a χ2 minimization principle. The vertical sizing idea described above has been applied to the MODIS visible and three near-IR channels and we demonstrate that it is possible to derive two vertical ice crystal sizes from a combination of these channels. For validation purposes, we have selected a number of cirrus scenes over the ARM Southern Great Plain site and compared the retrieved vertical ice crystal sizes with the ground-based cloud radar retrieval values. The vertical sizing results determined from the 1.38 μm spectral lines and MODIS data will be

  3. Validation of interphase fluorescence in situ hybridization (iFISH for multiple myeloma using CD138 positive cells

    Directory of Open Access Journals (Sweden)

    Renata Kiyomi Kishimoto

    2016-06-01

    Full Text Available ABSTRACT BACKGROUND: Multiple myeloma is a plasma cell neoplasm with acquired genetic abnormalities of clinical and prognostic importance. Multiple myeloma differs from other hematologic malignancies due to a high fraction of low proliferating malignant plasma cells and the paucity of plasma cells in bone marrow aspiration samples, making cytogenetic analysis a challenge. An abnormal karyotype is found in only one-third of patients with multiple myeloma and interphase fluorescence in situ hybridization is the most useful test for studying the chromosomal abnormalities present in almost 90% of cases. However, it is necessary to study the genetic abnormalities in plasma cells after their identification or selection by morphology, immunophenotyping or sorting. Other challenges are the selection of the most informative FISH panel and determining cut-off levels for FISH probes. This study reports the validation of interphase fluorescence in situ hybridization using CD138 positive cells, according to proposed guidelines published by the European Myeloma Network (EMN in 2012. METHOD: Bone marrow samples from patients with multiple myeloma were used to standardize a panel of five probes [1q amplification, 13q14 deletion, 17p deletion, t(4;14, and t(14;16] in CD138+ cells purified by magnetic cell sorting. RESULTS: This test was validated with a low turnaround time and good reproducibility. Five of six samples showed genetic abnormalities. Monosomy/deletion 13 plus t(4;14 were found in two cases. CONCLUSION: This technique together with magnetic cell sorting is effective and can be used in the routine laboratory practice. In addition, magnetic cell sorting provides a pure plasma cell population that allows other molecular and genomic studies.

  4. Synthesis and properties of crystalline thin film of antimony trioxide on the Si(1 0 0) substrate

    International Nuclear Information System (INIS)

    Highlights: • Formation of crystalline phase of Sb2O3 on Si(1 0 0) is demonstrated. • STM and STS characterizations of the grown Sb2O3 film are presented. • STS results elucidate the band gap of Sb2O3. • Ab initio calculations reveal energetically favored Sb2O3 surface structures. - Abstract: Atomic-scale understanding and processing of the surface and interface properties of antimony trioxide (Sb2O3) are essential to the development of nanoscale Sb2O3 materials for various applications, such as photocatalysts, transparent conducting oxides, optical coatings, dielectric films, and fire retardants. Lack of atomically well-defined, crystalline Sb2O3 templates has however hindered atomic resolution characterization of the Sb2O3 properties. We report the preparation of crystalline Sb2O3 thin films on the Si(1 0 0) substrate with a simple process by oxidizing Sb-covered Si(1 0 0) in proper conditions. Physical properties of the synthesized films have been elucidated by low-energy electron diffraction, scanning tunneling microscopy and spectroscopy, and ab initio calculations. The spectroscopic results show that the band gap of Sb2O3 is 3.6 eV around the gamma point (i.e. Γ). Calculations reveal energetically favored Sb2O3(1 0 0) surface structures. The findings open a new path for the atomic-scale research of Sb2O3

  5. Synchronous Improvement of Dispersibility and Electrical Property of Antimony Doped Tin Oxide Nanoparticles Processed by Polyvinyl Alcohol

    Science.gov (United States)

    Liu, Shimin; Wen, Bin; Jiang, Weiwei; Liu, Chaoqian; Ding, Wanyu; Wang, Nan; Chai, Weiping

    2015-08-01

    Antimony doped tin oxide (ATO) nanoparticles were prepared by wet chemical coprecipitation method with different contents of polyvinyl alcohol (PVA) dispersant. The prepared ATO nanoparticles have been characterized by means of XRD, SEM, HRTEM, SAED, EDS, bulk density and electrical resistivity measurement. Results indicated that the approach functionalized by PVA dispersant enables a synchronous improvement of two important properties namely the dispersibility and electrical conductivity due to the mechanism of avoiding the formation of agglomeration of nanoparticles, which could be regarded as primary factors for the enhanced electron transfer of powders: The surface area over which are crucial for the interfacial arrangement and electron charge scattering/transfer processes. The bulk density and electrical resistivity decreased to a minimum of 0.90 g/cm3 and 1.44 Ωṡcm at PVA dispersant content of 5%, and increased rapidly at higher PVA contents. The prepared ATO nanoparticles can serve as a kind of effective conductive filler in insulating species such as plastics, textile and rubber.

  6. Lithium intercalation in sputter deposited antimony-doped tin oxide thin films: Evidence from electrochemical and optical measurements

    Energy Technology Data Exchange (ETDEWEB)

    Montero, J., E-mail: jose.montero@angstrom.uu.se; Granqvist, C. G.; Niklasson, G. A. [Department of Engineering Sciences, The A°ngström Laboratory, Uppsala University, P.O. Box 534, SE-751 21 Uppsala (Sweden); Guillén, C.; Herrero, J. [Department of Energy, Ciemat, Avda. Complutense 40, Ed. 42, E-28040 Madrid (Spain)

    2014-04-21

    Transparent conducting oxides are used as transparent electrical contacts in a variety of applications, including in electrochromic smart windows. In the present work, we performed a study of transparent conducting antimony-doped tin oxide (ATO) thin films by chronopotentiometry in a Li{sup +}-containing electrolyte. The open circuit potential vs. Li was used to investigate ATO band lineups, such as those of the Fermi level and the ionization potential, as well as the dependence of these lineups on the preparation conditions for ATO. Evidence was found for Li{sup +} intercalation when a current pulse was set in a way so as to drive ions from the electrolyte into the ATO lattice. Galvanostatic intermittent titration was then applied to determine the lithium diffusion coefficient within the ATO lattice. The electrochemical density of states of the conducting oxide was studied by means of the transient voltage recorded during the chronopotentiometry experiments. These measurements were possible because, as Li{sup +} intercalation took place, charge compensating electrons filled the lowest part of the conduction band in ATO. Furthermore, the charge insertion modified the optical properties of ATO according to the Drude model.

  7. Antimony segregation in Ge and formation of n-type selectively doped Ge films in molecular beam epitaxy

    International Nuclear Information System (INIS)

    Antimony segregation in Ge(001) films grown by molecular beam epitaxy was studied. A quantitative dependence of the Sb segregation ratio in Ge on growth temperature was revealed experimentally and modeled theoretically taking into account both the terrace-mediated and step-edge-mediated segregation mechanisms. A nearly 5-orders-of-magnitude increase in the Sb segregation ratio in a relatively small temperature range of 180–350 °C was obtained, which allowed to form Ge:Sb doped layers with abrupt boundaries and high crystalline quality using the temperature switching method that was proposed earlier for Si-based structures. This technique was employed for fabrication of different kinds of n-type Ge structures which can be useful for practical applications like heavily doped n+-Ge films or δ-doped layers. Estimation of the doping profiles sharpness yielded the values of 2–5 nm per decade for the concentration gradient at the leading edge and 2–3 nm for the full-width-half-maximum of the Ge:Sb δ-layers. Electrical characterization of grown Ge:Sb structures revealed nearly full electrical activation of Sb atoms and the two-dimensional nature of charge carrier transport in δ-layers

  8. Profiling microbial community in a watershed heavily contaminated by an active antimony (Sb) mine in Southwest China.

    Science.gov (United States)

    Sun, Weimin; Xiao, Enzong; Dong, Yiran; Tang, Song; Krumins, Valdis; Ning, Zengping; Sun, Min; Zhao, Yanlong; Wu, Shiliang; Xiao, Tangfu

    2016-04-15

    Located in Southwest China, the Chahe watershed has been severely contaminated by upstream active antimony (Sb) mines. The extremely high concentrations of Sb make the Chahe watershed an excellent model to elucidate the response of indigenous microbial activities within a severe Sb-contaminated environment. In this study, water and surface sediments from six locations in the Chahe watershed with different levels of Sb contamination were analyzed. Illumina sequencing of 16S rRNA amplicons revealed more than 40 phyla from the domain Bacteria and 2 phyla from the domain Archaea. Sequences assigned to the genera Flavobacterium, Sulfuricurvum, Halomonas, Shewanella, Lactobacillus, Acinetobacter, and Geobacter demonstrated high relative abundances in all sequencing libraries. Spearman's rank correlations indicated that a number of microbial phylotypes were positively correlated with different speciation of Sb, suggesting potential roles of these phylotypes in microbial Sb cycling. Canonical correspondence analysis further demonstrated that geochemical parameters, including water temperature, pH, total Fe, sulfate, aqueous Sb, and Eh, significantly structured the overall microbial community in Chahe watershed samples. Our findings offer a direct and reliable reference to the diversity of microbial communities in the presence of extremely high Sb concentrations, and may have potential implications for in situ bioremediation strategies of Sb contaminated sites. PMID:26820933

  9. A novel voltammetric sensor based on carbon nanotubes and nanoparticles of antimony tin oxide for the determination of ractopamine.

    Science.gov (United States)

    Baytak, Aysegul Kutluay; Teker, Tugce; Duzmen, Sehriban; Aslanoglu, Mehmet

    2016-02-01

    An electrochemical sensor was prepared by the modification of a glassy carbon electrode (GCE) with carbon nanotubes (CNTs) and nanoparticles of antimony tin oxide (ATO). The surface layer was characterized by scanning electronmicroscopy (SEM), energy dispersive X-ray diffraction method (EDX) and ATR FT-IR spectroscopy. The proposed electrode was assessed in respect to the electro-oxidation of ractopamine. Compared with a bare GCE and a GCE electrode modified with CNTs, the ATONPs/CNTs/GCE exhibited a great catalytic activity towards the oxidation of ractopamine with a well-defined anodic peak at 600 mV. The current response was linear with the concentration of ractopamine over the range from 10 to 240 nM with a detection limit of 3.3 nM. The proposed electrode enabled the selective determination of ractopamine in the presence of high concentrations of ascorbic acid (AA), dopamine (DA) and uric acid (UA). The proposed electrode was successfully applied for the determination of ractopamine in feed and urine samples. The sensitive and selective determination of ractopamine makes the developed method of great interest for monitoring its therapeutic use and doping control purposes. PMID:26652385

  10. Effect of Vanadium and Titanium substitution over an antimony-based mixed oxide catalysts for propane ammoxidation to acrylonitrile

    International Nuclear Information System (INIS)

    Antimony (Sb) oxide is known to be the active phase for the ammoxidation of propane to acrylonitrile (ACN). The influenced of V and/ or Ti on the physicochemical properties of Sb-based mixed oxide catalysts were studied using catalysts prepared by slurry method. The dried precursor was calcined in air at 350-600 degree Celsius for a total of 10 h. The active phases in Sb-promoted catalysts were determined using X-ray Diffraction (XRD) while the changes in microstructure of these catalysts were studied using physical adsorption of nitrogen gas. The catalytic activities of these catalysts were tested in a fixed-bed reactor with online GC at 420 degree Celsius with reaction feed (% v) of 5.8:7:17.4 for propane, ammonia and oxygen, respectively. Results show that promotional of Sb with V and/ or Ti has an effect on the chemical environment of the Sb-mixed oxide catalysts, leading to differences in catalytic activity of these catalysts. (author)

  11. Quadrupole coupling constants and isomeric Moessbauer shifts for halogen-containing gold, platinum, niobium, tantalum and antimony compounds

    International Nuclear Information System (INIS)

    We have analyzed by means of Density functional theory calculations the nuclear quadrupole coupling constants of a range of gold, antimony, platinum, niobium and tantalum compounds. The geometrical parameters and halogen nuclear quadrupole coupling constants obtained by these calculations substantially corresponded to the data of microwave and nuclear quadrupole resonance spectroscopy. An analysis of the quality of the calculations that employ pseudo-potentials and all-electron basis sets for the halogen compounds was carried out. The zero order regular approximation (ZORA) method is shown to be a viable alternative for the calculation of halogen coupling constants in molecules. In addition, the ZORA model, in contrast to the pseudo-potential model, leads to realistic values of all metal nuclear quadrupole coupling constants. From Klopman's approach, it follows that the relationship between the electrostatic bonding and covalent depends on the nature of the central atom. The results on Moessbauer chemical shifts are also in a good agreement with the coordination number of the central atom.

  12. Quantitative study of the effect of deposition temperature on antimony incorporation in InAs/InAsSb superlattices

    Science.gov (United States)

    Haugan, H. J.; Mahalingam, K.; Szmulowicz, F.; Brown, G. J.

    2016-02-01

    InAs/InAsSb superlattices (SLs) are being actively explored for infrared detector applications owing to their superior carrier lifetimes. However, antimony (Sb) segregation during growth can alter the properties of the grown material. In this study, using X-ray energy dispersive spectrometry, authors quantify the compositional profile of individual layers and establish epitaxial parameters for high-quality InAs/InAsSb SL materials. Epitaxial conditions are determined for a nominal 7.7 nm InAs/3.5 nm InAs0.7Sb0.3 SL structure tailored for an approximately 6 μm response at 150 K. Since the growth of mixed anion alloys is complicated by the potential reaction of As2 with Sb surfaces, authors varied the deposition temperature (Tg) in order to control As2 surface reactions on Sb surfaces. Authors find that Sb incorporation is suppressed by 21%, with the increase of Tg from 395 to 440 °C. This incorporation likely stems from Sb surface segregation during InAsSb layer growth that is driven by the As-Sb exchange mechanism, which can lead to significant compositional and dimensional deviations from the intended design.

