WorldWideScience

Sample records for antimony 137

  1. Antimony Toxicity

    Directory of Open Access Journals (Sweden)

    Shyam Sundar

    2010-12-01

    Full Text Available Antimony toxicity occurs either due to occupational exposure or during therapy. Occupational exposure may cause respiratory irritation, pneumoconiosis, antimony spots on the skin and gastrointestinal symptoms. In addition antimony trioxide is possibly carcinogenic to humans. Improvements in working conditions have remarkably decreased the incidence of antimony toxicity in the workplace. As a therapeutic, antimony has been mostly used for the treatment of leishmaniasis and schistosomiasis. The major toxic side-effects of antimonials as a result of therapy are cardiotoxicity (~9% of patients and pancreatitis, which is seen commonly in HIV and visceral leishmaniasis co-infections. Quality control of each batch of drugs produced and regular monitoring for toxicity is required when antimonials are used therapeutically.

  2. Pentavalent Antimonials: New Perspectives for Old Drugs

    OpenAIRE

    Ribeiro, Raul R.; Cynthia Demicheli; Frédéric Frézard

    2009-01-01

    Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent stud...

  3. Pentavalent Antimonials: New Perspectives for Old Drugs

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro

    2009-06-01

    Full Text Available Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent studies suggest that pentavalent antimony acts as a prodrug that is converted to active and more toxic trivalent antimony. Other works support the direct involvement of pentavalent antimony. Recent data suggest that the biomolecules, thiols and ribonucleosides, may mediate the actions of these drugs. This review will summarize the progress to date on the chemistry and biochemistry of pentavalent antimony. It will also present the most recent works being done to improve antimonial chemotherapy. These works include the development of simple synthetic methods for pentavalent antimonials, liposome-based formulations for targeting the Leishmania parasites responsible for visceral leishmaniasis and cyclodextrin-based formulations to promote the oral delivery of antimony.

  4. Testing of antimony selective media for treatment of liquid radwaste

    International Nuclear Information System (INIS)

    Nuclear power plants have sought radiation source term reduction and reduced discharge of radioactive constituents for many years. In the case of pressurized water reactors (PWRs), the latter efforts have been directed toward capture and immobilization of recalcitrant (ubiquitous radionuclides with long half-lives) species such as Cs-134 and Cs-137 and Co-58 and Co-60. As these plants resolved, or at least mitigated, the problems with radiocesium and radio-cobalt, antimony radionuclides (Sb-122, Sb-124, and Sb-125) have become a primary concern in liquid liquid radwaste systems Graver Technologies developed a granular composite metal oxide media with good selectivity for radio-antimony. Initial laboratory data were collected using non-radioactive salts of antimony, cesium, and cobalt to judge efficacy of selective removal of antimony. Based on success of those trials, the media, designated Gravex GX187, was tested in partnership with Energy Solutions (nee Duratek) using actual liquid liquid radwaste in two PWR plants. One of these plants performed extensive slip-stream trials comparing the GX187 with strong base anion resins. With more than 2500 bed volumes of throughput, the GX187 outperformed the other competitors by reducing both Sb-124 and Sb-125 radionuclides below minimum detectable activity (MDA) with average decontamination factors (DF's) of 170, even when subjected to high levels of borate. Based on these favorable results, Energy Solutions installed the GX187 in a layered bed in their ALPS liquid radwaste processing system at this plant in August 2005. After one year of intermittent, batchwise operation including an outage, the GX187 processed more than 2.25 million liters (>600,000 gallons) of liquid liquid radwaste while reducing the Sb-125 activity to 2.9 E-08 Bq/L (DF=111) on average. This evaluation is ongoing and will continue at least until the fall 2006 outage at this plant. Concurrently, Graver developed a second generation antimony selective

  5. FIRST REPORT ON OTOTOXICITY OF MEGLUMINE ANTIMONIATE

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Valete-Rosalino

    2014-09-01

    Full Text Available Introduction: Pentavalent antimonials are the first drug of choice in the treatment of tegumentary leishmaniasis. Data on ototoxicity related with such drugs is scarcely available in literature, leading us to develop a study on cochleovestibular functions. Case Report: A case of a tegumentary leishmaniasis patient, a 78-year-old man who presented a substantial increase in auditory threshold with tinnitus and severe rotatory dizziness during the treatment with meglumine antimoniate, is reported. These symptoms worsened in two weeks after treatment was interrupted. Conclusion: Dizziness and tinnitus had already been related to meglumine antimoniate. However, this is the first well documented case of cochlear-vestibular toxicity related to meglumine antimoniate.

  6. Cesium-137

    International Nuclear Information System (INIS)

    This sheet belongs to a collection which relates to the use of radionuclides essentially in unsealed sources. Its goal is to gather on a single document the most relevant information as well as the best prevention practices to be implemented. These sheets are made for the persons in charge of radiation protection: users, radioprotection-skill persons, labor physicians. Each sheet treats of: 1 - the radio-physical and biological properties; 2 - the main uses; 3 - the dosimetric parameters; 4 - the measurement; 5 - the protection means; 6 - the areas delimitation and monitoring; 7 - the personnel classification, training and monitoring; 8 - the effluents and wastes; 9 - the authorization and declaration administrative procedures; 10 - the transport; and 11 - the right conduct to adopt in case of incident or accident. This sheet deals specifically with Cesium-137

  7. Antimony bioavailability in mine soils

    International Nuclear Information System (INIS)

    Antimony has low bioavailability in mining and smelting contaminated soils and bacterial biosensors are not suitable for its detection. - Five British former mining and smelting sites were investigated and found to have levels of total Sb of up to 700 mg kg-1, indicating high levels of contamination which could be potentially harmful. However, this level of Sb was found to be biologically unavailable over a wide range of pH values, indicating that Sb is relatively unreactive and immobile in the surface layers of the soil, remaining where it is deposited rather than leaching into lower horizons and contaminating ground water. Sb, sparingly soluble in water, was unavailable to the bacterial biosensors tested. The bioluminescence responses were correlated to levels of co-contaminants such as arsenic and copper, rather than to Sb concentrations. This suggests that soil contamination by Sb due to mining and smelting operations is not a severe risk to the environment or human health provided that it is present as immobile species and contaminated sites are not used for purposes which increase the threat of exposure to identified receptors. Co-contaminants such as arsenic and copper are more bioavailable and may therefore be seen as a more significant risk

  8. Perspectives of antimony compounds in oncology

    Institute of Scientific and Technical Information of China (English)

    Pankaj SHARMA; Diego PEREZ; Armando CABRERA; Nee ROSAS; Jose Luis ARIAS

    2008-01-01

    Antimony, a natural element that has been used as a drug for over more than 100 years, has remarkable therapeutic efficacy in patients with acute promyelocytic leukemia. This review focuses on recent advances in developing antimony anti- cancer agents with an emphasis on antimony coordination complexes, Sb (Ⅲ) and Sb (V). These complexes, which include many organometallic complexes, may provide a broader spectrum of antitumoral activity. They were compared with classical platinum anticancer drugs. The review covers the literature data pub- lished up to 2007. A number of antimonials with different antitumoral activities are known and have diverse applications, even though little research has been done on their possibilities. It might be feasible to develop more specific and effective inhibitors for phosphatase-targeted, anticancer therapeutics through the screen- ing of sodium stibogluconate (SSG) and potassium antimonyltartrate-related compounds, which are comprised of antimony conjugated to different organic moieties. For example, SSG appears to be a better inhibitor than suramin which is a compound known for its antineoplastic activity against several types of cancers.