  13. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss

    International Nuclear Information System (INIS)

    145 stars with Nh>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c π- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs

  14. 138 000m3 LNG运输船液货舱维护系统的温度场分析%The Temperature Field Analysis for the Tank Insulation System of 138 000 m3 LNG Carrier

    Institute of Scientific and Technical Information of China (English)

    章伟星; 周昊; 蔡洙一; 陈映秋; 柳春图

    2008-01-01

    分析了一艘138 000 m3薄膜式LNG运输船液货舱维护系统的稳态温度场,研究了骨材、内外壳体间的空腔中空气的对流以及表面间的辐射对换热的影响,建立了温度场分析的数学模型;在商业软件ANSYS的基础上开发了数值计算程序,并利用有限元传热模型,计算了8种工况下船体各部分的温度分布及日蒸发率值.计算结果表明:该船在正常工况下液货舱的维护系统是有效的,符合的相关要求.

  15. Comparative analysis of multiple myeloma treatment by CD138 antigen targeting with bismuth-213 and Melphalan chemotherapy

    International Nuclear Information System (INIS)

    Introduction: Multiple myeloma (MM) is a B-cell malignancy of terminally differentiated plasma cells within the bone marrow. Despite intense research to develop new treatments, cure is almost never achieved. Alpha-radioimmunotherapy (RIT) has been shown to be effective in vivo in a MM model. In order to define where alpha-RIT stands in MM treatment, the aim of this study was to compare Melphalan, MM standard treatment, with alpha-RIT using a [213Bi]-anti-mCD138 antibody in a syngeneic MM mouse model. Methods: C57BL/KaLwRij mice were grafted with 1 × 106 5T33 murine MM cells. Luciferase transfected 5T33 cells were used for in vivo localization. The first step of the study was to assess the dose-response of Melphalan 21 days after engraftment. The second step consisted in therapeutic combination: Melphalan followed by RIT at day 22 or day 25 after engraftment. Toxicity (animal weight, blood cell counts) and treatment efficacy were studied in animals receiving no treatment, injected with Melphalan alone, RIT alone at day 22 or day 25 (3.7 MBq of [213Bi]-anti-CD138) and Melphalan combined with alpha-RIT. Results: Fifty percent of untreated mice died by day 63 after MM engraftment. In mice treated with Melphalan alone, only the 200 μg dose improved median survival. No animal was cured after Melphalan treatment whereas 60% of the mice survived with RIT alone at day 22 after tumor engraftment with only slight and reversible hematological radiotoxicity. No therapeutic effect was observed with alpha-RIT 25 days after engraftment. Melphalan and alpha-RIT combination does not improve overall survival compared to RIT alone, and results in increased leukocyte and red blood cell toxicity. Conclusions: Alpha-RIT seems to be a good alternative to Melphalan. Association of these two treatments provides no benefit. The perspectives of this work would be to evaluate RIT impact on the regimens incorporating the novel agents bortezomide, thalidomide and lenalidomide

  16. Development of a non-chromatographic method for the speciation analysis of inorganic antimony in mushroom samples by hydride generation atomic fluorescence spectrometry

    Science.gov (United States)

    Sousa Ferreira, Hadla; Costa Ferreira, Sergio Luis; Cervera, M. Luisa; de la Guardia, Miguel

    2009-06-01

    A simple and sensitive method has been developed for the direct determination of toxic species of antimony in mushroom samples by hydride generation atomic fluorescence spectrometry (HG AFS). The determination of Sb(III) and Sb(V) was based on the efficiency of hydride generation employing NaBH 4, with and without a previous KI reduction, using proportional equations corresponding to the two different measurement conditions. The extraction efficiency of total antimony and the stability of Sb(III) and Sb(V) in different extraction media (nitric, sulfuric, hydrochloric, acetic acid, methanol and ethanol) were evaluated. Results demonstrated that, based on the extraction yield and the stability of extracts, 0.5 mol L - 1 H 2SO 4 proved to be the best extracting solution for the speciation analysis of antimony in mushroom samples. The limits of detection of the developed methodology were 0.6 and 1.1 ng g - 1 for Sb(III) and Sb(V), respectively. The relative standard derivation was 3.8% (14.7 ng g - 1 ) for Sb(V) and 5.1% (4.6 ng g - 1 ) for Sb(III). The recovery values obtained for Sb(III) and Sb(V) varied from 94 to 106% and from 98 to 105%, respectively. The method has been applied to determine Sb(III), Sb(V) and total Sb in five different mushroom samples; the Sb(III) content varied from 4.6 to 11.4 ng g - 1 and Sb(V) from 14.7 to 21.2 ng g - 1 . The accuracy of the method was confirmed by the analysis of a certified reference material of tomato leaves.

  17. STUDY ON THE REMOVAL OF ANTIMONY FOR PRODUCING SODIUM STANNATE BY TIN SLAG%锡渣生产锡酸钠中除锑的研究

    Institute of Scientific and Technical Information of China (English)

    卢丹艳

    2012-01-01

    利用生产硫酸亚锡、氯化亚锡、锡:扮的含锡废料生产锡酸钠,生产成本低,但在这过程中需要除去的杂质也相对比较多。文章对除锑的工艺参数和条件进行了研究,重点探讨了除锑温度、除锑时间、除锑后溶液静置沉降时间等因素对锑效果的影响。结果表明,采用该工艺,Sb的脱除率为95.3%,产品质量符合Sn-42等级标准。%waste material that contains tin and can be used for producing Stannous sulfate, Stannous chloride and Tin powder is use for producing Sodium stannate. The cost of production may stay at a relative low level. But It needs to get rid of More impurities, Relatively speaking .In this paper, the process parameters and conditions of the removal of Antimony are studied. The factors such as the temperature and time of the removal of Antimony and time of sedimentation time of the Solution are discussed, which have an influence on the removal of Antimony. It is shown that, using this technology, removal rate of Sb is 95.3%, and the Product quality is In accordance with the grading standard of Sn 42.

  18. Facilitated extracellular electron transfer of Shewanella loihica PV-4 by antimony-doped tin oxide nanoparticles as active microelectrodes

    Science.gov (United States)

    Zhang, Xiaojian; Liu, Huan; Wang, Jinrong; Ren, Guangyuan; Xie, Beizhen; Liu, Hong; Zhu, Ying; Jiang, Lei

    2015-11-01

    Dissimilatory metal reducing bacteria are capable of extracellular electron transfer (EET) to insoluble metal oxides as external electron acceptors for their anaerobic respiration, which is recognized as an important energy-conversion process in natural and engineered environments, such as in mineral cycling, bioremediation, and microbial fuel/electrolysis cells. However, the low EET efficiency remains one of the major bottlenecks for its practical application. We report firstly that the microbial current generated by Shewanella loihica PV-4 (S. loihica PV-4) could be greatly improved that is up to ca. 115 fold, by adding antimony-doped tin oxide (ATO) nanoparticles in the electrochemical reactor. The results demonstrate that the biocompatible, electrically conductive ATO nanoparticles acted as active microelectrodes could facilitate the formation of a cells/ATO composite biofilm and the reduction of the outer membrane c-type cytochromes (OM c-Cyts) that are beneficial for the electron transfer from cells to electrode. Meanwhile, a synergistic effect between the participation of OM c-Cyts and the accelerated EET mediated by cell-secreted flavins may play an important role for the enhanced current generation in the presence of ATO nanoparticles. Moreover, it is worth noting that the TCA cycle in S. loihica PV-4 cells is activated by adding ATO nanoparticles, even if the potential is poised at +0.2 V, thereby also improving the EET process. The results presented here may provide a simple and effective strategy to boost the EET of S. loihica PV-4 cells, which is conducive to providing potential applications in bioelectrochemical systems.Dissimilatory metal reducing bacteria are capable of extracellular electron transfer (EET) to insoluble metal oxides as external electron acceptors for their anaerobic respiration, which is recognized as an important energy-conversion process in natural and engineered environments, such as in mineral cycling, bioremediation, and

  19. Geologic interpretation of seismic data along the proposed relocation of Route 138; stations 59+00 to 83+00 in Brockton, Mass.

    Science.gov (United States)

    Hazelwood, Robert M.; Castle, Robert O.

    1954-01-01

    This investigation was made to determine the surface and subsurface geological conditions along the proposed relocation of Route 138 in the vicinity of the Torrey Street crossing in Brockton, Mass. The field work was done in April 1952 as part of cooperative program of the Commonwealth of Massachusetts, Department of Public Works, and the United States Department of the Interior, Geological Survey. 

  20. Hemoglobin Brockton [β138 (H16) Ala → Pro]: An unstable variatn near the C-terminus of the β-subunits with normal oxygen-binding properties

    International Nuclear Information System (INIS)

    Hemoglobin Brockton [β138 (H16) Ala → Pro] is an unstable variant associated with a mild anemia. It has the same electrophoretic mobility as and cannot be resolved from Hb A. Oxygen affinity measurements of blood and hemolysate do not indicate biphasic oxygen saturation, showing that the functional properties of the variant are very similar to those of Hb A. This implies that the introduction of proline into the H-helix at position 138 does not disrupt the critical inter- and intrasubunit hydrogen bonds and salt bridges at the β carboxyl-terminal dipeptide, since these polar interactions are essential for the normal oxygen-binding properties of hemoglobin. X-ray crystallographic data are consistent with these findings and show that the consequences of the β138 Ala → Pro substitution are almost entirely confined to the immediate vicinity of the mutation site. Instability probably results from the inability of a buried hydrogen bond to form between Pro 138β and Val 134β

  1. Targeting of human GGT in a renal cell carcinoma mouse model with 99mTc-HYNIC-mAb 138H11

    International Nuclear Information System (INIS)

    The study shows that the specific tumor uptake of 99mTc-HYNIC-mAb 138H11 in GGT positive tumours was 2 to 5 times as high as in the controls. A high unspecific background activity was observed in the blood and in all organs well supplied with blood. (orig.)

  2. Crystallization in Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk metallic glass under pressure

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Zhou, T.J.; Rasmussen, Helge Kildahl;

    2000-01-01

    The effect of pressure on the crystallization behavior of the bulk metallic glass-forming Zr41.2Ti13.8Cu12.5Ni10Be22.5 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray powder diffraction measurements using synchrotron radiation....

  3. A Novel Anti-Human Syndecan-1(CD138) Monoclonal Antibody 4B3: Characterization and Application

    Institute of Scientific and Technical Information of China (English)

    Wanping Sun; Fengming Wang; Fang Xie; Guoqing Wang; Jin Sun; Gehua Yu; Yuhua Qiu; Xueguang Zhang

    2007-01-01

    Syndecan-1 (CD138), a member of integral membrane heparin sulfate proteoglycans, is an essential matrix receptor for maintaining the normal morphological phenotypes. In this study, we generated a specific mouse anti-human syndecan-1 monoclonal antibody (mAb) 4B3 and identified it by competition assay with the available syndecan-1 mAb (BB4). Stained by 4B3, the expression of syndecan-1 was detected on tumor cell lines, such as 8226,U266, XG-1, XG-2, Daudi and Jurkat. The expression was also found on neuron stem cells. It was established that 4B3 mAb could inhibit XG-1 and XG-2 proliferation. The data not only determined that 4B3 mAb was a functional anti-human syndecan-1 mAb, but also indicated that syndecan-1 might be a valuable surface antigen and play an important role in regulation of tumor pathology and differentiation of neural stem cells. This novel antibody 4B3 may be value of study of tumor proliferation/survival mechanism and contributes to diagnosis and treatment of diverse diseases.

  4. Comment on ``Unified explanation of the anomalous dynamic properties of highly asymmetric polymer blends'' [J. Chem. Phys. 138, 054903 (2013)

    Science.gov (United States)

    Colmenero, J.

    2013-05-01

    In a recent paper by Ngai and Capaccioli ["Unified explanation of the anomalous dynamic properties of highly asymmetric polymer blends," J. Chem. Phys. 138, 054903 (2013), 10.1063/1.4789585] the authors claimed that the so-called coupling model (CM) provides a unified explanation of all dynamical anomalies that have been reported for dynamically asymmetric blends over last ten years. Approximately half of the paper is devoted to chain-dynamic properties involving un-entangled polymers. According to the authors, the application of the CM to these results is based on the existence of a crossover at a time tc ≈ 1-2 ns of the magnitudes describing chain-dynamics. Ngai and Capaccioli claimed that the existence of such a crossover is supported by the neutron scattering and MD-simulation results, corresponding to the blend poly(methyl methacrylate)/poly(ethylene oxide), by Niedzwiedz et al. [Phys. Rev. Lett. 98, 168301 (2007), 10.1103/PhysRevLett.98.168301] and Brodeck et al. [Macromolecules 43, 3036 (2010), 10.1021/ma902820a], respectively. Being one of the authors of these two papers, I will demonstrate here that there is no evidence supporting such a crossover in the data reported in these papers.

  5. Clinical analysis of 138 cases with trigeminal neuralgia at the Department of Neurosurgery, Tokyo Dental College Ichikawa General Hospital

    International Nuclear Information System (INIS)

    We reviewed clinical data from a total of 138 trigeminal neuralgia patients treated at the Department of Neurosurgery, Tokyo Dental College Ichikawa General Hospital. In 10 patients, MRI scan revealed a brain tumor or a cerebral arteriovenous malformation, which was recognized as the cause of the trigeminal neuralgia. The remaining patients were treated with Tegretol, and side effects necessitating discontinuation of the drug occurred in six patients, including two with severe adverse reactions that required inpatient treatment. When Tegretol therapy was not applicable or proved to be less effective, the patients underwent surgical therapy or gamma knife radiosurgery. Since no symptom can predict the presence of a tumor, brain MRI is considered to be essential for all patients with trigeminal neuralgia. Although Tegretol is effective in the treatment of neuralgia, the occurrence of side effects should be carefully monitored during therapy. Considering that 116 patients (84%) were referred by oral-dental surgeons, trigeminal neuralgia is likely to be a disorder commonly encountered by these specialists, thereby indicating the importance of medical cooperation between neurosurgeons and oral-dental surgeons. (author)

  6. Separation of cirrus cloud from clear surface from AVIRIS data using the 1.38 micron water vapor band

    Science.gov (United States)

    Gao, Bo-Cai; Goetz, Alexander F. H.

    1992-01-01

    Cirrus clouds play an important role in climate systems because of their large area coverage, persistence, and radiative effects. Thin cirrus clouds are difficult to detect in visible images and infrared images in the 10-12 micron atmospheric window region, particularly over land, because these clouds are partially transparent. Ackerman recently developed a method for detecting cirrus clouds using three narrow channels centered near 8, 11, and 12 microns, respectively, based on the analysis of IR emission spectra measured with a high spectral resolution interferometer. Barton also described a method for estimating cirrus cloud height and amount from measurements with two narrow channel radiometers of the Selective Chopper Radiometer on Nimbus 5. Both channels are located within the strong 2.7 micron water vapor band absorption region. One of the channels includes additional carbon dioxide absorption. A differential absorption technique with sets of empirical coefficients was used in the estimation of cirrus cloud heights and amounts. A technique using narrow channels in the strong 1.38 micron water vapor band absorption region for detecting cirrus clouds from spectral imaging data acquired by the Airborne Visible/Infrared Imaging Spectrometer (AVIRIS) on 5 Dec. 1991 during the FIRE (The First International Satellite Cloud Climatology Project (ISCCP) Regional Experiment) Phase 2 Field Experiment is described.

  7. High-Time-Resolution Measurements of the Polarization of the Crab Pulsar at 1.38 GHz

    CERN Document Server

    Slowikowska, Agnieszka; Harding, Alice K; O'Dell, Stephen L; Elsner, Ronald F; van der Horst, Alexander J; Weisskopf, Martin C

    2014-01-01

    Using the Westerbork Synthesis Radio Telescope (WSRT), we obtained high-time-resolution measurements of the full (linear and circular) polarization of the Crab pulsar. Taken at a resolution of 1/8192 of the 34-ms pulse period (i.e., $4.1 \\mu{\\rm s}$), the 1.38-GHz linear-polarization measurements are in general agreement with previous lower-time-resolution 1.4-GHz measurements of linear polarization in the main pulse (MP), in the interpulse (IP), and in the low-frequency precursor (LFP). Consistent with previous measurements, we find the MP and LP to be linearly polarized at about $24\\%$ and $21\\%$, with no discernible difference in polarization position angle. Furthermore, we find no evidence for variation (sweep) in polarization position angle over the MP, the IP, or the LFP. However, the main pulse exhibits a small but statistically significant quadratic variation in the degree of linear polarization. In addition, we detect weak circular polarization in the main pulse and interpulse, and strong ($\\approx 2...

  8. Targeting CD138-/CD20+ Clonogenic Myeloma Precursor Cells Decreases These Cells and Induces Transferable Antimyeloma Immunity.

    Science.gov (United States)

    Lum, Lawrence G; Thakur, Archana; Kondadasula, Sri Vidya; Al-Kadhimi, Zaid; Deol, Abhinav; Tomaszewski, Elyse N; Yano, Hiroshi; Schalk, Dana L; Ayash, Lois; Zonder, Jeffrey A; Uberti, Joseph P; Abidi, Muneer H; Ratanatharathorn, Voravit

    2016-05-01

    This phase Ib clinical trial evaluated whether pretargeting of CD20(+) clonogenic myeloma precursor cells (CMPCs) with anti-CD3 × anti-CD20 bispecific antibody-armed T cells (BATs) before autologous stem cell transplantation (SCT) in patients with standard-risk and high-risk multiple myeloma would induce antimyeloma immunity that could be detected and boosted after SCT. All 12 patients enrolled in this study received 2 BATs infusions before SCT, and 4 patients received a booster infusion of BATs after SCT. Pretargeting CD138(-)/CD20(+) CMPCs with BATs before SCT was safe and reduced levels of CMPCs by up to 58% in the postinfusion bone marrow in patients who remained in remission. Four of 5 patients who remained in remission had a >5-fold increase in IFN-γ enzyme-linked immunospot responses. SOX2 antibody increased after BATs infusions and persisted after SCT. The median anti-SOX2 level at 3 months after SCT was 28.1 ng/mL (range, 4.6 to 256 ng/mL) in patients who relapsed and 46 ng/mL (range, 28.3 to 73.3 ng/mL) in patients who remained in remission. The immune correlates suggest that infusions of targeted T cells given before SCT were able to reduce CMPC levels and induced cellular and humoral antimyeloma immunity that could be transferred and boosted after SCT. PMID:26827660

  9. Synthesis and biological evaluation of novel inhibitors against 1,3,8-trihydroxynaphthalene reductase from Magnaporthe grisea.

    Science.gov (United States)

    Chen, Haifeng; Han, Xinya; Qin, Nian; Wei, Lin; Yang, Yue; Rao, Li; Chi, Bo; Feng, Lingling; Ren, Yanliang; Wan, Jian

    2016-03-15

    1,3,8-Trihydroxynaphthalene reductase (3HNR) is an essential enzymes that is involved in fungal melanin biosynthesis. Based on the structural informations of active site of 3HNR, a series of β-nitrostyrene compounds were rationally designed and synthesized. The enzymatic activities of these compounds showed that most of them exhibited high inhibitory activities (<5.0 μM) against 3HNR; compound 3-2 exhibit the highest inhibitory activity (IC50=0.29 μM). In particular, some of these compounds had moderate fungicidal activity against Magnaporthe grisea. Compound 3-4 showed high in vivo activities against M. grisea (EC50=9.5 ppm). Furthermore, compound 3-2 was selected as a representative molecule, and the probable binding mode of this compound and the surrounding residues in the active site of 3HNR was elucidated by using molecular dock. The positive results suggest that β-nitrostyrene derivatives are most likely to be promising leads toward the discovery of novel agent of rice blast. PMID:26860927

  10. Eficácia do sulfato de aminosidine na leishmaniose visceral grave, resistente ao tratamento com antimonial pentavalente

    Directory of Open Access Journals (Sweden)

    Cleudson Castro

    1995-09-01

    Full Text Available Descreve-se um caso de calazar grave resistente a dez cursos de antimonial petitavalente (glucantime à base de 20mg de Sb5/kg/dia, que respondeu favoravelmente ao sulfato de aminosidine intramuscular na dose de 20mg/kg/dia por 20 dias, repetido após 20 dias. O parasitismo esplénico passou de 50 parasitos por campo a 3 parasitos em 10 campos logo após a primeira série de sulfato de aminosidine, tornando-se negativo depois de sete meses. A melhora clínica foi imediata, com redução gradual da hepatoesplenomegalia, e desaparecimento 26 meses após. Neste período aumentou 13 kg. Após o uso de aminosidine a reação de Monténégro tornou-se positiva e as células mononucleares responderam quando estimuladas com antígenos de leishmânia.A grave kala-azar infection in a 14 years old boy is described. The leishmanial infection failed to respond to ten interrupted courses of glucantime of variable duration (14-56 days at a dose of 20mg Sb5/kg/day. However a favorable response ocurred to intramuscular aminosidine sulphate (20mg/kg/day for 20 days. This same regimen was repeated 20 days later. After the first treatment splenic puncture parasite density fell from 50 amastigotes per oil immersion field to 3 amastigotes in 10 fields. A further splenic puncture 7 months after treatment was negative. The marked hepatoesplenomegaly gradually resolved over 26 months follow up and he gained 13 kilogramas in weight. After aminosidine sulphate therapy his Montenegro reaction become positive and his lymphocytes responded to leishmania antigens.

  11. Migration and leaching risk of extraneous antimony in three representative soils of China: lysimeter and batch experiments.

    Science.gov (United States)

    Hou, H; Yao, N; Li, J N; Wei, Y; Zhao, L; Zhang, J; Li, F S

    2013-11-01

    Antimony (Sb) distribution, solubility and mobility onto natural soils of China were studied in lysimeter and batch experiments as a function of physicochemical properties of the soil. An outdoor lysimeter experiment investigated the leaching and migration of Sb in the soils with Sb-polluted topsoil and unpolluted subsoil over a 5month period. Soil solutions were collected by suction cups installed at different depth of lysimeters, and leachates were regularly collected and analyzed for Sb concentrations. The majority of the added Sb was retained in the topsoil layers, but small portions were moved to the sub-layers. Sb concentrations in the soil solutions and leachates ranged from 0-755.5 (6.38±54 on average) μg l(-1) and 0-0.45 (smaller than the detection limit) μg l(-1) respectively, indicating the low solubility of Sb in the soils. Batch experiments were performed in order to determine the sorption capacity and the partition coefficient (Kd). Freundlich isotherm described properly the equilibrium experimental data and results show that the Kd values for Primosol, Isohumosol, Ferrosol equal to 22.5, 87.8, 704 L kg(-1), respectively. These results showed the strong capacity of the soils to retain Sb, and prevent it being leached down the profile. The mobilizable Sb was in the order: Primosol>Isohumosol>Ferrosol. Sb migration in the soils was mainly associated with the exchangeable, carbonate-bound, and metal-organic complex-bound fractions. Health risk assessment indicates that Sb leaching from Ferrosol will not harm to human health through groundwater under the test conditions, while it has certain health risks from the Isohumosol and Primosol. PMID:23931906

  12. Correlating microbial community profiles with geochemical conditions in a watershed heavily contaminated by an antimony tailing pond.

    Science.gov (United States)

    Xiao, Enzong; Krumins, Valdis; Tang, Song; Xiao, Tangfu; Ning, Zengping; Lan, Xiaolong; Sun, Weimin

    2016-08-01

    Mining activities have introduced various pollutants to surrounding aquatic and terrestrial environments, causing adverse impacts to the environment. Indigenous microbial communities are responsible for the biogeochemical cycling of pollutants in diverse environments, indicating the potential for bioremediation of such pollutants. Antimony (Sb) has been extensively mined in China and Sb contamination in mining areas has been frequently encountered. To date, however, the microbial composition and structure in response to Sb contamination has remained overlooked. Sb and As frequently co-occur in sulfide-rich ores, and co-contamination of Sb and As is observed in some mining areas. We characterized, for the first time, the microbial community profiles and their responses to Sb and As pollution from a watershed heavily contaminated by Sb tailing pond in Southwest China. The indigenous microbial communities were profiled by high-throughput sequencing from 16 sediment samples (535,390 valid reads). The comprehensive geochemical data (specifically, physical-chemical properties and different Sb and As extraction fractions) were obtained from river water and sediments at different depths as well. Canonical correspondence analysis (CCA) demonstrated that a suite of in situ geochemical and physical factors significantly structured the overall microbial community compositions. Further, we found significant correlations between individual phylotypes (bacterial genera) and the geochemical fractions of Sb and As by Spearman rank correlation. A number of taxonomic groups were positively correlated with the Sb and As extractable fractions and various Sb and As species in sediment, suggesting potential roles of these phylotypes in Sb biogeochemical cycling. PMID:27182975

  13. Synthesis and properties of crystalline thin film of antimony trioxide on the Si(1 0 0) substrate

    Energy Technology Data Exchange (ETDEWEB)

    Yasir, M. [Department of Physics and Astronomy, University of Turku, FI-20014 Turku (Finland); Kuzmin, M. [Department of Physics and Astronomy, University of Turku, FI-20014 Turku (Finland); Ioffe Physical-Technical Institute, Russian Academy of Sciences, St. Petersburg 194021 (Russian Federation); Punkkinen, M.P.J.; Mäkelä, J.; Tuominen, M.; Dahl, J. [Department of Physics and Astronomy, University of Turku, FI-20014 Turku (Finland); Laukkanen, P., E-mail: pekka.laukkanen@utu.fi [Department of Physics and Astronomy, University of Turku, FI-20014 Turku (Finland); Kokko, K. [Department of Physics and Astronomy, University of Turku, FI-20014 Turku (Finland)

    2015-09-15

    Highlights: • Formation of crystalline phase of Sb{sub 2}O{sub 3} on Si(1 0 0) is demonstrated. • STM and STS characterizations of the grown Sb{sub 2}O{sub 3} film are presented. • STS results elucidate the band gap of Sb{sub 2}O{sub 3}. • Ab initio calculations reveal energetically favored Sb{sub 2}O{sub 3} surface structures. - Abstract: Atomic-scale understanding and processing of the surface and interface properties of antimony trioxide (Sb{sub 2}O{sub 3}) are essential to the development of nanoscale Sb{sub 2}O{sub 3} materials for various applications, such as photocatalysts, transparent conducting oxides, optical coatings, dielectric films, and fire retardants. Lack of atomically well-defined, crystalline Sb{sub 2}O{sub 3} templates has however hindered atomic resolution characterization of the Sb{sub 2}O{sub 3} properties. We report the preparation of crystalline Sb{sub 2}O{sub 3} thin films on the Si(1 0 0) substrate with a simple process by oxidizing Sb-covered Si(1 0 0) in proper conditions. Physical properties of the synthesized films have been elucidated by low-energy electron diffraction, scanning tunneling microscopy and spectroscopy, and ab initio calculations. The spectroscopic results show that the band gap of Sb{sub 2}O{sub 3} is 3.6 eV around the gamma point (i.e. Γ). Calculations reveal energetically favored Sb{sub 2}O{sub 3}(1 0 0) surface structures. The findings open a new path for the atomic-scale research of Sb{sub 2}O{sub 3}.

  14. Imipramine is an orally active drug against both antimony sensitive and resistant Leishmania donovani clinical isolates in experimental infection.

    Directory of Open Access Journals (Sweden)

    Sandip Mukherjee

    Full Text Available BACKGROUND: In an endeavor to find an orally active and affordable antileishmanial drug, we tested the efficacy of a cationic amphiphilic drug, imipramine, commonly used for the treatment of depression in humans. The only available orally active antileishmanial drug is miltefosine with long half life and teratogenic potential limits patient compliance. Thus there is a genuine need for an orally active antileishmanial drug. Previously it was shown that imipramine, a tricyclic antidepressant alters the protonmotive force in promastigotes, but its in vivo efficacy was not reported. METHODOLOGY/PRINCIPAL FINDINGS: Here we show that the drug is highly active against antimony sensitive and resistant Leishmania donovani in both promastigotes and intracellular amastigotes and in LD infected hamster model. The drug was found to decrease the mitochondrial transmembrane potential of Leishmania donovani (LD promastigotes and purified amastigotes after 8 h of treatment, whereas miltefosine effected only a marginal change even after 24 h. The drug restores defective antigen presenting ability of the parasitized macrophages. The status of the host protective factors TNF α, IFN γ and iNOS activity increased with the concomitant decrease in IL 10 and TGF β level in imipramine treated infected hamsters and evolution of matured sterile hepatic granuloma. The 10-day therapeutic window as a monotherapy, showing about 90% clearance of organ parasites in infected hamsters regardless of their SSG sensitivity. CONCLUSIONS: This study showed that imipramine possibly qualifies for a new use of an old drug and can be used as an effective orally active drug for the treatment of Kala-azar.