  9. Preparation of nanosized antimony by mechanochemical reduction of antimony sulphide Sb2S3

    International Nuclear Information System (INIS)

    The preparation of nanosized antimony (grain size 19 nm) by high-energy milling of antimony sulphide Sb2S3 with elemental Fe as reducing element is reported. The mechanochemical reduction was performed in a planetary ball mill for 10-180 min. The process is rather straightforward with elemental antimony and iron sulphide (pyrrhotite-4H) being the only solid-state products. The process kinetics as described by X-ray diffraction (XRD) and vibrating sample magnetometer (VSM) magnetometry shows that most of the reduction is complete after 60 min of milling

  10. The Membrane Electrowinning Separation of Antimony from a Stibnite Concentrate

    Science.gov (United States)

    Yang, Jian-Guang; Yang, Sheng-Hai; Tang, Chao-Bo

    2010-06-01

    The main purpose of this study was to characterize and to extract antimony from a stibnite concentrate through electrowinning. This article reports an account of a study conducted on the optimization of the process parameters for antimony pentachloride circular leaching, purification, and electrowinning of antimony from antimony trichloride solution. The effect of electrowinning parameters, such as antimony and sodium chloride concentration in the catholyte, temperature, current density, polar distance, etc., on the voltage requirement and the current efficiency (CE) of antimony electrodeposition was explored. A maximum CE of more than 97 pct was attained with a catholyte composition of 70-g/L antimony, 25-g/L NaCl, 4.5-mol/L hydrogen ion concentration, with an anolyte composition of 40-g/L antimony trichloride at a temperature of 328 K (55 °C), a 4-cm polar distance, and a cathode current density of 200 A/m2. Under the optimized conditions, the CE was more than 97 pct, and a 99.98 pct antimony plate was obtained on the cathode. The chemical content analysis of the resulting anolyte was indicated to be 97 pct antimony pentachloride and 3 pct antimony trichloride, which could be recycled to leaching tank as the leaching agent.

  11. Synthesis and application of antimony pent(isooctyl thioglycollate)

    Institute of Scientific and Technical Information of China (English)

    LIU You-nian; LI Hong-bing; SHU Wan-gen; CHEN Qi-yuan

    2005-01-01

    A new type of thermal stabilizer, antimony pent(isooctyl thioglycollate)(Sb(SCH2COOC8H17)5), was synthesized by using antimony trioxide, isooctanol and thioglycolic acid in 2 steps. Firstly, antimony trioxide was oxidized into colloidal antimony peroxide. Then antimony peroxide and isooctyl thioglycollate reacted stoichiometrically for 2 h with the yield of 87%. This compound was used as thermal stabilizer for polyvinyl chloride(PVC). The results show that the thermal stability time is 52 min at 200 ℃ by heat-ageing oven test when adding 2.5% thermal stabilizer to PVC resin. Compared with antimony tris(isooctyl thiolycollate), the initial thermal stability of antimony pent(isooctyl thioglycollate) is better than that of antimony tris(isooctyl thioglycollate), while the long-term thermal stability time is shorter than that of antimony tris(isooctyl thioglycollate). Meanwhile, the synergism of antimony pent(isooctyl thioglycollate) with calcium stearate was studied, indicating that when the mass ratio of antimony pent(isooctyl thioglycollate) to calcium stearate is 2:1, the thermal stability time of PVC is 58 min.

  12. Novel methods for the encapsulation of meglumine antimoniate into liposomes

    Directory of Open Access Journals (Sweden)

    F. Frézard

    2000-07-01

    Full Text Available The antimonial drug, meglumine antimoniate, was successfully encapsulated in dehydration-rehydration vesicles and in freeze-dried empty liposomes (FDELs. High encapsulation efficiencies (from 28 to 58% and low weight ratios of lipids to encapsulated antimony (from 1:0.15 to 1:0.3 were achieved. These formulations, contrary to those obtained by conventional methods, can be stored as intermediate lyophilized forms and reconstituted just before use. The efficacy of FDEL-encapsulated meglumine antimoniate was evaluated in hamsters experimentally infected with Leishmania chagasi. A significant reduction of liver parasite burdens was observed in animals treated with this preparation, when compared to control animals treated with empty liposomes. In contrast, free meglumine antimoniate was found to be inefficient when administered at a comparable dose of antimony. This novel liposome-based meglumine antimoniate formulation appears to be promising as a pharmaceutical product for the treatment of visceral leishmaniasis.

  13. Microbial antimony biogeochemistry: Enzymes, regulation, and related metabolic pathways

    Science.gov (United States)

    Li, Jingxin; Qian Wang; Oremland, Ronald S.; Kulp, Thomas R.; Rensing, Christopher; Wang, Gejiao

    2016-01-01

    Antimony (Sb) is a toxic metalloid that occurs widely at trace concentrations in soil, aquatic systems, and the atmosphere. Nowadays, with the development of its new industrial applications and the corresponding expansion of antimony mining activities, the phenomenon of antimony pollution has become an increasingly serious concern. In recent years, research interest in Sb has been growing and reflects a fundamental scientific concern regarding Sb in the environment. In this review, we summarize the recent research on bacterial antimony transformations, especially those regarding antimony uptake, efflux, antimonite oxidation, and antimonate reduction. We conclude that our current understanding of antimony biochemistry and biogeochemistry is roughly equivalent to where that of arsenic was some 20 years ago. This portends the possibility of future discoveries with regard to the ability of microorganisms to conserve energy for their growth from antimony redox reactions and the isolation of new species of “antimonotrophs.”

  14. Vacuum Evaporation Technology for Treating Antimony-Rich Anode Slime

    Science.gov (United States)

    Qiu, Keqiang; Lin, Deqiang; Yang, Xuelin

    2012-11-01

    A vacuum evaporation technology for treating antimony-rich anode slime was developed in this work. Experiments were carried out at temperatures from 873 K to 1073 K and residual gas pressures from 50 Pa to 600 Pa. During vacuum evaporation, silver from the antimony-rich anode slime was left behind in the distilland in a silver alloy containing antimony and lead, and antimony trioxide was evaporated. The experimental results showed that 92% by weight of antimony can be removed, and the silver content in the alloy was up to 12.84%. The antimony trioxide content in the distillate was more than 99.7%, and the distillate can be used directly as zero-grade antimony trioxide (China standard).

  15. Volatilization of cesium-137 from soil with chloride amendments during heating and vitrification

    International Nuclear Information System (INIS)

    During vitrification of soil and soil:limestone mixtures, significant volatilization (> 10%) of the radioisotope 137Cs occurred particularly in the presence of small amounts (99% of the 137Cs by repeated amendment and treatment at 1000 degree C. Amendment with sodium borate and subsequent heating to 1200 degree C also stimulated significant volatilization of 137Cs. However, amendments up to 10% of other chemicals including carbonates, nitrates, phosphates, sulfates, fluorides, polystyrene, graphite, stainless steels, iron, zinc oxide, and antimony oxide did not increase 137Cs volatilization compared to unamended samples. The majority of the chloride-induced volatilization occurred between 800 and 1000 degree C for sodium chloride-amended samples of both soil and soil:limestone mixtures. Thus, an effective and potentially efficient soil decontamination technique for 137Cs has been identified. 17 refs., 8 figs., 3 tabs

  16. Decorporation of cesium-137

    International Nuclear Information System (INIS)

    Cesium radio-isotopes, especially cesium-137 (137Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, 137Cs is a major contaminant which can cause severe β, γirradiations and contaminations. 137Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the 137Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  17. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    International Nuclear Information System (INIS)

    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122 Sb and 124 Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  18. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta Etel Treiger; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Lab. de Biologia Molecular]. E-mail: samanta@usp.br; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo (IMT-SP), SP (Brazil). Lab. de Protozoologia]. E-mail:hfandrad@usp.br

    2005-10-15

    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes {sup 122} Sb and {sup 124} Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  19. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    OpenAIRE

    Samanta Etel Treiger Borborema; Heitor Franco de Andrade Junior; João Alberto Osso Junior; Nanci do Nascimento

    2005-01-01

    Pentavalent antimony, as meglumine antimoniate (Glucantime® ) or sodium stibogluconate (Pentostam® ), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer...

  20. The exposure to and health effects of antimony

    DEFF Research Database (Denmark)

    Cooper, Ross G.; Harrison, Adrian Paul

    2009-01-01

    . Antimony toxicity is dependent on the exposure dose, duration, route (breathing, eating, drinking, or skin contact), other chemical exposures, age, sex, nutritional status, family traits, life style, and state of health. Chronic exposure to antimony in the air at levels of 9 mg/m3 may exacerbate irritation...

  1. The presence of antimony in various dental filling materials

    International Nuclear Information System (INIS)

    Antimony was determined in a number of non-metallic dental materials currently used for tooth restoration. The method applied was instrumental neutron activation analysis. The concentration of antimony in some of the brands tested was found to be as high as 900 fold that in the normal hard dental tissues. (author)

  2. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    International Nuclear Information System (INIS)

    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb+5) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes 122Sb and 124Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony and high uptake in

  3. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta E.T.; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mails: samanta@usp.br; nnascime@ipen.br; Andrade Junior, Heitor F. de [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular; Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil); E-mail: hfandrad@usp.br; Osso Junior, Joao A. [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br

    2007-07-01

    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb{sup +5}) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes {sup 122}Sb and {sup 124}Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony

  4. Separation of traffic related antimony compounds

    International Nuclear Information System (INIS)

    Complete text of publication follows. It is known that most of the brake pads contain Sb2S3 as lubricant to achieve better friction stability. Due to braking the brake lining crumbles away and its Sb content gets into the air. As a result of the temperature increase accompanying the braking a part of the antimony may oxidize to oxides, as Sb2O3 or even to the more stable form, Sb2O4. Since Sb2O3 more readily soluble than the others, its absorption from the lung so its environmental impact effect is more harmful. After a systematic investigation involving solubilization of the solid compounds, citric and tartaric acid as well as 6 mol/dm3 HCl were tested for leaching of trace antimony compounds from natural matrix. To prepare reference material related to these species, soil and activated charcoal was spiked in 10 μg/g concentration with all the three material (Sb2S3, Sb2O3,Sb2O4). separately. Recovery of the different forms was checked by graphite furnace atomic absorption spectrometric (GFAAS) analysis of the leachates. The soil was confirmed to oxidize the sulfide content while the activated charcoal was established to enrich antimony from HCl solution as ion association complex. It was concluded, that Sb2S3 is leached only in slight amount in 4 hours by 0.1-0.5 mol/dm3 citric acid, while leaching of Sb2O3 is quantitative. On the other side, it was proved that Sb2O3 as well as Sb2S3 traces are soluble in 6 HCl solution in 60 min, whilst Sb2O4 is not destroyed. So, the Sb2O3 and Sb2S3 content of a flying dust can be determined. The GFAAS temperature program had to be modified in order to be capable to analyze high organic matrix as citric or tartaric acid even in 0.5 mol/dm3 concentration. Concerning their decomposition temperature an additional step was inserted into the temperature program, pyrolysis on 300 and 400 deg C, respectively. The antimony concentration of the highly acidic leachates were determined by hydride generation GFAAS. The reproducibility of

  5. Reducing NOx emissions with antimony additive

    International Nuclear Information System (INIS)

    This paper describes improvement in a process for the catalytic cracking of a heavy hydrocarbon feed containing Ni and nitrogen compounds by contact with a circulating inventory of catalytic cracking catalyst to produce catalytically cracked products and spent catalyst. It comprises: Ni or Ni compounds and coke comprising nitrogen compounds, and wherein the spent catalyst is regenerated by contact with oxygen or an oxygen-containing gas in a catalyst regeneration zone operating at catalyst regeneration conditions to produce hot regenerated catalyst comprising Ni or Ni compounds which is recycled to catalytically crack the heavy feed and the catalyst regeneration zone produces a flue gas comprising CO, CO2 and oxides of nitrogen, NOx. The improvement comprises: adding to the circulating catalyst inventory CO combustion promoter in an amount equivalent to 0.01 to 50 wt ppm Pt to reduce the CO content of the flue gas and reducing the NOx content of the flue gas by adding to the circulating catalyst inventory a separate particle additive comprising antimony. The additive being added in an amount sufficient to reduce the production of NOx relative to operation without the additive, and wherein the additive comprises a compound of antimony which does not substantially passivate the Ni or Ni compounds present on the cracking catalyst, nor deactivate the CO combustion promoter

  6. Investigation into antimony mobility in sewage sludge fermentation.

    Science.gov (United States)

    Wehmeier, Silvia; Feldmann, Jörg

    2005-12-01

    Antimony is distributed in the environment in inorganic and organic species with different solubility and mobility characters. Here we investigate the transformation of antimony in view of biomethylation during sewage sludge fermentation as a case study for an anaerobic environment. Our approach was to identify if antimony methylation follows the Challenger pathway by using isotopically enriched antimonite (123Sb(v)). The antimony source was subjected to methylation in sewage sludge, an anaerobic dominant methanogenic Archaea community. The antimony species were determined in the gas phase using cryotrapping (CT)-GC-ICP-MS, and in the medium (sewage slude) by hydride generation (HG) prior CT-GC-ICP-MS. The determined 123/121Sb isotope ratios in the volatile trimethylstibine and non-volatile methylantimony species indicated that the methylation follows the proposed methylation pathway. With this approach we were able to quantify 123Sb incorporation into monomethyl-, dimethyl- and trimethylantimony, respectively. The incorporation decreased with further methylation from 91% to 82% and 73%. Volatilisation as trimethystibine was generally lower than 0.1%, however, up to 0.8% of added antimony was found methylated to methylantimony species and mainly accumulated in the cell. Moreover, antimony biomethylation was enhanced by stimulation of the anaerobic communities of methanogenic Archaea and sulfate reducing bacteria (SRB), with the methanogens showing a higher activity. PMID:16307071

  7. Cesium-137 in biosphere

    International Nuclear Information System (INIS)

    The behaviour of cesium-137 in environment is reviewed. Problems on 137Cs migration in environment, on metabolism andbiological effects are considered. Data on nuclide accumulation in various plants, ways of their entering the man's organism are presented. It is marked that the rate of 137Cs metabolism in the man's organism depends considerably on age, sex, temperature of environment, conditions for activity, water and mineral metabolism and some other factors. It is shown that the annual effective equivalent dose per capita will increase to 2000 yr. up to 1 μSv, that constitutes 0.05% of the average value of irradiation by a natural source

  8. Novel antimony-silicate material Quasar-n for the removal of radionuclides from acidic decontamination liquids - 16157

    International Nuclear Information System (INIS)

    Novel antimony silicate material, commercially available from PQ Corporation (previously Ineos Silicas) is highly selective for the removal of several key radionuclides (Co-60, Sr-90, Cs-137, Pu-236 and Am-241) from acidic and neutral nuclear waste effluents. The paper will summarise most the key results that have been obtained in the previous studies of the material. In addition, new test results on the removal Co-60, Sr-90, Cs-137 and Am-241 from acid media are reported. Static batch experiments and column experiments show that Am can be removed efficiently from nitric and oxalic acid, indicating that Quasar is suitable e.g. for the purification of acidic decontamination solutions. (authors)

  9. Structural and electrical characterization of zinc oxide doped with antimony

    Directory of Open Access Journals (Sweden)

    G. Juárez Díaz

    2014-08-01

    Full Text Available In this work we report the results of structural and electrical characterization realized on zinc oxide single crystal samples with (001 orientation, which were doped with antimony. Doping was carried out by antimony thermal diffusion at 1000 °C for periods of 1 and 2 hours under nitrogen environment from a solid source formed by antimony oxide. Electrical characterization by I-V curves and Hall effect shown an increase in acceptor concentration which demonstrates that doping is effective and create holes in zinc oxide samples.