  15. New and rapid access to synthesis of novel polysubstituted imidazoles using antimony trichloride and stannous chloride dihydrate as effective and reusable catalysts

    Indian Academy of Sciences (India)

    Leyla Poorali; Bahador Karami; Khalil Eskandari; Mahboobeh Azizi

    2013-05-01

    In this work, new, efficient and environmentally adapted synthesis of polysubstituted imidazoles in one-pot is repoted. The multicomponent reaction of various aldehydes, benzil, aliphatic and aromatic primary amines and ammonium acetate under solvent-free condition is explained. The highly efficient role of antimony trichloride and stannous chloride dihydrate as catalyst in this synthesis was shown and their effects on the reaction process were studied. By this advantage, several polysubstituted imidazoles as pharmaceutical important molecules can be prepared in high yield and high purity. This method is a very easy and rapid for the synthesis of imidazole derivatives.

  16. Effect of antimony substitution for niobium on the crystal structure, piezoelectric and dielectric properties of (K0.5Na0.5)NbO3 ceramics

    DEFF Research Database (Denmark)

    Mgbemere, H E; Schneider, G A; Stegk, Tobias

    2010-01-01

    The effect of antimony (Sb) substitution for niobium (Nb) on potassium sodium niobate (KNN) ceramic was investigated with respect to the densification behaviour at different sintering temperatures, microstructure and electrical properties. A small amount of Sb5+ was added while simultaneously......+ substituted is increased, the structure of the ceramic transformed from orthorhombic to pseudo-cubic which led to slight shrinkage in the unit cell volume. Microstructural examination revealed that above 10 mol%, a second phase (K2NaSb3O9) was formed which segregated mainly to the grain boundary while the...

  17. Comparative study on the corrosion behavior of the cold rolled and hot rolled low-alloy steels containing copper and antimony in flue gas desulfurization environment

    Science.gov (United States)

    Park, S. A.; Kim, J. G.; He, Y. S.; Shin, K. S.; Yoon, J. B.

    2014-12-01

    The correlation between the corrosion and microstructual characteristics of cold rolled and hot rolled low-alloy steels containing copper and antimony was established. The corrosion behavior of the specimens used in flue gas desulfurization systems was examined by electrochemical and weight loss measurements in an aggressive solution of 16.9 vol % H2SO4 + 0.35 vol % HCl at 60°C, pH 0.3. It has been shown that the corrosion rate of hot rolled steel is lower than that of cold rolled steel. The corrosion rate of cold rolled steel was increased by grain refinement, inclusion formation, and preferred grain orientation.

  18. Preparation and Characterization of Antimony Doped Tin Oxide Thin Films Synthesized by Co-Evaporation of Sn and Sb using Plasma Assisted Thermal Evaporation

    Directory of Open Access Journals (Sweden)

    C. Jariwala

    2013-05-01

    Full Text Available Tin oxide (SnO2 thin films are having promising properties such as high visible transmittance and low electric resistivity, makes them very important transparent conductor in a variety of optoelectronics devices. Further, doping with pentavalent impurity such as Antimony (Sb enhances its conductivity considerably. In order to study the effect of Antimony doping, Antimony doped tin oxide (SnO2 : Sb thin films have been prepared by the co-evaporation of Sn and Sb using Plasma Assisted Thermal Evaporation (PATE in oxygen (O2 partial pressure at various doping level from 4% to 25%. The influence of various Sb doping levels on the compositional, electrical, optical and structural properties have been investigated using Energy Dispersive X-ray (EDX spectroscopy, Ultraviolet-Visible (UV-VIS transmission spectroscopy, four-probe resistivity measurement and X-ray Diffraction (XRD, respectively. EDX studies confirmed the different Sb doping levels in the grown films from 4 % to 25 %, while electrical resistivity is obtained in range of 0.36 to 9.5 Ohmcm using four-probe setup for 4 % to 25 % Sb doping levels. Transmittance spectra measured in UV-VIS range for Sb doped films show reduction in an average transmittance in respect to increase in Sb doping levels in the grown films. Whereas, XRD analysis reveals that higher Sb doping of 25 % induce the precipitation of antimony oxide (Sb2O3 phase and its precipitation suppressed the growth of SnO2 peaks as well as responsible for reduction in conductivity and transparency. The best electrical resistivity of optimized SnO2 : Sb (5 % is 0.36 Ohmcm without deteriorating the high (~ 80 % average transmittance in the wavelength region 300-800 nm in comparison to undoped SnO2 film (6.57 Ohmcm , confirm the usefulness of SnO2 : Sb (5 % films for device applications.

  19. Design of a Flow-Through Voltammetric Sensor Based on an Antimony-Modified Silver Electrode for Determining Lithol Rubine B in Cosmetics

    OpenAIRE

    Wang Lai-Hao; Huang Shu-Juan

    2011-01-01

    Lithol Rubine B (LRB; the disodium salt of 3-hydroxy-4-[(4-methyl-2-sulfophenyl) azo]-2-naphthalenecarboxylic acid) was detected using high-performance liquid chromatography with an electrochemical (antimony film on silver) detector (HPLC-ECD). For direct current (DC) mode, with the current at a constant potential, and measurements with suitable experimental parameters, a linear concentration from 0.125 to 1.80 μg/mL was found. The detection limit of our method was approximately 2.0 ng/mL. An...

  20. Double blind, randomized controlled trial, to evaluate the effectiveness of a controlled nitric oxide releasing patch versus meglumine antimoniate in the treatment of cutaneous leishmaniasis [NCT00317629

    Directory of Open Access Journals (Sweden)

    Silva Federico A

    2006-05-01

    Full Text Available Abstract Background Cutaneous Leishmaniasis is a worldwide disease, endemic in 88 countries, that has shown an increasing incidence over the last two decades. So far, pentavalent antimony compounds have been considered the treatment of choice, with a percentage of cure of about 85%. However, the high efficacy of these drugs is counteracted by their many disadvantages and adverse events. Previous studies have shown nitric oxide to be a potential alternative treatment when administered topically with no serious adverse events. However, due to the unstable nitric oxide release, the topical donors needed to be applied frequently, making the adherence to the treatment difficult. The electrospinning technique has allowed the production of a multilayer transdermal patch that produces a continuous and stable nitric oxide release. The main objective of this study is to evaluate this novel nitric oxide topical donor for the treatment of cutaneous leishmaniasis. Methods and design A double-blind, randomized, double-masked, placebo-controlled clinical trial, including 620 patients from endemic areas for Leishmaniasis in Colombia was designed to investigate whether this patch is as effective as meglumine antimoniate for the treatment of cutaneous leishmaniasis but with less adverse events. Subjects with ulcers characteristic of cutaneous leishmaniasis will be medically evaluated and laboratory tests and parasitological confirmation performed. After checking the inclusion/exclusion criteria, the patients will be randomly assigned to one of two groups. During 20 days Group 1 will receive simultaneously meglumine antimoniate and placebo of nitric oxide patches while Group 2 will receive placebo of meglumine antimoniate and active nitric oxide patches. During the treatment visits, the medications will be daily administered and the presence of adverse events assessed. During the follow-up, the research group will visit the patients at days 21, 45, 90 and 180. The

  1. Antimony (Sb) sorption studies on zircaloy, carbon steel (CS) and magnetite coated CS (MCS) surfaces in aqueous medium at pH 10.2 and 280℃

    International Nuclear Information System (INIS)

    Antimony sorption studies on zircaloy, CS and magnetite coated carbon steel (MCS) at primary heat transport temperature (290℃) of pressurised heavy water reactor (PHWR) are of direct relevance in investigating Sb activity problem faced in Indian PHWRs. Sb impregnated PHT pump carbon bearing releases Sb to reactor core. This Sb activates, and redeposit on out-of-core surfaces and results in exposure and apparent high decontamination factors. This Sb is not amenable to normal decantation. The form and state of deposited Sb is not yet fully known. This works attempts for this

  2. Effect of the antimony thin-film deposition sequence on copper-silicon interdiffusion: Vpliv zaporedja nanosa tankih plasti antimona na interdifuzijo baker-silicij:

    OpenAIRE

    Chaouki, Benazzouz; Fouzia, Zekkar; Mahfoud, Benkerri; Mokhtar, Boudissa; Mounir, Reffas; Nasser, Menni

    2012-01-01

    In this work we present a study of the effect of an antimony layer on the interdiffusion and formation of copper silicides while inverting the sequence of Cu and Sb deposition on Si(111) substrates. Thermal evaporation was used to deposit Cu/Sb and Sb/Cu bilayers on a Si(111) substrate heated at 100 °C, without breaking the vacuum. XRD and RBS analysis showed, for samples heat treated at 200 °C and 400 °C, a segregation of the three elements (i.e., Cu, Sb and Si) to the surface and diffusion ...

  3. Early differentiated CD138(high MHCII+ IgG+ plasma cells express CXCR3 and localize into inflamed kidneys of lupus mice.

    Directory of Open Access Journals (Sweden)

    Stéphanie Lacotte

    Full Text Available Humoral responses are central to the development of chronic autoimmune diseases such as systemic lupus erythematosus. Indeed, autoantibody deposition is responsible for tissue damage, the kidneys being one of the main target organs. As the source of pathogenic antibodies, plasma cells are therefore critical players in this harmful scenario, both at systemic and local levels. The aim of the present study was to analyze plasma cells in NZB/W lupus mice and to get a better understanding of the mechanisms underlying their involvement in the renal inflammation process. Using various techniques (i.e. flow cytometry, quantitative PCR, ELISpot, we identified and extensively characterized three plasma cell intermediates, according to their B220/CD138/MHCII expression levels. Each of these cell subsets displays specific proliferation and antibody secretion capacities. Moreover, we evidenced that the inflammation-related CXCR3 chemokine receptor is uniquely expressed by CD138(highMHCII(+ plasma cells, which encompass both short- and long-lived cells and mostly produce IgG (autoantibodies. Expression of CXCR3 allows efficient chemotactic responsiveness of these cells to cognate chemokines, which production is up-regulated in the kidneys of diseased NZB/W mice. Finally, using fluorescence and electron microscopy, we demonstrated the presence of CD138(+CXCR3(+IgG(+ cells in inflammatory areas in the kidneys, where they are very likely involved in the injury process. Thus, early differentiated CD138(highMHCII(+ rather than terminally differentiated CD138(highMHCII(low plasma cells may be involved in the renal inflammatory injury in lupus, due to CXCR3 expression and IgG secretion.

  4. 婴幼儿巨细胞病毒感染138例临床及治疗观察%Clinical characteristics and therapy of cytomegalovirus infection in 138 infant cases

    Institute of Scientific and Technical Information of China (English)

    徐玉敏; 朱雪萍; 肖志辉; 丁晓春; 冯星

    2013-01-01

    目的:探讨婴幼儿巨细胞病毒( CMV)感染的临床特点及治疗。方法:对在我院确诊、住院治疗的138例CMV感染患儿的临床资料进行回顾性分析。结果:138例患儿(男80例,女58例)血清CMV-IgM阳性和(或)血、尿CMV-DNA-PCR阳性,入院年龄9 d~3岁。临床表现为肺炎99例,伴有肺功能改变18例;婴儿肝炎62例,其中肝硬化1例,肝豆状核变性1例,高胆红素血症30例(2例合并核黄疸,3例胆道闭锁,1例胆总管囊肿,3例肝糖原累积症);溶血性贫血10例,特发性血小板减少症6例;脑发育异常15例,其中脑积水1例、脑结节硬化2例、运动落后3例、智力低下3例、癫痫2例;脑干听觉诱发电位异常16例(双侧听力受损10例、青光眼1例);先天性心脏病8例,多发畸形3例,迁延性肠炎5例,营养不良7例,喉软骨发育不良3例,选择性IgA缺乏症1例,遗传代谢性疾病1例,同时合并多重感染11例,合并呼吸衰竭、休克2例。治疗后好转114例,放弃治疗19例,死亡5例。结论:婴幼儿CMV感染临床表现多样化,以肺炎最多见;其次是肝胆系统受累。中枢神经系统受损可导致脑发育异常、听神经受损、运动落后等,少数病例可伴发其他畸形甚至多发畸形。绝大部分CMV感染病例预后良好,少数病例预后差甚至死亡。%Objective:To investigate the clinical characteristics and therapy of cytomegalovirus ( CMV) infection in infants.Methods:Clinical characteristics and outcome were retrospectively analyzied of in 138 infants infected CMV diagnosed in our hospital.Results:One hundred thirty-eight cases(male 80, female 58) were diagnosed by the positive of serum CMV-IgM and or blood/urine CMV-DNA-PCR.The admission age was 9 d to 3-year-old. Ninety-nine patients were diagnosed as pneumonia , 18 showed lung function detects .Sixty-two cases were diagnosed as infant hepatitis , 1

  5. High-time-resolution Measurements of the Polarization of the Crab Pulsar at 1.38 GHz

    Science.gov (United States)

    Słowikowska, Agnieszka; Stappers, Benjamin W.; Harding, Alice K.; O'Dell, Stephen L.; Elsner, Ronald F.; van der Horst, Alexander J.; Weisskopf, Martin C.

    2015-01-01

    Using the Westerbork Synthesis Radio Telescope, we obtained high-time-resolution measurements of the full polarization of the Crab pulsar. At a resolution of 1/8192 of the 34 ms pulse period (i.e., 4.1 μs), the 1.38 GHz linear-polarization measurements are in general agreement with previous lower-time-resolution 1.4 GHz measurements of linear polarization in the main pulse (MP), in the interpulse (IP), and in the low-frequency component (LFC). We find the MP and IP to be linearly polarized at about 24% and 21% with no discernible difference in polarization position angle. However, contrary to theoretical expectations and measurements in the visible, we find no evidence for significant variation (sweep) in the polarization position angle over the MP, the IP, or the LFC. We discuss the implications, which appear to be in contradiction to theoretical expectations. We also detect weak circular polarization in the MP and IP, and strong (≈20%) circular polarization in the LFC, which also exhibits very strong (≈98%) linear polarization at a position angle of 40° from that of the MP or IP. The properties are consistent with the LFC, which is a low-altitude component, and the MP and IP, which are high-altitude caustic components. Current models for the MP and IP emission do not readily account for the absence of pronounced polarization changes across the pulse. We measure IP and LFC pulse phases relative to the MP consistent with recent measurements, which have shown that the phases of these pulse components are evolving with time.