  10. Nanometric Antimony Powder Synthesis by Activated Alkaline Hydride Reduction of Antimony Pentachloride

    International Nuclear Information System (INIS)

    A novel chemical reduction method using an activated alkaline hydride (LiH or NaH-t-BuONa) in tetrahydrofuran solvent has been applied to antimony salt reduction. X-ray diffraction and transmission electron microscopy studies have been carried out to characterize the morphology and structure of the materials. Alkali hydride nature influence has been proved. In both cases the process allows to prepare antimony particles in nanometer range from few nanometers to about 20nm which could be used as anodic materials for lithium-ion batteries. With lithium hydride well-crystallized particles inclined to agglomeration were observed whereas finely dispersed amorphous particles were pointing out after activated sodium hydride reduction

  11. Deposition of rod-shaped antimony sulfide thin films from single-source antimony thiosemicarbazone precursors

    Energy Technology Data Exchange (ETDEWEB)

    Biswal, Jasmine B.; Sawant, Narayan V. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India); Garje, Shivram S., E-mail: ssgarje@chem.mu.ac.i [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India)

    2010-04-02

    Antimony sulfide thin films were deposited on glass substrates by aerosol assisted chemical vapour deposition technique using single source precursors, namely, antimony(III) thiosemicarbazones, SbCl{sub 3}(L) (L = thiosemicarbazones of thiophene-2-carboxaldehyde (1) and cinnamaldehyde (2)). The deposited films were characterized by X-ray diffraction, scanning electron microscopy, energy dispersive X-ray analysis and UV-visible spectroscopy in order to identify their phases, morphologies, compositions and optical properties respectively. These characterizations revealed that the films were comprised of rod-shaped particles of orthorhombic stibnite (Sb{sub 2}S{sub 3}) with a Sb:S stoichiometry of {approx} 1:1.3. The calculated optical band gap from UV-vis absorption spectrum is found to be 3.48 eV.

  12. Antimony mobility in Japanese agricultural soils and the factors affecting antimony sorption behavior

    International Nuclear Information System (INIS)

    The mobility of antimony (Sb) in Japanese agricultural soils was studied by radiotracer experiments using 124Sb tracer. The soil-solution distribution coefficients (K d) of Sb were measured for 110 soil samples. These K ds ranged from 1 to 2065 L kg-1; the geometric mean was 62 L kg-1 excluding one extremely high value, 2065 L kg-1. Experimental measurement of K d showed a decrease with both increasing pH and increasing phosphate concentration. The latter suggested that one aspect of the Sb sorption phenomena in Japanese soil was influenced by specific adsorption of anions such as phosphate. However, other aspects could not be explained by this specific adsorption mechanism, because only 20-40% of soil-sorbed Sb could be extracted by phosphate solution. - Antimony mobility in tested Japanese agricultural soils was generally low and was affected by pH and phosphate concentration

  13. Selective determination of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone by atomic-absorption spectrometry with a carbon-tube atomizer.

    Science.gov (United States)

    Kamada, T; Yamamoto, Y

    1977-05-01

    The extraction behaviour of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone in organic solvents has been investigated by means of frameless atomic-absorption spectrophotometry with a carbon-tube atomizer. The selective extraction of antimony(III) and differential determination of antimony(III) and antimony(V) have been developed. With ammonium pyrrolidinedithiocarbamate and methyl isobutyl ketone, when the aqueous phase/solvent volume ratio is 50 ml/10 ml and the injection volume in the carbon tube is 20 mul, the sensitivity for antimony is 0.2 ng/ml for 1% absorption. The relative standard deviations are ca. 2%. Interferences by many metal ions can be prevented by masking with EDTA. The proposed methods have been applied satisfactorily to determination of antimony(III) and antimony(V) in various types of water. PMID:18962096

  14. Antimony distribution and environmental mobility at an historic antimony smelter site, New Zealand

    International Nuclear Information System (INIS)

    A historic antimony smelter site at Endeavour Inlet, New Zealand has smelter residues with up to 17 wt.% antimony. Residues include coarse tailings (cm scale particles, poorly sorted), sand tailings (well sorted) and smelter slag (blocks up to 30 cm across). All of this material has oxidised to some degree over the ca. 100 years since the site was abandoned. Oxidation has resulted in acidification of the residues down to pH 2-5. Smelter slag contains pyrrhotite (FeS) and metallic antimony, and oxidation is restricted to surfaces only. The coarse tailings are the most oxidised, and few sulfide grains persist. Unoxidised sand tailings contain 10-20 vol.% stibnite (Sb2S3) containing up to 5% As, with subordinate arsenopyrite (FeAsS), and minor pyrite (FeS2). The sand tailings are variably oxidised on a scale of 2-10 cm, but original depositional layering is preserved during oxidation and formation of senarmontite (Sb2O3). Oxidation of sand tailings has resulted in localised mobility of both Sb and As on the cm scale, resulting in redistribution of these metalloids with iron oxyhydroxide around sand grain boundaries. Experiments demonstrate that Sb mobility decreases with time on a scale of days. Attenuation of both As and Sb occurs due to adsorption on to iron oxyhydroxides which are formed during oxidation of the smelter residues. There is no detectable loss of Sb or As from the smelter site into the adjacent river, <50 m away, which has elevated Sb (ca. 20 μg/l) and As (ca. 7 μg /l) from mineralised rocks upstream. Despite the high concentrations of Sb and As in the smelter residues, these metalloids are not being released into the environment. - High levels of antimony in primitive smelter soils remain largely immobile on the metre scale

  15. Tissue distribution of residual antimony in rats treated with multiple doses of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Deise Riba Coelho

    2014-07-01

    Full Text Available Meglumine antimoniate (MA and sodium stibogluconate are pentavalent antimony (SbV drugs used since the mid-1940s. Notwithstanding the fact that they are first-choice drugs for the treatment of leishmaniases, there are gaps in our knowledge of their toxicological profile, mode of action and kinetics. Little is known about the distribution of antimony in tissues after SbV administration. In this study, we evaluated the Sb content of tissues from male rats 24 h and three weeks after a 21-day course of treatment with MA (300 mg SbV/kg body wt/d, subcutaneous. Sb concentrations in the blood and organs were determined by inductively coupled plasma-mass spectrometry. In rats, as with in humans, the Sb blood levels after MA dosing can be described by a two-compartment model with a fast (t1/2 = 0.6 h and a slow (t1/2 >> 24 h elimination phase. The spleen was the organ that accumulated the highest amount of Sb, while bone and thyroid ranked second in descending order of tissues according to Sb levels (spleen >> bone, thyroid, kidneys > liver, epididymis, lungs, adrenals > prostate > thymus, pancreas, heart, small intestines > skeletal muscle, testes, stomach > brain. The pathophysiological consequences of Sb accumulation in the thyroid and Sb speciation in the liver, thyroid, spleen and bone warrant further studies.

  16. How can we adapt to geological scarcity of antimony? Investigation of antimony's substitutability and of other measures to achieve a sustainable use

    NARCIS (Netherlands)

    Henckens, M.L.C.M.; Driessen, P.P.J.; Worrell, E.

    2016-01-01

    Abstract Antimony is an element that is applied in many useful applications for mankind. However, antimony resources are very scarce, when comparing the current extraction rates with the availability of antimony containing ores. From an inter-temporal sustainability perspective, current generations

  17. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials

    International Nuclear Information System (INIS)

    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1 M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by L-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3σ) of the proposed method was 0.02 ng mL-1 for antimony(III), and the relative standard deviation was 7.8% (c = 1.0 ng mL-1, n = 7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results.

  18. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials.

    Science.gov (United States)

    Jiang, Xiuming; Wen, Shengping; Xiang, Guoqiang

    2010-03-15

    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by l-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3 sigma) of the proposed method was 0.02 ng mL(-1) for antimony(III), and the relative standard deviation was 7.8% (c=1.0 ng mL(-1), n=7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results. PMID:19853991

  19. Antimony distribution and environmental mobility at an historic antimony smelter site, New Zealand.

    Science.gov (United States)

    Wilson, N J; Craw, D; Hunter, K

    2004-05-01

    A historic antimony smelter site at Endeavour Inlet, New Zealand has smelter residues with up to 17 wt.% antimony. Residues include coarse tailings (cm scale particles, poorly sorted), sand tailings (well sorted) and smelter slag (blocks up to 30 cm across). All of this material has oxidised to some degree over the ca. 100 years since the site was abandoned. Oxidation has resulted in acidification of the residues down to pH 2-5. Smelter slag contains pyrrhotite (FeS) and metallic antimony, and oxidation is restricted to surfaces only. The coarse tailings are the most oxidised, and few sulfide grains persist. Unoxidised sand tailings contain 10-20 vol.% stibnite (Sb2S3) containing up to 5% As, with subordinate arsenopyrite (FeAsS), and minor pyrite (FeS2). The sand tailings are variably oxidised on a scale of 2-10 cm, but original depositional layering is preserved during oxidation and formation of senarmontite (Sb2O3). Oxidation of sand tailings has resulted in localised mobility of both Sb and As on the cm scale, resulting in redistribution of these metalloids with iron oxyhydroxide around sand grain boundaries. Experiments demonstrate that Sb mobility decreases with time on a scale of days. Attenuation of both As and Sb occurs due to adsorption on to iron oxyhydroxides which are formed during oxidation of the smelter residues. There is no detectable loss of Sb or As from the smelter site into the adjacent river, <50 m away, which has elevated Sb (ca. 20 microg/l) and As (ca. 7 microg/l) from mineralised rocks upstream. Despite the high concentrations of Sb and As in the smelter residues, these metalloids are not being released into the environment. PMID:14987811

  20. Heat-treated Saccharomyces cerevisiae for antimony speciation and antimony(III) preconcentration in water samples

    International Nuclear Information System (INIS)

    An analytical method was developed for antimony speciation and antimony(III) preconcentration in water samples. The method is based on the selective retention of Sb(III) by modified Saccharomyces cerevisiae in the presence of Sb(V). Heat, caustic and solvent pretreatments of the biomass were investigated to improve the kinetics and thermodynamics of Sb(III) uptake process at room temperature. Heating for 30 min at 80 deg. C was defined as the optimal treatment. Antimony accumulation by the cells was independent of pH (5-10) and ionic strength (0.01-0.1 mol L-1). 140 mg of yeast and 2 h of contact were necessary to ensure quantitative sequestration of Sb(III) up to 750 μg L-1. In these conditions, Sb(V) was not retained. Sb(V) was quantified in sorption supernatant by inductively coupled plasma mass spectrometry (ICP-MS) or inductively coupled plasma optical emission spectrometry (ICP-OES). Sb(III) was determined after elution with 40 mmol L-1 thioglycolic acid at pH 10. A preconcentration factor close to nine was achieved for Sb(III) when 100 mL of sample was processed. After preconcentration, the detection limits for Sb(III) and Sb(V) were 2 and 5 ng L-1, respectively, using ICP-MS, 7 and 0.9 μg L-1 using ICP-OES. The proposed method was successfully applied to the determination of Sb(III) and Sb(V) in spiked river and mineral water samples. The relative standard deviations (n = 3) were in the 2-5% range at the tenth μg L-1 level and less than 10% at the lowest Sb(III) and Sb(V) tested concentration (0.1 μg L-1). Corrected recoveries were in all cases close to 100%

  1. Characterization of Antimony exchanged Hydrous Zirconium oxide

    International Nuclear Information System (INIS)

    Pentavalent 125Sb bearing species are persistent even after chemical treatment in low level liquid waste effluents. It was found that Hydrous Zirconium Oxide (HZO) had an efficiency better that 80% for Sb pick in a wide pH range of 1-13 for concentrations up to 150 mg/l. HZO coated on poly urethane foam was used in WMD Trombay for removal for 125Sb from waste effluent. The exchange capacity of HZO with 40% moisture content ranged between 0.7-0.9 meq/g for removal of Sb(V). In order to understand the mechanism of Sb uptake by HZO, freshly prepared HZO exchanged with trivalent and pentavalent Sb from aqueous solutions was characterized with FTIR and XRD. The FTIR analysis confirmed presence of surface hydroxyl groups. Sb exchanged HZO samples showed modification in characteristic frequencies of -OH group when compared with unexchanged HZO. The broadening of -OH stretching frequency at 3400 cm-1 in Sb exchanged HZO-B indicated of ingress of disorderliness or weakening of -OH bond. The spectral shift was towards lower frequencies indicating clustering of low frequency bonds around -OH groups and weakening of -O-H bond. This change in -OH profile shows it to be the site of exchange/sorption. The XRD analysis showed HZO to be amorphous. Both pentavalent and trivalent antimony was exchanged with HZO, heat treated at 600℃ and analysed with XRD. Hydrous Zirconium Oxide (Heated up to 600℃) had an X-Ray diffraction pattern identical to Aldrich make pure Zirconia (Monoclinic) (PCPDF-371484). Pentavalent Sb loaded HZO and trivalent Sb loaded HZO showed different crystalline structures on heat treatment. Sb(V) loaded HZO shows Orthorhombic structure (PCCPDF-371413) and Sb(III) exchanged Zirconia shows tetragonal structure (PCPDF-501089). Cubic Sb2O5 antimony oxide crystals were also detected in the sample. From the above analysis it could be understood that the surface hydroxyl group helped in sorption of Sb species. But this was not purely surface phenomenon. Sb after

  2. Noninferiority of Miltefosine Versus Meglumine Antimoniate for Cutaneous Leishmaniasis in Children

    OpenAIRE

    Rubiano, Luisa Consuelo; Miranda, María Consuelo; Muvdi Arenas, Sandra; Montero, Luz Mery; Rodríguez-Barraquer, Isabel; Garcerant, Daniel; Prager, Martín; Osorio, Lyda; Rojas, Maria Ximena; Pérez, Mauricio; Nicholls, Ruben Santiago; Gore Saravia, Nancy

    2012-01-01

    Background. Children have a lower response rate to antimonial drugs and higher elimination rate of antimony (Sb) than adults. Oral miltefosine has not been evaluated for pediatric cutaneous leishmaniasis.

  3. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb+ ions to a fluence of 5 x 1020 ions/m2, thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  4. Recovery of antimony-125 from tin-124 irradiated by neutrons

    International Nuclear Information System (INIS)

    Currently, antimony-125 is produced by recovery from tin-124 irradiated by neutrons in nuclear reactors. The radionuclide builds up following the pathway: Sn-124 (n,γ) → Sn-125 (β-) (9.6 days) → Sb-125 ((β-) (2.77 years) The cross-section of the (n,γ) reaction is low (0.2 barn), therefore tin metal enriched with tin-124 is used. It should be noted that the use of an enriched target decreases the build-up of other radionuclides as compared to the natural mixture of tin isotopes. Published data showed that ion exchange on anion exchangers is one of the most promising procedures of recovery of antimony-125 from irradiated tin-124. We irradiated tin metal enriched with tin-124 (approximately 96%). After cooling and storage, the specific activity was 5 μCi per g of metal. The irradiated sample was dissolved in concentrated hydrochloric acid containing hydrogen peroxide or bromine in order to convert tin to the tetravalent state and antimony to the pentavalent state. We used tin-119m as a mark for an express gamma-spectrometric determination of the distribution coefficients. We studied the separation of Sb-125 and tin on strongly basic (Dowex-50 and AV-17), moderately basic (AN-2FN), and weakly basic (AN-31) ion exchangers. Hydrochloric acid, a mixture of hydrochloric and hydrobromic acids, and nitric acid were used as the elutriating agents. The samples from chromatography were subjected to gamma-spectrometric analysis using Si(Li) and Ge(Li) semiconductor detectors. In experiments examining the separation on strongly basic anion exchangers, the attained decontamination factor for removal of tin from antimony-125 was approximately 104-105 in one cycle. In the experiments devoted to the separation on moderately basic and weakly basic anion exchangers, tin was eluted before antimony-125. This should improve reasonably the regeneration of the enriched tin samples. The most interesting and significant results were obtained in the study of separation of antimony-125

  5. Oral Delivery of Meglumine Antimoniate-β-Cyclodextrin Complex for Treatment of Leishmaniasis

    OpenAIRE

    Demicheli, Cynthia; Ochoa, Rosemary; da Silva, José B. B.; Falcão, Camila A. B.; Rossi-Bergmann, Bartira; Melo, Alan L.; Sinisterra, Ruben D.; Frézard, Frédéric

    2004-01-01

    The need for daily parenteral administration represents one of the most serious limitations in the clinical use of pentavalent antimonials against leishmaniasis. In this work, we investigated the ability of β-cyclodextrin to enhance the oral absorption of antimony and to promote the oral efficacy of meglumine antimoniate against experimental cutaneous leishmaniasis. The occurrence of interactions between β-cyclodextrin and meglumine antimoniate was demonstrated through the changes induced in ...