  6. HIGH-TIME-RESOLUTION MEASUREMENTS OF THE POLARIZATION OF THE CRAB PULSAR AT 1.38 GHz

    Energy Technology Data Exchange (ETDEWEB)

    Słowikowska, Agnieszka [Kepler Institute of Astronomy, University of Zielona Góra, Lubuska 2, 65-265 Zielona Góra (Poland); Stappers, Benjamin W. [Jodrell Bank Centre for Astrophysics, University of Manchester, Manchester M13 9PL (United Kingdom); Harding, Alice K. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); O' Dell, Stephen L.; Elsner, Ronald F.; Weisskopf, Martin C. [Astrophysics Office, NASA Marshall Space Flight Center, ZP12, Huntsville, AL 35812 (United States); Van der Horst, Alexander J. [Astronomical Institute, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands)

    2015-01-20

    Using the Westerbork Synthesis Radio Telescope, we obtained high-time-resolution measurements of the full polarization of the Crab pulsar. At a resolution of 1/8192 of the 34 ms pulse period (i.e., 4.1 μs), the 1.38 GHz linear-polarization measurements are in general agreement with previous lower-time-resolution 1.4 GHz measurements of linear polarization in the main pulse (MP), in the interpulse (IP), and in the low-frequency component (LFC). We find the MP and IP to be linearly polarized at about 24% and 21% with no discernible difference in polarization position angle. However, contrary to theoretical expectations and measurements in the visible, we find no evidence for significant variation (sweep) in the polarization position angle over the MP, the IP, or the LFC. We discuss the implications, which appear to be in contradiction to theoretical expectations. We also detect weak circular polarization in the MP and IP, and strong (≈20%) circular polarization in the LFC, which also exhibits very strong (≈98%) linear polarization at a position angle of 40° from that of the MP or IP. The properties are consistent with the LFC, which is a low-altitude component, and the MP and IP, which are high-altitude caustic components. Current models for the MP and IP emission do not readily account for the absence of pronounced polarization changes across the pulse. We measure IP and LFC pulse phases relative to the MP consistent with recent measurements, which have shown that the phases of these pulse components are evolving with time.

  7. Single-dose radiosurgical treatment for hepatic metastases - therapeutic outcome of 138 treated lesions from a single institution

    International Nuclear Information System (INIS)

    Local ablative therapies such as stereotactically guided single-dose radiotherapy or helical intensity-modulated radiotherapy (tomotherapy) with high single-doses are successfully applied in many centers in patients with liver metastasis not suitable for surgical resection. This study presents results from more than 10 years of clinical experience and evaluates long-term outcome and efficacy of this therapeutic approach. From 1997 to 2009 a total of 138 intrahepatic tumors of 90 patients were irradiated with single doses of 17 to 30 Gy (median dose 24 Gy). Median age of the patients was 64 years (range 31–89 years). Most frequent underlying tumor histologies were colorectal adenocarcinoma (70 lesions) and breast cancer (27 lesions). In 35 treatment sessions multiple targets were simultaneously irradiated (up to four lesions at once). Local progression-free (PFS) and overall survival (OS) after treatment were investigated using uni- and multiple survival regression models. Median overall survival of all patients was 24.3 months. Local PFS was 87%, 70% and 59% after 6, 12 and 18 months, respectively. Median time to local progression was 25.5 months. Patients with a single lesion and no further metastases at time of RT had a favorable median PFS of 43.1 months according to the Kaplan-Meier estimator. The type of tumor showed a statistical significant influence on local PFS, with a better prognosis for breast cancer histology than for colorectal carcinoma in uni- and multiple regression analysis (p = 0.05). Multiple regression analysis revealed no influence of planning target volume (PTV), patient age and radiation dose on local PFS. Treatment was well tolerated with no severe adverse events. This study confirms safety of SBRT in liver lesions, with 6- and 12 months local control of 87% and 70%. The dataset represents the clinical situation in a large oncology setting, with many competing treatment options and heterogeneous patient characteristics

  8. Surface morphologies and properties of pure and antimony-doped tin oxide films derived by sol-gel dip-coating processing

    International Nuclear Information System (INIS)

    A simple laboratory technique for the routine preparation of antimony-doped tin oxide (ATO) on float glass substrates (25 mm x 76 mm x 1 mm) was described. As-prepared thin films were dried at temperature of 100 ± 5 deg. C and annealed at temperatures of 400-550 deg. C. Microstructural and morphological analyses of as-prepared films were performed at different conditions. The evolution of grain size and the morphologies of ATO films were analyzed by means of atom force microscopy (AFM) and digital microscope. The studies suggested that higher Sb-doped level and higher annealing temperature led to a decrease in the surface roughness of the deposited films. The XRD patterns revealed that as-prepared ATO films were in the crystallization of a tetragonal rutile structure of SnO2 with highly (1 1 0) preferred orientation. Their optical properties were analyzed by U-3310 spectrophotometer. The transmission of the ATO thin films was obtained as high as 80-90% in visible region, but decreased substantially in IR region. The sheet resistance of the investigated thin films was determined by four-probe method, showing that it was about 85-100 Ω □-1which decreased with the increase of antimony-doped concentration

  9. Ultra-low carrier concentration and surface-dominant transport in antimony-doped Bi2Se3 topological insulator nanoribbons

    KAUST Repository

    Hong, Seung Sae

    2012-03-27

    A topological insulator is the state of quantum matter possessing gapless spin-locking surface states across the bulk band gap, which has created new opportunities from novel electronics to energy conversion. However, the large concentration of bulk residual carriers has been a major challenge for revealing the property of the topological surface state by electron transport measurements. Here we report the surface-state-dominant transport in antimony-doped, zinc oxide-encapsulated Bi2Se3 nanoribbons with suppressed bulk electron concentration. In the nanoribbon with sub-10-nm thickness protected by a zinc oxide layer, we position the Fermi levels of the top and bottom surfaces near the Dirac point by electrostatic gating, achieving extremely low two-dimensional carrier concentration of 2×10 11cm-2. The zinc oxide-capped, antimony-doped Bi 2Se3 nanostructures provide an attractive materials platform to study fundamental physics in topological insulators, as well as future applications. © 2012 Macmillan Publishers Limited. All rights reserved.

  10. Stability studies of arsenic, selenium, antimony and tellurium species in water, urine, fish and soil extracts using HPLC/ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Lindemann, T.; Prange, A.; Neidhart, B. [GKSS Research Centre, Geesthacht (Germany). Inst. of Physical and Chemical Analysis; Dannecker, W. [Hamburg Univ. (Germany). Inst. fuer Anorganische und Angewandte Chemie

    2000-10-01

    The stability of arsenic, selenium, antimony and tellurium species in water and urine (NIST SRM 2670n) as well as in extracts of fish and soil certified reference materials (DORM-2 and NIST SRM 2710) has been investigated. Stability studies were carried out with As(III), As(V), arsenobetaine, monomethylarsonic acid (MMA), dimethylarsinic acid (DMA), phenylarsonic acid (PAA), Se(IV), Se(VI), selenomethionine, Sb(III), Sb(V) and Te(VI). Speciation analysis was performed by on-line coupling of anion exchange high-performance liquid chromatography (HPLC) with inductively coupled plasma mass spectrometry (ICP-MS). Best storage of aqueous mixtures of the examined species was achieved at 3 C whereas at -20 C species transformation especially of selenomethionine and Sb(V) took place and a new selenium species appeared within a period of 30 days. Losses and species transformations during extraction processes were investigated. Extraction of the spiked fish material with methanol/water led to partial conversion of Sb(III), Sb(V) and selenomethionine to two new antimony and one new selenium species. The other arsenic, selenium and tellurium species were almost quantitatively extracted. For soil spiked with MMA, PAA, Se(IV) and Sb(III), recoveries after extraction with water and sulfuric acid (0.01 mol/L) were below 20%. (orig.)

  11. Antimony(v) cations for the selective catalytic transformation of aldehydes into symmetric ethers, α,β-unsaturated aldehydes, and 1,3,5-trioxanes.

    Science.gov (United States)

    Arias Ugarte, Renzo; Devarajan, Deepa; Mushinski, Ryan M; Hudnall, Todd W

    2016-07-01

    1-Diphenylphosphinonaphthyl-8-triphenylstibonium triflate ([][OTf]) was prepared in excellent yield by treating 1-lithio-8-diphenylphosphinonaphthalene with dibromotriphenylstiborane followed by halide abstraction with AgOTf. This antimony(v) cation was found to be stable toward oxygen and water, and exhibited exceptional Lewis acidity. The Lewis acidity of [][OTf] was exploited in the catalytic reductive coupling of a variety of aldehydes into symmetric ethers of type in good to excellent yields under mild conditions using Et3SiH as the reductant. Additionally, [][OTf] was found to selectively catalyze the Aldol condensation reaction to afford α-β unsaturated aldehydes () when aldehydes with 2 α-hydrogen atoms were used. Finally, [][OTf] catalyzed the cyclotrimerization of aliphatic and aromatic aldehydes to afford the industrially-useful 1,3,5 trioxanes () in good yields, and with great selectivity. This phosphine-stibonium motif represents one of the first catalytic systems of its kind that is able to catalyze these reactions with aldehydes in a controlled, efficient manner. The mechanism of these processes has been explored both experimentally and theoretically. In all cases the Lewis acidic nature of the antimony(v) cation was found to promote these reactions. PMID:27326797

  12. Annealing effects on structural, electrical and optical properties of antimony-tinoxide thin films deposited by sol gel dip coating technique

    Energy Technology Data Exchange (ETDEWEB)

    Lekshmy, S. Sujatha, E-mail: jolly2jolly@gmail.com; Anitha, V. S., E-mail: jolly2jolly@gmail.com; Berlin, I. John, E-mail: jolly2jolly@gmail.com; Joy, K., E-mail: jolly2jolly@gmail.com [Thin film Laboratory, Post Graduate and Research Department of Physics, Mar Ivanios College, Thiruvananthapuram 695 015 (India)

    2014-01-28

    Antimony-doped tin dioxide possess interesting physical and chemical properties. These properties have a wide range of applications such as catalysis and optoelectronic devices. In the present study, antimony-doped tin oxide (SnO2:Sb) thin films were deposited on the quartz substrates by sol-gel dip coating technique. The films were annealed at temperatures 350°C, 550°C and 850°C in air for 2 hours. The structure and surface morphologies were observed by X-ray diffraction (XRD) and Scanning electron microscopy (SEM). XRD patterns shows tetragonal structure for the SnO2:Sb films annealed at different temperatures. Crystallite size increased from 6 to 14 nm as annealing temperature increased from 350°C to 850°C. SEM studies reveals crack free and smooth surface for all the films. The grains are found to be homogenously distributed for films annealed at higher temperature. The electrical conductivity of the films annealed at 350°C and 550°C decreased and increased for the films annealed at 850°C. The optical properties of the films were investigated in the UV-visible-NIR region (200-900 nm) using UV spectra. The transmittance of the films decreased for films annealed at higher temperature. The optical energy band gap values (4.13 eV-4.83 eV) increased with the increase in annealing temperature.

  13. Surface morphologies and properties of pure and antimony-doped tin oxide films derived by sol-gel dip-coating processing

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Daoli [Department of Electronic Science and Technology, Huazhong University of Science and Technology, 1037 Luoyu Road Hongshan District, Wuhan City Hubei Province 430074 (China)]. E-mail: zhang_daoli@mail.hust.edu.cn; Tao Liang [Department of Electronic Science and Technology, Huazhong University of Science and Technology, 1037 Luoyu Road Hongshan District, Wuhan City Hubei Province 430074 (China); Deng Zhibing [Department of Electronic Science and Technology, Huazhong University of Science and Technology, 1037 Luoyu Road Hongshan District, Wuhan City Hubei Province 430074 (China); Zhang Jianbing [Department of Electronic Science and Technology, Huazhong University of Science and Technology, 1037 Luoyu Road Hongshan District, Wuhan City Hubei Province 430074 (China); Chen Liangyan [Department of Electronic Science and Technology, Huazhong University of Science and Technology, 1037 Luoyu Road Hongshan District, Wuhan City Hubei Province 430074 (China)

    2006-12-10

    A simple laboratory technique for the routine preparation of antimony-doped tin oxide (ATO) on float glass substrates (25 mm x 76 mm x 1 mm) was described. As-prepared thin films were dried at temperature of 100 {+-} 5 deg. C and annealed at temperatures of 400-550 deg. C. Microstructural and morphological analyses of as-prepared films were performed at different conditions. The evolution of grain size and the morphologies of ATO films were analyzed by means of atom force microscopy (AFM) and digital microscope. The studies suggested that higher Sb-doped level and higher annealing temperature led to a decrease in the surface roughness of the deposited films. The XRD patterns revealed that as-prepared ATO films were in the crystallization of a tetragonal rutile structure of SnO{sub 2} with highly (1 1 0) preferred orientation. Their optical properties were analyzed by U-3310 spectrophotometer. The transmission of the ATO thin films was obtained as high as 80-90% in visible region, but decreased substantially in IR region. The sheet resistance of the investigated thin films was determined by four-probe method, showing that it was about 85-100 {omega} {open_square}{sup -1}which decreased with the increase of antimony-doped concentration.

  14. Oral bioavailability of arsenic, antimony and a selection of metals in ashes; Oral biotillgaenglighet av arsenik, antimon och ett urval av metaller i askor

    Energy Technology Data Exchange (ETDEWEB)

    Carlsson, Christel; Bendz, David; Jones, Celia

    2008-06-15

    In an earlier study, financed by Varmeforsk, 'Q4-238 Environmental guidelines for reuse of ash in civil engineering applications', the total content of arsenic and lead was shown to determine whether or not reuse of some of the ashes in construction work is feasible. The model used to calculate the guidelines uses the total concentration of metals to evaluate the health risks resulting from exposure to the ashes. The use of total concentration can lead to overly conservative risk assessments if a significant fraction of the total metal content is not bioavailable. Better precision in the risk assessment can be given by the use of the bioavailable fraction of arsenic and lead in the model. As a result, ashes which are rejected on the basis of total metal concentration may be acceptable for use in engineering construction when the assessment is based on the bioavailable fraction. The purpose of the study was to (i) compile information on the oral bioavailability of arsenic, antimony and a selection of metals in ashes and similar materials, and on in vitro methods for determination of oral bioavailability, and (ii) experimentally estimate oral bioavailability of arsenic, antimony and some metals in a selection of ashes by analysis of the gastrointestinal bioaccessibility of these elements. The investigated elements were antimony, arsenic, lead, cadmium, copper, chromium, nickel and zinc. In the literature study performed within the project a number of static and dynamic in vitro methods simulating gastrointestinal processes of contaminants were compiled. The methods include one or several segments, i.e. mouth, stomach and intestine. Among the compiled methods, the RIVM (Rijksinstituut voor volksgesundheid en milieu) in vitro method was used in the experimental part of the project. The advantages with the method was that: the method to a high degree mimicked the human gastrointestinal processes (the method included three segments mouth, stomach, and intestine

  15. Direct determination of arsenic and antimony in naphtha by electrothermal atomic absorption spectrometry with microemulsion sample introduction and iridium permanent modifier

    Energy Technology Data Exchange (ETDEWEB)

    Cassella, Ricardo J. [Departamento de Quimica Analitica, Universidade Federal Fluminense, Outeiro de Sao Joao Batista s/n, Centro, 24020-007, Niteroi/RJ (Brazil); Barbosa, Bruno Alberto R.S.; Santelli, Ricardo E. [Departamento de Geoquimica, Universidade Federal Fluminense, Outeiro de Sao Joao Batista s/n, Centro, 24020-007, Niteroi/RJ (Brazil); Rangel, Alessandra T. [PETROBRAS, CENPES, PDEDS/QM, Rio de Janeiro (Brazil)

    2004-05-01

    This paper reports the determination of arsenic and antimony in naphtha by employing electrothermal atomic absorption spectrometry (ETAAS) as the analytical technique. In order to promote the direct determination of the analytes in the very volatile naphtha, the formation of a microemulsion with different surfactants (Triton X-100 and Brij-35) and different chemical modification strategies were tested. The results indicated that Triton X-100 is the best emulsification agent for naphtha in both As and Sb determination when it is employed at a concentration of 1% w/v in the microemulsion. Under these conditions, the microemulsion was stabile for at least 2 h. By using Brij-35 it was possible to achieve good stability only in the first 15 min. Among all chemical modification approaches investigated (Ir permanent modifier, W-Ir permanent modifier, and Pd modifier), the Ir permanent modifier provided better sensitivity for both analytes and allowed a higher pyrolysis temperature, which decreased the background signals at lower levels. Under the best conditions established in this work, an RSD of 4.6% (20 {mu}g L{sup -1}) and a detection limit of 2.7 {mu}g L{sup -1} were observed for arsenic. For antimony, an RSD of 4.0% (20 {mu}g L{sup -1}) and a detection limit of 2.5 {mu}g L{sup -1} were obtained. The accuracy of the procedure was assessed by analyzing spiked samples of naphtha from different origins. (orig.)

  16. 广州地区人巨细胞病毒临床低传代株UL138基因的序列特征及多态性分析%Analysis of nucleotide sequences and genetic polymorphisms of UL138 gene of low passage human cy-tomegalovirus strains in Guangzhou

    Institute of Scientific and Technical Information of China (English)

    蔡丽君; 胡兢晶; 王波; 苏海浩; 伍苑宾; 密英鸽; 郭梦杰

    2015-01-01

    目的:研究广州地区新生儿感染人巨细胞病毒( HCMV)临床低传代分离株UL138基因序列特征与多态性。方法从10例被证实为临床HCMV感染的新生儿尿液标本中分离HCMV低传代临床病毒株,进行多重PCR鉴定。对临床分离株进行HCMV UL138基因扩增、克隆、鉴定、测序及呈报GenBank;同时在GenBank搜索HCMV UL138同源序列,行序列分析,应用生物信息学在线软件分析UL138基因翻译后修饰位点、二级结构及等电点。结果成功分离3株HCMV临床病毒株,分别命名为 HCMV D3、D2和 D52。克隆测序后呈报 GenBank 并被收录。收录序列号分别为:DQ180375、DQ180387和DQ180359。分析结果显示在HCMV临床低传代D3、D2和D52病毒株UL138基因全序列841个碱基中,存在16个位点变异,可能编码的蛋白质氨基酸残基总数为169个,其基因序列高度保守,核苷酸变异均为碱基替换,无插入或缺失,碱基替换导致了7处氨基酸的改变。HCMV UL138蛋白翻译后修饰位点在除Toledo株外的所有分离株中均高度保守;所有分离株UL138蛋白的预测等电点均为6.51。结论广州地区感染婴儿的HCMV UL138基因及其编码的氨基酸序列极为保守,但仍具有一定的多态性,这在HCMV临床感染与致病机制研究中具有重要意义。%Objective To analyze the nucleotide sequences and genetic polymorphisms of UL138 gene of low passage human cytomegalovirus ( HCMV) strains isolated from infants in Guangzhou province. Methods The low passage strains of HCMV were isolated from urine samples of 10 infants with HCMV in-fection in Guangzhou province and identified by multiplex PCR.The UL138 genes were amplified, cloned and identified with sequencing.The sequences were analyzed together with the homologous sequences of 10 clinical isolates published in GenBank.The sequences of UL138 genes were analyzed by using bioinformatics softwares for investigation of

  17. Differential long-term effects of developmental exposure to polychlorinated biphenyls 52, 138 or 180 on motor activity and neurotransmission. Gender dependence and mechanisms involved.

    Science.gov (United States)

    Boix, Jordi; Cauli, Omar; Leslie, Heather; Felipo, Vicente

    2011-01-01

    Developmental exposure to polychlorinated biphenyls (PCBs) induces motor alterations in humans by unknown mechanisms. It remains unclear whether: (a) all non-dioxin-like (NDL) PCBs are neurotoxic or it depends on the grade of chlorination; (b) they have different neurotoxicity mechanisms; (c) they affect differently males and females. The aims of this work were to assess: (1) whether perinatal exposure to 3 NDL-PCBs with different grades of chlorination, (PCBs 52, 138 or 180) affects differentially motor activity in adult rats; (2) whether the effects are different in males or females and (3) the mechanisms involved in impaired motor activity. Rats were exposed to PCBs from gestational day 7 to post-natal day 21. Experiments were performed when the rats were 4 months-old. PCB52 did not affect motor activity, PCB180 reduced it in males but not in females and PCB138 reduced activity both in males and females. PCB52 or 138 did not affect extracellular dopamine in nucleus accumbens (NAcc). PCB180 increased it both in males and females. Extracellular glutamate in NAcc was reduced by the three PCBs. Activation of metabotropic glutamate receptors (mGluRs) in NAcc increased extracellular dopamine in control rats and in those exposed to PCB52 and reduced dopamine in rats exposed to PCB180. In rats exposed to PCB138 activation of mGluRs increases dopamine in females and reduces it in males. The opposite changes were observed for glutamate. mGluRs activation reduced extracellular glutamate in control rats and in those exposed to PCB52 and increased glutamate in rats exposed to PCB180. In rats exposed to PCB138 activation of mGluRs reduces glutamate in females and increases it in males. The data support that different NDL-PCBs affect differently motor activity. Increased glutamate release in NAcc following activation of mGluRs would be involved in reduced dopamine release and reduced motor activity in rats exposed to PCB138 or 180. PMID:21056608

  18. Polychlorinated biphenyls PCB 52, PCB 180, and PCB 138 impair the glutamate-nitric oxide-cGMP pathway in cerebellar neurons in culture by different mechanisms.

    Science.gov (United States)

    Llansola, Marta; Montoliu, Carmina; Boix, Jordi; Felipo, Vicente

    2010-04-19

    Polychlorinated biphenyls (PCBs) are persistent organic pollutants that accumulate in the food chain and are present in human blood and milk. Children born to mothers exposed to PCBs show cognitive deficits, which are reproduced in rats perinatally exposed to PCBs. It has been proposed that PCB-induced cognitive impairment is due to impairment of the glutamate-nitric oxide (NO)-cGMP pathway. The aim of the present work was to assess whether chronic exposure to the nondioxin-like PCB52, PCB138, or PCB180 alters the function of this pathway in primary cultures of rat cerebellar neurons and to assess whether different PCBs have similar or different mechanisms of action. PCB180 and PCB138 impair the function of the glutamate-NO-cGMP pathway at nanomolar concentrations, and PCB52 impairs the function of the glutamate-NO-cGMP pathway at micromolar concentrations. The mechanisms by which different PCBs impair the function of the glutamate-NO-cGMP pathway are different. Each PCB affects the pathway at more than one step but with different potency and, for some steps, in opposite ways. Exposure to the PCBs alters the basal concentrations of intracellular calcium, NO, and cGMP. The three PCBs increase NO; however, PCB52 and PCB138 increase basal cGMP, while PCB180 decreases it. PCB52 and PCB138 decrease the activation of soluble guanylate cyclase by NO, and PCB180 increases it. Long-term exposure to PCB52, PCB180, or PCB138 reduces the activation of NO synthase and the whole glutamate-NO-cGMP pathway in response to activation of N-methyl-d-aspartate receptors. The EC(50) was 300 nM for PCB52 and 2 nM for PCB138 or PCB180. These results show that chronic exposure to nondioxin like PCBs impairs the function of the glutamate-NO-cGMP pathway in cerebellar neurons by different mechanisms and with different potencies. Impaired function of this pathway would contribute to the cognitive alterations induced by perinatal exposure to PCBs in humans. PMID:20297801

  19. Single-dose anti-CD138 radioimmunotherapy: bismuth-213 is more efficient than lutetium-177 for treatment of multiple myeloma in a preclinical model

    Directory of Open Access Journals (Sweden)

    Nolwenn eFichou

    2015-11-01

    Full Text Available Objectives: Radioimmunotherapy (RIT has emerged as a potential treatment option for multiple myeloma (MM. In humans, a dosimetry study recently showed the relevance of RIT using an antibody targeting the CD138 antigen. The therapeutic efficacy of RIT using an anti-CD138 antibody coupled to 213Bi, an α-emitter, was also demonstrated in a preclinical MM model. Since then, RIT with β-emitters has shown efficacy in treating hematologic cancer. In this paper, we investigate the therapeutic efficacy of RIT in the 5T33 murine MM model using a new anti-CD138 monoclonal antibody labeled either with 213Bi for α-RIT or 177Lu for β-RIT.Methods: A new monoclonal anti-CD138 antibody, 9E7.4, was generated by immunizing a rat with a murine CD138-derived peptide. Antibody specificity was validated by flow cytometry, biodistribution and α-RIT studies. Then, a β-RIT dose-escalation assay with the 177Lu-radiolabeled 9E7.4 mAb was performed in KalwRij C57/BL6 mice 10 days after i.v. engraftment with 5T33 MM cells. Animal survival and toxicological parameters were assessed to define the optimal activity.Results: α-RIT performed with 3.7 MBq of 213Bi-labeled 9E7.4 anti-CD138 mAb increased median survival to 80 days compared to 37 days for the untreated control and effected cure in 45% of animals. β-RIT performed with 18.5 MBq of 177Lu-labeled 9E7.4 mAb was well tolerated and significantly increased mouse survival (54 versus 37 days in the control group; however, no mice were cured with this treatment.Conclusion: This study revealed the advantages of α-RIT in the treatment of MM in a preclinical model where β-RIT shows almost no efficacy.

  20. Investigation on spread and risk factors of tuberculosis in antimony miners%锑矿工结核病传播及危险因素调查

    Institute of Scientific and Technical Information of China (English)

    陈开森; 刘涛; 林瑞瑞; 罗涛; 杨崇广

    2015-01-01

    Objective To explore the infection rate of tuberculosis ( TB) and its risk factors in antimony miners .Methods With cluster sampling method , the strains identification and drug sensitive test were performed in Mycobacterium tuberculosis ( MTB) of 263 TB patients in antimony miners .The method of 12 sites mycobacterial interspersed repetitive unit and variable number of tandem repeat wre used to determine the genetic type of MTB .Risk factors of TB spread were assessed by chi-square test.Results The TB infection rate in antimony miners was 9.8%(472/4 831);among 263 TB cases, 175 cases were found clustered the clustering rate was 66.5%, the least estimated recent TB spread rate was 53.2%.High TB spread rate was found in the antimony miners with failed treatment , length of service longer than 10 years , multidrug-resistant bacterial strains , and positive sputum smear .Conclusion The MTB of antimony miners showed the clustering feature and the bacterial strains had strong toxicity and higher spreading rate .The major risk factors affecting TB spread were therapeutic effect , length of service , drug resistant bacterial strain and sputum smear result .%目的 了解锑矿工肺结核感染率及感染的危险因素. 方法 采用整群抽样方法,对263例锑矿工肺结核患者进行结核分枝杆菌的菌株鉴定和药敏试验. 基因分型采用12位点结核分枝杆菌散在分布重复单元和多位点串联重复序列;采用X2检验评估结核传播的危险因素. 结果 锑矿工肺结核的感染率为9.8%(472/4 831); 纳入研究的263例患者中,175例成簇,成簇率为66 .5%,近期传播率最低估计值为53 .2%. 治疗失败、工龄大于10年、菌株多重耐药及痰涂片阳性的锑矿工肺结核传播率较高. 结论 锑矿工结核分枝杆菌具有成簇性,其菌株毒力更强、传播率高,治疗效果、矿龄、菌株耐药性及痰涂片结果是影响肺结核传播的重要危险因素.

  1. An evaluation of the migration of antimony from polyethylene terephthalate (PET) plastic used for bottled drinking water.