  6. The influence of pet containers on antimony concentration in bottled drinking water

    OpenAIRE

    Perić-Grujić Aleksandra A.; Radmanovac Aleksandar R.; Stojanov Aleksander M.; Pocajt Viktor V.; Ristić Mirjana Đ.

    2010-01-01

    Antimony trioxide (Sb2O3) is the most frequently used catalyst in the polyethylene terephthalate (PET) manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potent...

  7. The influence of pet containers on antimony concentration in bottled drinking water

    Directory of Open Access Journals (Sweden)

    Perić-Grujić Aleksandra A.

    2010-01-01

    Full Text Available Antimony trioxide (Sb2O3 is the most frequently used catalyst in the polyethylene terephthalate (PET manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potentially toxic trace element. In this paper, the antimony content in nine brands of bottled mineral and spring water from Serbia, and seven brands of bottled mineral and spring water from EU countries was analyzed. The measurements were conducted using the inductively coupled plasma-mass spectrometry (ICP-MS technique. In the all examined samples the antimony concentration was bellow the maximum contaminant level of 5 μg/L prescribed by the Serbian and EU regulations. Comparison of the content of antimony in PET bottled waters with the content of antimony in water bottled commercially in glass and the natural content of antimony in pristine groundwaters, provides explicit evidence of antimony leaching from PET containers. Since waters bottled in PET have much greater concentration ratio of Sb to Pb than corresponding pristine groundwaters, it can be assumed that bottled waters cannot be used as the relavant source for the study of the natural antimony content in groundwaters. There is a clear relation between the quality of water in bottles (composition, ion strength and antimony leaching rate. Moreover, while the rate of antimony leaching is slow at temperatures below 60 oC, at the temperature range of 60-80 oC antimony release occurs and reaches maximum contaminant level rapidly. As antimony can cause both acute and chronic health problems, factors that promote the increase of antimony concentration should be avoided.

  8. Antimony Doped Tin Oxide Thin Films: Co Gas Sensor

    Directory of Open Access Journals (Sweden)

    P.S. Joshi

    2011-01-01

    Full Text Available Tin dioxide (SnO2 serves as an important base material in a variety of resistive type gas sensors. The widespread applicability of this semicoducting oxide is related both to its range of conductance variability and to the fact that it responds to both oxidising and reducing gases. The antimony doped tin-oxide films were prepared by spray pyrolysis method. The as-deposited films are blackish in colour. Addition of antimony impurity showed little increase in the thickness. The X-ray diffraction pattern shows characteristic tin oxide peaks with tetragonal structure. As the doping concentration of antimony was increased, new peak corresponding to Sb was observed. The intensity of this peak found to be increased when the Sb concentration was increased from 0.01 % to the 1 % which indicates the antimony was incorporated into the tin oxide. For gas sensing studies ohmic contacts were preferred to ensure the changes in resistance of sensor is due to only adsorption of gas molecule. The graph of I-V shows a straight line in nature which indicates the ohmic contact. The sensitivity of the sensor for CO gas was tested. The sensitivity of antimony doped tin oxide found to be increased with increasing Sb concentration. The maximum sensitivity was observed for Sb = 1 % at a working temperature of 250 °C.

  9. Behavior of arsenic impurity at antimony electric precipitation

    International Nuclear Information System (INIS)

    In the paper the arsenic impurity electrochemical behavior and it purification from antimony by electric precipitation out of fluoride solutions was studied. For this the arsenic sample with mass 0.003-0.006 g has been irradiated at the WWR-SM nuclear reactor during 3-5 hour in the thermal neutron flux 1013 n/cm2 s, after 24 h keeping the sample has being dissolved in the concentrated nitric acid, and then it has been evaporated several times with distillation water addition up to wet precipitation state. It is shown, that arsenic impurity behavior character in the antimony electric precipitation out to fluoride electrolyte depends on the electrolyte content, electrolysis conditions, arsenic valency state in arsenic impurity existence in the five-valency state its joint electric reduction with antimony is practically not observing. In the case the arsenic being in three-valency state, it joint electric reduction with antimony is taking place. In this time the electrolytic antimony contents arsenic impurities less in dozen time than initial material

  10. Antimony Resistance in Leishmania, Focusing on Experimental Research

    Directory of Open Access Journals (Sweden)

    Fakhri Jeddi

    2011-01-01

    Full Text Available Leishmaniases are parasitic diseases that spread in many countries with a prevalence of 12 million cases. There are few available treatments and antimonials are still of major importance in the therapeutic strategies used in most endemic regions. However, resistance toward these compounds has recently emerged in areas where the replacement of these drugs is mainly limited by the cost of alternative molecules. In this paper, we reviewed the studies carried out on antimonial resistance in Leishmania. Several common limitations of these works are presented before prevalent approaches to evidence antimonial resistance are related. Afterwards, phenotypic determination of resistance is described, then confronted to clinical outcome. Finally, we detail molecular mechanisms and targets involved in resistance and already identified in vitro within selected mutant strains or in clinical isolates.

  11. Lattice dynamics of femtosecond laser-excited antimony

    Science.gov (United States)

    Abdel-Fattah, Mahmoud Hanafy; Bugayev, Aleksey; Elsayed-Ali, Hani E.

    2016-07-01

    Ultrafast electron diffraction is used to probe the lattice dynamics of femtosecond laser-excited antimony thin film. The temporal hierarchies of the intensity and position of diffraction orders are monitored. The femtosecond laser excitation of antimony film was found to lead to initial compression after the laser pulse, which gives way to tension vibrating at new equilibrium displacement. A damped harmonic oscillator model, in which the hot electron-blast force contributes to the driving force of oscillations in lattice spacing, is used to interpret the data. The electron-phonon energy-exchange rate and the electronic Grüneisen parameter were obtained.

  12. Self-standing nanoribbons of antimony selenide and antimony sulfide with well-defined size and band gap

    Energy Technology Data Exchange (ETDEWEB)

    Vadapoo, Rajasekarakumar; Krishnan, Sridevi; Yilmaz, Hulusi [Department of Physics, University of Puerto Rico, San Juan, PR 00936 (Puerto Rico); Marin, Carlos [Institute for Functional Nanomaterials, University of Puerto Rico, San Juan, PR 00936 (United States)

    2011-04-29

    Sub-10 nm semiconducting nanostructures are crucial for the realization of nanoscale devices. Fabrication of nanostructures at this scale with homogeneous properties is challenging. Using ab initio calculations, we show that self-standing ribbons of antimony selenide and antimony sulfide of width 1.1 nm exhibit well-defined bandgaps of 1.66 and 2.16 eV, respectively. Molecular dynamics studies show that these ribbons are stable at 500 K. The one-dimensional (1D) heterostructure of these nanoribbons (Sb{sub 2}Se{sub 3}/Sb{sub 2}S{sub 3}) along the [001] direction shows a straddling type behavior.

  13. Selective oxidation of propene on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony

    International Nuclear Information System (INIS)

    Propene + 1802 reactions have been studied in a static reaction system on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony. The [160] acrolein content of the total acrolein formed and the proportion of 160 in the oxygen of the carbon dioxide by-product have been determined. The results indicate that for each catalyst the lattice is the only direct source of the oxygen in the aldehyde, and that lattice and/or gas phase oxygen is used in carbon dioxide formation. Oxygen anion mobility appears to be greater in the molybdate catalyst than in the other two. (author)

  14. Suicide with cesium 137

    International Nuclear Information System (INIS)

    Report on first case of suicide with radioactive substance in Bulgaria is given. A defectoscopist with cyclothymic structure of character and psychotraumatic family environment made a second and successful attempt at suicide, this time by means of external irradiation with 137Cs with an activity of 5.3 C in the course of two hours. He irradiated his heart region and the first three fingers of his right hand. A grave picture of acute, local irradiation injury lasting four months with lethal outcome. The authors treat the psychological motives in the behaviour of these suicides and the reasons which determine the small number of suicide carried out with radioactive substance. (author)

  15. Antimony to Cure Visceral Leishmaniasis Unresponsive to Liposomal Amphotericin B

    Science.gov (United States)

    Morizot, Gloria; Jouffroy, Romain; Faye, Albert; Chabert, Paul; Belhouari, Katia; Calin, Ruxandra; Charlier, Caroline; Miailhes, Patrick; Siriez, Jean-Yves; Mouri, Oussama; Yera, Hélène; Gilquin, Jacques; Tubiana, Roland; Lanternier, Fanny; Mamzer, Marie-France; Legendre, Christophe; Peyramond, Dominique; Caumes, Eric; Lortholary, Olivier; Buffet, Pierre

    2016-01-01

    We report on 4 patients (1 immunocompetent, 3 immunosuppressed) in whom visceral leishmaniasis had become unresponsive to (or had relapsed after) treatment with appropriate doses of liposomal amphotericin B. Under close follow-up, full courses of pentavalent antimony were administered without life-threatening adverse events and resulted in rapid and sustained clinical and parasitological cure. PMID:26735920

  16. Vapor pressures of dimethylcadmium, trimethylbismuth, and tris(dimethylamino)antimony

    Czech Academy of Sciences Publication Activity Database

    Morávek, Pavel; Fulem, Michal; Pangrác, Jiří; Hulicius, Eduard; Růžička, K.