    Science.gov (United States)

    Chapa-Martínez, C A; Hinojosa-Reyes, L; Hernández-Ramírez, A; Ruiz-Ruiz, E; Maya-Treviño, L; Guzmán-Mar, J L

    2016-09-15

    The leaching of antimony (Sb) from polyethylene terephthalate (PET) bottling material was assessed in twelve brands of bottled water purchased in Mexican supermarkets by atomic fluorescence spectrometry with a hydride generation system (HG-AFS). Dowex® 1X8-100 ion-exchange resin was used to preconcentrate trace amounts of Sb in water samples. Migration experiments from the PET bottle material were performed in water according to the following storage conditions: 1) temperature (25 and 75°C), 2) pH (3 and 7) and 3) exposure time (5 and 15days), using ultrapure water as a simulant for liquid foods. The test conditions were studied by a 2(3) factorial experimental design. The Sb concentration measured in the PET packaging materials varied between 73.0 and 111.3mg/kg. The Sb concentration (0.28-2.30μg/L) in all of the PET bottled drinking water samples examined at the initial stage of the study was below the maximum contaminant level of 5μg/L prescribed by European Union (EU) regulations. The parameters studied (pH, temperature, and storage time) significantly affected the release of Sb, with temperature having the highest positive significant effect within the studied experimental domain. The highest Sb concentration leached from PET containers was in water samples at pH7 stored at 75°C for a period of 5days. The extent of Sb leaching from the PET ingredients for different brands of drinking water can differ by as much as one order of magnitude in experiments conducted under the worst-case conditions. The chronic daily intake (CDI) caused by the release of Sb in one brand exceeded the Environmental Protection Agency (USEPA) regulated CDI value of 400ng/kg/day, with values of 514.3 and 566.2ng/kg/day for adults and children. Thus, the appropriate selection of the polymer used for the production of PET bottles seems to ensure low Sb levels in water samples. PMID:27192700

  2. Spatial distribution of antimony and arsenic levels in Manadas Creek, an urban tributary of the Rio Grande in Laredo, Texas.

    Science.gov (United States)

    Baeza, Marcia; Ren, Jianhong; Krishnamurthy, Sushma; Vaughan, Thomas C

    2010-02-01

    The Rio Grande and its tributaries represent a critical water source for both the human population and the ecological resources of the Rio Grande drainage basin. Manadas Creek, an urban tributary of the Rio Grande, is located in an industrialized area of Laredo, Texas, where warehouses, a major railroad, and a decommissioned antimony (Sb) smelter are located. Previous studies have found that the creek water is contaminated with heavy metals such as Sb and arsenic (As). However, data on the metal distribution in this creek are very limited. Herein, water and sediment core samples were collected from six sites along the creek in February, April, and May 2008. Samples were analyzed for dissolved and total metals in water, total metals in sediments, and available (soluble-exchangeable, surface adsorbed, and organically bound) fractions of metals associated with the sediments. Results show that concentrations of Sb in the water and sediment samples were significantly lower at the upstream control site compared to the two sites located near the decommissioned smelter. Decreasing levels of Sb were found at the sites located downstream. The As levels in the sediment remained constant at different depths, whereas Sb varied significantly. A high level, 420 mg/kg, of sediment Sb was found at the maximum sediment depth of 35.0 cm sampled. In addition, 65.7-76.9% Sb and 80.3-85.6% As were in their residual form, 15.0-22.5% Sb and 6.2-11.4% As were bound to organic matter, and the remaining As and Sb were in the soluble and surface adsorbed fractions. Pearson correlation analyses indicated that the distribution of Sb was only moderately correlated to iron and nickel in the sediment and its correlation with the sediment properties measured was insignificant. Cluster analyses only grouped the two Sb isotopes together for the sediments collected in May, indicating that sources other than natural occurrence were associated with Sb. The high level of sediment Sb observed indicates

  3. Arsenic and Antimony Removal from Drinking Water by Point-of-Entry Reverse Osmosis Coupled with Dual Plumbing Distribution - U.S. EPA Demonstration Project at Carmel Elementary School in Carmel, ME -Final Performance Evaluation Report

    Science.gov (United States)

    This report documents the activities performed for and the results obtained from the arsenic and antimony removal treatment technology demonstration project at the Carmel Elementary School (CES) in Carmel, ME. An innovative approach of employing point of entry (POE) reverse osmo...

  4. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss; Estudio de las interacciones de protones de 13,8 geV/c con los nucleos pesados de emusiones

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Aleixandre, J. L.

    1967-07-01

    145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.

  5. Lipopolysaccharide-induced activation of NF-{kappa}B non-canonical pathway requires BCL10 serine 138 and NIK phosphorylations

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharyya, Sumit; Borthakur, Alip; Dudeja, Pradeep K. [Department of Medicine, University of Illinois at Chicago and Jesse Brown VA Medical Center, Chicago, IL 60612-7227 (United States); Tobacman, Joanne K., E-mail: jkt@uic.edu [Department of Medicine, University of Illinois at Chicago and Jesse Brown VA Medical Center, Chicago, IL 60612-7227 (United States)

    2010-11-15

    Background and aims: B-cell lymphoma/leukemia (BCL)-10 and reactive oxygen species mediate two pathways of NF-{kappa}B (RelA) activation by lipopolysaccharide (LPS) in human colonic epithelial cells. The pathway for LPS activation of RelB by the non-canonical pathway (RelB) in non-myeloid cells was not yet reported, but important for understanding the range of potential microbial LPS-induced effects in inflammatory bowel disease. Methods: Experiments were performed in human colonic epithelial cells and in mouse embryonic fibroblasts deficient in components of the IkappaB kinase (IKK) signalosome, in order to detect mediators of the non-canonical pathway of NF-{kappa}B activation, including nuclear RelB and p52 and phospho- and total NF-{kappa}B inducing kinase (NIK). BCL10 was silenced by siRNA and effects of mutations of specific phosphorylation sites of BCL10 (Ser138Gly and Ser218Gly) were determined. Results: By the non-canonical pathway, LPS exposure increased nuclear RelB and p52, and phospho-NIK, with no change in total NIK. Phosphorylation of BCL10 serine 138 was required for NIK phosphorylation, since mutation of this residue eliminated the increases in phospho-NIK and nuclear RelB and p52. Mutations of either serine 138 or serine 218 reduced RelA, p50, and phospho-I{kappa}B{alpha} of the canonical pathway. Effects of LPS stimulation and BCL10 silencing on NIK phosphorylation were demonstrated in confocal images. Conclusions: LPS induces activation of both canonical and non-canonical pathways of NF-{kappa}B in human colonic epithelial cells, and the non-canonical pathway requires phosphorylations of BCL10 (serine 138) and NIK. These findings demonstrate the important role of BCL10 in mediating LPS-induced inflammation in human colonic epithelial cells and may open new avenues for therapeutic interventions.

  6. Perinatal Exposure to Purity-Controlled Polychlorinated Biphenyl 52, 138, or 180 Alters Toxicogenomic Profiles in Peripheral Blood of Rats after 4 Months

    OpenAIRE

    De Boever, Patrick; Wens, Britt; Boix, Jordi; Felipo, Vicente; Schoeters, Greet

    2013-01-01

    It is known from controlled animal experiments and human epidemiologic studies that early life exposure to mixtures of polychlorinated biphenyls (PCBs) is a risk factor for developmental neurotoxicity. The importance of non-dioxin-like PCBs in the context of the observed effect is uncertain because of the blending with the more potent dioxin-like PCBs. Previously, a controlled rat perinatal exposure study with individual, purity-controlled, non-dioxin-like congeners (PCB52, PCB138, or PCB180)...

  7. Down-regulation of human cytomegalovirus UL138, a novel latency-associated determinant, by hcmv-miR-UL36

    Indian Academy of Sciences (India)

    Yujing Huang; Ying Qi; Yanping Ma; Rong He; Yaohua Ji; Zhengrong Sun; Qiang Ruan

    2013-09-01

    MicroRNAs (miRNAs) are small RNAs, 19–23 nucleotides in length, which regulate a variety of cellular processes. Human cytomegalovirus (HCMV) encodes only one intronic miRNA: human cytomegalovirus microRNA UL36 (hcmv-miR-UL36). In this study, we found that over-expression of hcmv-miR-UL36 resulted in a more than threefold increase in HCMV DNA synthesis at 24 h post infection. Fifteen putative targets of hcmv-miR-UL36 were identified using hybrid PCR, one being the HCMV UL138 gene that has previously been identified as a novel latency-associated determinant of HCMV infection. Down-regulation of UL138 expression by hcmv-miR-UL36 was validated using luciferase reporter assays and Western blot analysis in HEK293 cells. In the presence of hcmv-miR-UL36, we observed a 74.6% decrease in luciferase activity and a 46.2% decrease in HCMV UL138 protein expression. Our results indicate that hcmv-miR-UL36 may be a viral miRNA contributing to HCMV replication.

  8. From Dense Hot Jupiter to Low Density Neptune: The Discovery of WASP-127b, WASP-136b and WASP-138b

    CERN Document Server

    Lam, K W F; Brown, D J A; Anderson, D R; Delrez, L; Gillon, M; Hébrard, G; Lendl, M; Mancini, L; Southworth, J; Smalley, B; Triaud, A H M; Turner, O D; Hay, K L; Armstrong, D J; Barros, S C C; Bonomo, A S; Bouchy, F; Boumis, P; Cameron, A Collier; Doyle, A P; Hellier, C; Henning, T; Jehin, E; King, G; Kirk, J; Louden, T; Maxted, P F L; McCormac, J J; Osborn, H P; Palle, E; Pepe, F; Pollacco, D; Prieto-Arranz, J; Queloz, D; Rey, J; Ségransan, D; Udry, S; Walker, S; West, R G; Wheatley, P J

    2016-01-01

    We report three newly discovered exoplanets from the SuperWASP survey. WASP-127b is a heavily inflated super-Neptune of mass 0.18Mj and radius 1.35Rj. This is one of the least massive planets discovered by the WASP project. It orbits a bright host star (V = 10.16) of spectral type G5 with a period of 4.17 days.WASP-127b is a low density planet which has an extended atmosphere with a scale height of 2500+/-400 km, making it an ideal candidate for transmission spectroscopy. WASP-136b and WASP-138b are both hot Jupiters with mass and radii of 1.51 Mj and 1.38 Rj, and 1.22 Mj and 1.09 Rj, respectively. WASP-136b is in a 5.22-day orbit around an F9 subgiant star with a mass of 1.41 Msun and a radius of 2.21 Rsun. The discovery of WASP-136b could help constraint the characteristics of the giant planet population around evolved stars. WASP-138b orbits an F7 star with a period of 3.63 days. Its radius agrees with theoretical values from standard models, suggesting the presence of a heavy element core with a mass of 1...

  9. New antimony(III) halide complexes with dithiocarbamate ligands derived from thiuram degradation: The effect of the molecule's close contacts on in vitro cytotoxic activity.

    Science.gov (United States)

    Urgut, O S; Ozturk, I I; Banti, C N; Kourkoumelis, N; Manoli, M; Tasiopoulos, A J; Hadjikakou, S K

    2016-01-01

    Antimony(III) halide complexes of the formulae {[SbBr(Me2DTC)2]n} (1), {[SbI(Me2DTC)2]n} (2) and {[(Me2DTC)2Sb(μ2-I)Sb(Me2DTC)2](+).I3(-)} (3) (Me2DTC = dimethyldithiocarbomate) were synthesized from SbX3, (X = Br or I) and tetramethylthiuram monosulfide (Me4tms) or tetramethylthiuram disulfide (Me4tds). The complexes were characterized by melting point (m.p.), elemental analysis (e.a.), Fourier-transform Infra-Red (FT-IR), Fourier-transform Raman (FT-Raman), Nuclear Magnetic Resonance ((1)H,(13)C-NMR) spectroscopy and Thermogravimetric-Differential Thermal Analysis (TG-DTA). Crystal structures of complexes 1-3 were determined with single crystal X-ray diffraction analysis. Complexes 1 and 2 are polymers with distorted square pyramidal (SP) geometry in each monomeric unit, whereas complex 3 is ionic, containing an iodonium linkage Sb-I(+)-Sb and an I3(-) counter anion; to the best of our knowledge, this is the first ionic antimony(III) iodide complex. The in vitro cytotoxic activity of 1-3 against human adenocarcinoma cells: breast (MCF-7) and cervix (HeLa) cells and non-cancerous cells: MRC-5 (normal human fetal lung fibroblast cells) was evaluated with trypan blue (TB) and sulforhodamine B (SRB) assays. Among antimony(III) compounds with sulfur containing ligand, those of dithiocarbamates exhibit significant cytotoxic activity. Hirshfeld surface volumes were analyzed to clarify the nature of the intermolecular interactions by the 2D fingerprint plot. Molecules with lower H-all atoms inter-molecular interactions exhibit the higher activity against MCF-7 cells. The in vivo genotoxicity of 1-3 was evaluated by the mean of Allium cepa test. Alterations in the mitotic index values due to the chromosomal aberrations were observed in the case of complexes 2 and 3. Since, no such alteration is caused by 1, it makes this compound candidate for further study as potential drug. PMID:26478326

  10. Long wavelength gallium indium nitrogen arsenide and gallium-indium-nitrogen-arsenic-antimony lasers on gallium arsenide

    Science.gov (United States)

    Ha, Wonill

    The boom in fiber optic communications has created a high demand for much lower cost lasers in the 1.3--1.6 mum wavelength range for both low cost vertical-cavity surface-emitting lasers (VCSELs) and high-power Raman pumps. This has led to the introduction of dilute nitrogen into GaInAs to reduce the bandgap sufficiently, resulting in a new long wavelength material grown on GaAs. This new material will provide a new platform for low cost and high-speed directly-modulated lasers that are essential for the rapid expansion of optical wide area networks, metro area networks, and local area networks. The requirements for these lasers are a broad operating temperature range (-10 to 90°C) and moderate output power (˜10 mW) in the fundamental mode. There is also a growing interest in higher power lasers, at similar wavelengths, as pumps for Raman amplifiers to expand the available bandwidth and increase power budgets. Research has shown that GaInNAs can be coherently lattice matched to GaAs while providing the proper bandgap energy. These GaAs-based lasers with dilute N can take advantage of the well-developed GaAs processing techniques and superior distributed Bragg reflector mirror technology for VCSELs. This thesis presents new structures utilizing GaNAs barriers and a new quantum well material, GaInNAsSb, to achieve long-wavelength optical emission in post-annealed material. This increase is accompanied by a blue-shift in the bandgap energy. As a result, the distinct challenge of this material system is to achieve high quality material with sufficiently long wavelength emission. Introduction of nitrogen into the barriers reduces the blue-shift of luminescence by suppressing nitrogen out-diffusion from the quantum wells and decreasing carrier confinement in the quantum wells. We utilize antimony, both incorporated into the crystal and used as a surfactant, to enable higher indium incorporation. GaNAs or GaNAsSb barriers also reduce the overall strain of the active

  11. Post-CMOS FinFET integration of bismuth telluride and antimony telluride thin-film-based thermoelectric devices on SoI substrate

    KAUST Repository

    Aktakka, Ethem Erkan

    2013-10-01

    This letter reports, for the first time, heterogeneous integration of bismuth telluride (Bi2Te3) and antimony telluride (Sb 2Te3) thin-film-based thermoelectric ffect transistors) via a characterized TE-film coevaporationand shadow-mask patterning process using predeposition surface treatment methods for reduced TE-metal contact resistance. As a demonstration vehicle, a 2 × 2 mm2-sized integrated planar thermoelectric generator (TEG) is shown to harvest 0.7 μ W from 21-K temperature gradient. Transistor performance showed no significant change upon post-CMOS TEG integration, indicating, for the first time, the CMOS compatibility of the Bi2Te3 and Sb2Te3 thin films, which could be leveraged for realization of high-performance integrated micro-TE harvesters and coolers. © 2013 IEEE.