    2013-01-01

    Roč. 360, Dec (2013), s. 106-110. ISSN 0378-3812 R&D Projects: GA ČR GA13-15286S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : vapor pressure * dimethylcadmium * trimethylbismuth * tris(dimethylamino)antimony * sublimation and vaporization enthalpy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.241, year: 2013

  17. Discovery of palladium, antimony, tellurium, iodine, and xenon isotopes

    OpenAIRE

    Kathawa, J.; Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-eight palladium, thirty-eight antimony, thirty-nine tellurium, thirty-eight iodine, and forty xenon isotopes have been observed and the discovery of these isotopes is discussed here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented.

  18. Vacuum distillation of antimony-mercury gold containing concentrates

    International Nuclear Information System (INIS)

    Results of researches on vacuum distillation of mercury from gold containing antimony-mercury concentrates are considered in this article. It is shown that at vacuum of 20-50 mm Hg and temperature 300 deg C mercury is sublimated and gold remain in a cinder. (author)

  19. Antimony content of macrofungi from clean and polluted areas

    Czech Academy of Sciences Publication Activity Database

    Borovička, J.; Řanda, Zdeněk; Jelínek, E.

    2006-01-01

    Roč. 64, č. 11 (2006), s. 1837-1844. ISSN 0045-6535 Institutional research plan: CEZ:AV0Z10480505 Keywords : mushrooms * antimony pollution * bioaccumulation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.442, year: 2006

  20. Antimony and arsenic biogeochemistry in the East China Sea

    Science.gov (United States)

    Ren, Jing-Ling; Zhang, Xu-Zhou; Sun, You-Xu; Liu, Su-Mei; Huang, Daji; Zhang, Jing

    2016-02-01

    The biogeochemical cycles of the metalloid elements arsenic and antimony in the East China Sea (ECS), one of the most important marginal seas for western Pacific, were examined in May 2011. Dissolved inorganic arsenic (As(V) and As(III)) and antimony (Sb(V) and Sb(III)) species were determined by selective hydride generation-atomic fluorescence spectrometry (HG-AFS). Results show that total dissolved inorganic arsenic (TDIAs; [TDIAs]=[As(V)]+[As(III)]) were moderately depleted in the surface water and enriched in the deep water. Arsenite (As(III)) showed different vertical profiles with that of TDIAs, with significant surface enrichment in the middle shelf region where the concentrations of phosphate were extremely low. Speciation of dissolved arsenic was subtly controlled by the stoichiometric molar ratio of arsenate (As(V)) to phosphate. The average As(V)/P ratio for the ECS in spring 2011 was 10.8×10-3, which is higher than previous results and indicates the arsenate stress. The concentrations of total dissolved inorganic antimony (TDISb; [TDISb]=[Sb(V)]+[Sb(III)]) were high near the Changjiang Estuary and the coastal area of Hangzhou Bay and decreased moderately off the coast. TDISb displayed moderate conservative behavior in the ECS that confirms by the correlations with salinity and dissolved aluminum. Different with that of As(III), antimonite (Sb(III)) concentrations were extremely lower in the ECS, with relative higher concentration appeared at the bottom layer which indicates the contribution from sediment-water interface. A preliminary box model was established to estimate the water-mass balance and antimony budgets for the ECS. Compared with other areas in the world, the concentrations of dissolved inorganic arsenic and antimony in the ECS remain at natural levels.

  1. The determination of the thermodynamic activity of antimony in alpha-iron

    International Nuclear Information System (INIS)

    In this paper a method is suggested for determining the thermodynamic activity of antimony dissolved in alpha-iron, based on the study of antimony distribution between the two phases: liquid lead and solid iron. By this method, it was found that solid solutions of antimony in alpha-iron can be distinguished by positive divergences from the ideal state. Over a fairly wide range of concentrations, solutions of antimony in iron obey Henry's law. Special experiments on the distribution of antimony between lead and liquid iron showed that in the liquid state also the iron-antimony system is marked by positive divergences from the ideal state when small concentrations of antimony are present. The heat required for the solution of antimony in alpha-iron, and the excess partial molar entropy, were calculated from the activity temperature. The results were used for accurately locating the line showing the solubility limit of antimony in alpha-iron. Since alloys of antimony with iron were obtained by diffusion saturation and not by cooling from the liquid state, there was no liquefaction. Thus the lattice constant of the alloys and its relation to the alloy concentration could be reliably determined. The solubility limit established from X-ray data agrees with that obtained with Sb124. (author)

  2. Decorporation of cesium-137; Decorporation du cesium-137

    Energy Technology Data Exchange (ETDEWEB)

    Le Fleche, Ph.; Destombe, C.; Grasseau, A.; Mathieu, J.; Chancerelle, Y.; Mestries, J.C. [GMR, Direction des Recherches, Etudes et Techniques, 94 - Arcueil (France)

    1997-12-31

    Cesium radio-isotopes, especially cesium-137 ({sup 137}Cs) are among the radionuclides of main importance produced by a fission reaction in reactor or a nuclear weapon explosion. In the environment, {sup 137}Cs is a major contaminant which can cause severe {beta}, {gamma}irradiations and contaminations. {sup 137}Cs is distributed widely and relatively uniformly throughout the body with the highest concentration in skeletal muscles. A treatment becomes difficult afterwards. The purposes of this report are Firstly to compare the Prussian blue verses cobalt and potassium ferrocyanide (D.I. blue) efficiency for the {sup 137}Cs decorporation and secondly to assess a chronological treatment with D.I. blue. (author)

  3. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2005-10-01

    Full Text Available Pentavalent antimony, as meglumine antimoniate (Glucantime® or sodium stibogluconate (Pentostam® , is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology.Os antimoniais pentavalentes, como o antimoniato de meglumina (Glucantime® ou estibogluconato de sódio (Pentostam® , são o principal tratamento para a leishmaniose, um complexo de doenças causadas pelo protozoário parasita Leishmania, uma doença endêmica e negligenciada no Brasil. Apesar do seu uso clínico por mais de meio século, seu mecanismo de ação, toxicidade e dados de farmacocinética permanecem desconhecidos. Os métodos analíticos para determinação de antimônio em sistemas biológicos são complexos e apresentam baixa sensibilidade. Estudos utilizando radiotraçadores têm papel potencial no desenvolvimento farmacológico. O objetivo deste estudo foi desenvolver um radiotraçador de antimônio, com propriedades físicas e biológicas adequadas. O antimoniato de meglumina foi irradiado por nêutrons no reator nuclear IEA-R1, produzindo dois radioisótopos: 122

  4. States of antimony and tin atoms in lead chalcogenides

    International Nuclear Information System (INIS)

    It is shown by Mössbauer spectroscopy of the 119Sb(119mSn) isotope that impurity antimony atoms in PbS, PbSe, and PbTe lattices are distributed between cation and anion sublattices. In n-type samples, the greatest part of antimony is located in the anion sublattice; in hole ones, in the cation sublattice. The tin atoms formed as a result of radioactive decay of 119Sb (antisite state) are electrically inactive in the anion sub-lattice of PbS and PbSe, while, in the cation sublattice, they form donor U− centers. Electron exchange between the neutral and doubly ionized tin U− centers via the allowed band states is observed. The tin atoms formed after radioactive decay of 119Sb are electrically inactive in the anion and cation sublattices of PbTe.