  12. Antimony doped tin oxides and their composites with tin pyrophosphates as catalyst supports for oxygen evolution reaction in proton exchange membrane water electrolysis

    DEFF Research Database (Denmark)

    Xu, Junyuan; Li, Qingfeng; Hansen, Martin Kalmar;

    2012-01-01

    based on tin pyrophosphates as the catalyst support. The materials showed an overall conductivity of 0.57 S cm−1 at 130 °C under the water vapor atmosphere with a contribution of the proton conduction. Using this composite support, iridium oxide nanoparticle catalysts were prepared and characterized in......Proton exchange membrane water electrolysers operating at typically 80 °C or at further elevated temperatures suffer from insufficient catalyst activity and durability. In this work, antimony doped tin oxide nanoparticles were synthesized and further doped with an inorganic proton conducting phase...... sulfuric and phosphoric acid electrolytes, showing much enhanced catalytic activity. Electrolyzer tests were conducted at both 80 °C with an Aquivion™ membrane and at 130 °C with a phosphoric acid doped Aquivion™ membrane. Significant improvement in the anodic kinetics was achieved on the composite...

  13. Antimony, Arsenic and Chromium Speciation Studies in Biała Przemsza River (Upper Silesia, Poland) Water by HPLC-ICP-MS

    OpenAIRE

    Magdalena Jabłońska-Czapla

    2015-01-01

    In this paper the total concentration of As, Cr, Sb, pH and the red-ox potential of water and sediment samples of the Biała Przemsza River were determined. The arsenic (AB, MMA, DMA, As(III), As(V)), chromium (Cr(III), Cr(VI)) and antimony (Sb(III), Sb(V)) forms were studied by HPLC-ICP-MS. Ions were successfully separated on Hamilton PRP-X100: (AB, MMA, DMA, As(III), As(V)), Dionex Ion Pac AS-7 (Sb(III), Sb(V)) and Dionex IonPac AG7 columns: Cr(III), Cr(VI) with LOD 0.16 μg/L, 0.08 μg/L, ...

  14. Progress report on neutron beam experiments in Thailand: effects of antimony substitutions on the critical temperature of Bi-Pb-Sr-Ca-Cu-O compounds

    Energy Technology Data Exchange (ETDEWEB)

    Sangariyavanich, A.; Ampornrat, P. [Office of Atomic Energy for Peace, Bangkok (Thailand)

    1998-10-01

    Effects of systematic substitutions of antimony for bismuth in Bi{sub 1.8-x}Pb{sub 0.2}Sb{sub x}Sr{sub 2}Ca{sub 3}Cu{sub 4}O{sub 10} have been investigated. Fabrication of the specimens has been performed by solid state reaction in air. The samples were sintered between 820degC - 843degC for 65 hours and subsequently quenched in liquid nitrogen. The critical temperatures of most specimens as determined by standard four-probe technique was higher than 100 K. Phase identification by X-ray diffraction technique indicated that `2223` and `2234` were the predominant phases in these samples. (author)

  15. Behavior of antimony isotopes in the primary coolant of WWER-1000-type nuclear reactors in NPP Kozloduy during operation and shutdown

    Energy Technology Data Exchange (ETDEWEB)

    Dobrevski, Ivan D.; Zaharieva, Neli N. [Bulgarian Academy of Sciences, Sofia (Bulgaria). Inst. for Nuclear Research and Nuclear Energy; Minkova, Katia F.; Gerchev, Nikolay B. [Kozloduy Nuclear Power Plant, Kozloduy (Bulgaria). Dept. of Chemistry and Radiochemistry

    2009-05-15

    This paper focuses on the behavior of the antimony isotopes {sup 122}Sb and {sup 124}Sb in the coolant of the WWER reactors in the nuclear power plant Kozloduy (Bulgaria) during operation and shutdown. It is concluded that the chemical properties of their actual precursor, the isotope {sup 121}Sb, determine the behavior of {sup 122}Sb and {sup 124}Sb during operation, load fluctuations, and shutdown as well as during the reactor coolant purification process. It is supposed that differences between the reactor bulk and the core fuel cladding surface chemistry as well as the presence of sub-cooled nucleate boiling at the fuel cladding may create conditions under which a local oxidizing environment may come into existence. (orig.)

  16. Comparison of the native antimony-bearing Paiting gold deposit, Guizhou Province, China, with Carlin-type gold deposits, Nevada, USA

    Science.gov (United States)

    Xie, Zhuo-Jun; Xia, Yong; Cline, Jean S.; Yan, Bao-Wen; Wang, Ze-Peng; Tan, Qin-Ping; Wei, Dong-Tian

    2016-03-01

    The Paiting gold deposit, Guizhou Province, China, has been regarded as a Carlin-type gold deposit by several researchers. Alteration and ore-related minerals from the Paiting deposit were examined, and results were compared with the Cortez Hills Carlin-type gold deposit, Nevada, USA. Similarities include the structural and stratigraphic controls on the orebodies in both deposits and the occurrence of invisible gold ionically bound in arsenian pyrite. Significant differences include the following: (1) The gold-bearing mineral in Nevada is arsenian pyrite. However, gold-bearing minerals in the Paiting deposit include arsenopyrite, arsenian pyrite, and trace pyrrhotite. Also, euhedral or subhedral gold-bearing arsenian pyrite at Paiting contains significantly less As, Cu, and Hg than gold-bearing pyrite from Nevada. (2) Alteration in the Paiting deposit displays significantly less decarbonatization. Instead, dolomite precipitation, which has not been described in Nevada deposits, is associated with deposition of gold-bearing sulfide minerals. (3) Stibnite and minor native antimony typify Paiting late-ore-stage minerals, whereas in Nevada, realgar, orpiment, and calcite are common late-ore-stage minerals. Precipitation of native antimony in the Paiting deposit reflects the evolution of a late-ore fluid with unusually low sulfur and oxygen fugacities. Some characteristics of the Paiting gold deposit, including formation of ore-stage dolomite and precipitation from CO2-rich ore fluids at temperatures in excess of 250 °C, are more typical of orogenic deposits than Nevada Carlin deposits. The presence of similarities in the Paiting deposit to both Carlin type and orogenic deposits is consistent with formation conditions intermediate to those typical of Carlin type and orogenic systems.

  17. Antimony, Arsenic and Chromium Speciation Studies in Biała Przemsza River (Upper Silesia, Poland) Water by HPLC-ICP-MS.

    Science.gov (United States)

    Jabłońska-Czapla, Magdalena

    2015-05-01

    In this paper the total concentration of As, Cr, Sb, pH and the red-ox potential of water and sediment samples of the Biała Przemsza River were determined. The arsenic (AB, MMA, DMA, As(III), As(V)), chromium (Cr(III), Cr(VI)) and antimony (Sb(III), Sb(V)) forms were studied by HPLC-ICP-MS. Ions were successfully separated on Hamilton PRP-X100: (AB, MMA, DMA, As(III), As(V)), Dionex Ion Pac AS-7 (Sb(III), Sb(V)) and Dionex IonPac AG7 columns: Cr(III), Cr(VI) with LOD 0.16 μg/L, 0.08 μg/L, 0.09 μg/L, 0.012 μg/L, 0.08 μg/L, 0.12 μg/L, 0.009 μg/L, 0.012 μg/L, 0.19 μg/L, 0.37 μg/L, respectively. The simplified BCR three-step sequential chemical extraction was performed on the bottom sediment samples. The samples were collected monthly, between April and December 2014, at five sampling points. Large contents of manganese, lead, cadmium and zinc were found in the Biała Przemsza River water. In December 2014, the lead content in the bottom sediment in Sławków was nearly 6000 mg/kg. In the river water, only the inorganic arsenic speciation forms were found. Sb(V), As(V) and Cr(III) were dominant. Studies have shown that arsenic, antimony and chromium were mainly bound to oxides, organic matter and sulphides in the bottom sediments. PMID:25941843

  18. Antimony, Arsenic and Chromium Speciation Studies in Biała Przemsza River (Upper Silesia, Poland Water by HPLC-ICP-MS

    Directory of Open Access Journals (Sweden)

    Magdalena Jabłońska-Czapla

    2015-04-01

    Full Text Available In this paper the total concentration of As, Cr, Sb, pH and the red-ox potential of water and sediment samples of the Biała Przemsza River were determined. The arsenic (AB, MMA, DMA, As(III, As(V, chromium (Cr(III, Cr(VI and antimony (Sb(III, Sb(V forms were studied by HPLC-ICP-MS. Ions were successfully separated on Hamilton PRP-X100: (AB, MMA, DMA, As(III, As(V, Dionex Ion Pac AS-7 (Sb(III, Sb(V and Dionex IonPac AG7 columns: Cr(III, Cr(VI with LOD 0.16 μg/L, 0.08 μg/L, 0.09 μg/L, 0.012 μg/L, 0.08 μg/L, 0.12 μg/L, 0.009 μg/L, 0.012 μg/L, 0.19 μg/L, 0.37 μg/L, respectively. The simplified BCR three-step sequential chemical extraction was performed on the bottom sediment samples. The samples were collected monthly, between April and December 2014, at five sampling points. Large contents of manganese, lead, cadmium and zinc were found in the Biała Przemsza River water. In December 2014, the lead content in the bottom sediment in Sławków was nearly 6000 mg/kg. In the river water, only the inorganic arsenic speciation forms were found. Sb(V, As(V and Cr(III were dominant. Studies have shown that arsenic, antimony and chromium were mainly bound to oxides, organic matter and sulphides in the bottom sediments.

  19. Evaluation of organelle changes in promastigotes of unresponsive leishmania tropica to meglumine antimoniate in comparison with sensitive and standard isolates by electron microscopy

    Directory of Open Access Journals (Sweden)

    Mitra Bahreini

    2015-01-01

    Full Text Available Background: The control of leishmaniasis faces serious challenges because of resistance to the first-line antimonial drugs. We aimed to evaluate the differences in organelle changes of cultivated promastigotes obtained from skin lesions of sensitive and unresponsive isolates to meglumine antimoniate (Glucantime by electron microscopy. Material and Methods: This study was done in Bam city, southeastern Iran, in which the incidence of disease has sharply increased since the earthquake in 2003. The samples were taken from 66 patients who were referred to the cutaneous leishmaniasis (CL treatment center in Bam. A questionnaire was completed for each individual, recording their demographic characteristics and CL status. The scraping smears provided from the edge of active lesions with sterile blades were fixed with methanol, stained by Giemsa, and examined under a compound light microscope for amastigote form simultaneously. To prepare the specimens for transmission electron imaging, promastigotes were centrifuged and resuspened. Results: Transmission electron microscopic study of the cultivated promastigotes revealed that there were alterations in the organelles and structures of sensitive isolates compared with unresponsive and standard ones. Organelles and structures such as mitochondria, kinetoplast, microtubules, cytoplasmic vacuoles, plasma membrane and vesicles were studied. The alterations such as disintegration of kinetoplast into thin filaments and condensation of kinetoplast DNA core, changes in size, number and location of vesicles and microtubules were observed. We noted intense cytoplasmic vacuolization, and considerable swelling of mitochondria. Conclusion: The significance and relevance of these changes might help understand drug resistance patterns and help localize the best target site for inactivating the organism.

  20. Evaluation of a Possible Synergistic Effect of Meglumine Antimoniate with Paromomycin, Miltefosine or Allopurinol on in Vitro Susceptibility of Leishmania tropica Resistant Isolate

    Directory of Open Access Journals (Sweden)

    Tahereh Rezaei Riabi

    2013-09-01

    Full Text Available Background: Pentavalent antimonials are still the first choice treatment for leishma­niasis, but with low efficacy and resistance is emerging. In the present study, the effect of meglumine antimoniate (MA, Glucantime combined with paromomy­cin, miltefosine or allopurinol on in vitro susceptibility of Leishmania tropica resistant isolate was evaluated.Method: The drugs were obtained from commercial sources and diluents of each drug in medium were prepared on the day of experiment. J774 A.1 murine macrophage cell lines were attached to the cultured on slide and incubated at 37 0C with 5% CO2 for 24 h. Then the stationary phase promastigotes were added to the cells and after 4 hrs of incubation different concentrations of MA, paromomycin, miltefosine or allopurinol were added and incubated for an additional of 72 h. Then the slides were dried and fixed with methanol, stained by Giemsa and studied under a light microscope. Drug activity was evaluated by assessing the macrophage infection rate and the number of amastigotes per infected macrophage was done by examin­ing 100 macrophages. The experiment was done in triplicates.Result: Various concentrations of MA along with paromomycin, miltefosine or allopurinol significantly inhibited (P<0.01 the proliferation of L. tropica amastigote stage in the macrophage cell line as compared with MA alone or positive control.Conclusion: Combination of Glucantime with paromomycin, miltefosine or allopuri­nol showed a synergistic effect on the clinical isolate of L. tropica in vitro. Use of combination therapy is a new hope and a logical basis for therapy of the pa­tients with cutaneous leishmaniasis. Further investigations are needed to evaluate the therapeutic effects of these drugs on the CL patients.