  5. Resistance to Arsenic- and Antimony-Based Drugs

    OpenAIRE

    Milena Salerno; Arlette Garnier-Suillerot

    2003-01-01

    Organic arsenicals were the first antimicrobial agents specifically synthesized for the treatment of infectious diseases such as syphilis and sleeping sickness. For the treatment of diseases caused by trypanosomatid parasites, organic derivatives of arsenic and the related metalloid antimony are still the drugs of choice. Arsenic trioxide, As203, has been used for a long time in traditional Chinese medicines for treatment of various diseases, and it has recently been shown to be clinically ac...

  6. Crystallization of antimony orthotantalate and its physical properties

    International Nuclear Information System (INIS)

    Physicochemical conditions of monophase synthesis of antimony orthoniobate monocrystals in the system SbO3-Ta2O5-KHF2-H2O2-H2O were investigated. In the area of monophase synthesis of SbTaO4 monocrystals kinetic studies of its growth conditions for inoculation, depending on solvent concentration, temperature, pyroelectric properties of the monocrystal grown were studied and conclusion was made on their practical use

  7. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Hernandez-Garcia, C. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA

    2015-06-01

    CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  8. Correlation of CsK{sub 2}Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A., E-mail: mmamu001@odu.edu; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529 (United States); The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States); Hernandez-Garcia, C.; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States)

    2015-06-01

    CsK{sub 2}Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  9. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Directory of Open Access Journals (Sweden)

    M. A. Mamun

    2015-06-01

    Full Text Available CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  10. Removal of lead from crude antimony by using NaPo3 as lead elimination reagent

    OpenAIRE

    Ye L.G.; Tang C.B.; Yang S.H.; Chen Y.M.; Zhang W.H.

    2015-01-01

    In order to solve the shortcomings when removing lead from crude antimony in the traditional antimony smelting, a new process was provided using NaPO3 as lead elimination reagent to yield phosphate slag, and it was removed by floating on the surface of the liquid antimony. Reaction mechanism was clarified by using the TG-DTA and XRD techniques and single factor experiments of removal lead from crude antimony were engaged. The results show that PbO and NaPO3...

  11. Suicide with 137 cesium

    International Nuclear Information System (INIS)

    A case report is presented of suicide by radiation exposure after a preceding attempt with potassium ferrocyanide. The subject, a 30-year-old nondestructive-testing technician, held with his right fingers and then placed in his left shirt pocket a metal-canned 5,3-Ci 137Cs source. Despite appearance of signs of severe topical injury by day 3 after the incident and development of systemic toxicity symptoms with indications of affection of internal organs by day 16, medical aid was not sought until day 21 when efforts at management proved unable to prevent fatal outcome. A prominent distinguishing characteristic of this mode of suicide is that the deed's sequelae are delayed in coming into effect. Cases known to have occurred are extremely rare (only two have been described in the literature). This is likely to be related to a distinct unpopularity of radioactive materials as well as their limited availability to the general public. The subjects that did use them were radiation workers having access to such substances; being acquainted with the biological effects of radiation, they, nevertheless, have chosen this protracted and distressful way of taking their lives. (A.B.)

  12. Standardization of 137 Cs+137m Ba by Liquid Scintillation

    International Nuclear Information System (INIS)

    A procedure for the preparation of a stable, homogeneous solution of ''137 Cs+''137m Ba, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51% (k=1)

  13. Recent advances on antimony(III/V) compounds with potential activity against tumor cells.

    Science.gov (United States)

    Hadjikakou, S K; Ozturk, I I; Banti, C N; Kourkoumelis, N; Hadjiliadis, N

    2015-12-01

    Antimony one of the heavier pnictogens, has been in medical use against microbes and parasites as well. Antimony-based drugs have been prescribed against leishmaniasis since the parasitic transmission of the tropical disease was understood in the beginning of the 20th century. The activity of arsenic against visceral leishmaniasis led to the synthesis of an array of arsenic-containing parasitic agents, among them the less toxic pentavalent antimonials: Stibosan, Neostibosan, and Ureastibamine. Other antimony drugs followed: sodium stibogluconate (Pentostam) and melglumine antimoniate (Glucantim or Glucantime); both continue to be in use today despite their toxic side effects and increasing loss in potency due to the growing resistance of the parasite against antimony. Antimony compounds and their therapeutic potentials are under consideration from many research groups, while a number of early reviews recording advances of antimony biomedical applications are also available. However, there are only few reports on the screening for antitumor potential of antimony compounds. This review focuses upon results obtained on the anti-proliferative activity of antimony compounds in the past years. This survey shows that antimony(III/V) complexes containing various types of ligands such as thiones, thiosemicarbazones, dithiocarbamates, carboxylic acids, or ketones, nitrogen donor ligands, exhibit selectivity against a variety of cancer cells. The role of the ligand type of the complex is elucidated within this review. The complexes and their biological activity are already reported elsewhere. However quantitative structure-activity relationship (QSAR) modeling studies have been carried out and they are reported for the first time here. PMID:26092367

  14. Complexation of HSA with different forms of antimony (Sb): An application of fluorescence spectroscopy

    International Nuclear Information System (INIS)

    Antimony (Sb) pollution has been of a great environmental concern in some areas in China. Sb enters human body via drinking water, inhalation and food chain, unavoidably interacts with human serum albumin (HSA) in blood plasma, and consequently does harm to human health. The harmful effects of Sb on human health depend on the Sb species and their binding ability to HSA. In the present study, binding of three forms of Sb with HSA was investigated by excitation-emission matrix (EEM) spectroscopy. All of antimony potassium tartrate, antimony trichloride and potassium pyroantimonate quenched fluorescence of HSA. Values of conditional stability constant Ka (×105/M) for Sb and HSA systems were 8.13–9.12 for antimony potassium tartrate, 2.51–4.27 for antimony trichloride and 3.63–9.77 for potassium pyroantimonate. The binding constant Kb (×104/M) values of HSA with antimony potassium tartrate, antimony trichloride and potassium pyroantimonate were 0.02–0.07, 3.55–5.01, and 0.07–1.08, respectively. There was one independent class of binding site for antimony trichloride towards HSA. There was more than one Sb binding site and negative cooperativity between multiple binding sites for potassium pyroantimonate and antimony potassium tartrate towards HSA. The binding ability of HSA to complex Sb followed the order: antimony trichloride>potassium pyroantimonate>antimony potassium tartrate. -- Highlights: ► The first study reporting interaction of Sb with HSA. ► Sb can effectively quench the fluorescence of HSA. ► The binding ability of HSA to Sb was dependent on the form of Sb. ► Binding differences indicate differences in toxicity of various forms Sb to human. ► HAS-Sb binding parameters are important for understanding toxicity of Sb

  15. Leishmania donovani isolates with antimony-resistant but not -sensitive phenotype inhibit sodium antimony gluconate-induced dendritic cell activation.

    Directory of Open Access Journals (Sweden)

    Arun Kumar Haldar

    2010-05-01

    Full Text Available The inability of sodium antimony gluconate (SAG-unresponsive kala-azar patients to clear Leishmania donovani (LD infection despite SAG therapy is partly due to an ill-defined immune-dysfunction. Since dendritic cells (DCs typically initiate anti-leishmanial immunity, a role for DCs in aberrant LD clearance was investigated. Accordingly, regulation of SAG-induced activation of murine DCs following infection with LD isolates exhibiting two distinct phenotypes such as antimony-resistant (Sb(RLD and antimony-sensitive (Sb(SLD was compared in vitro. Unlike Sb(SLD, infection of DCs with Sb(RLD induced more IL-10 production and inhibited SAG-induced secretion of proinflammatory cytokines, up-regulation of co-stimulatory molecules and leishmanicidal effects. Sb(RLD inhibited these effects of SAG by blocking activation of PI3K/AKT and NF-kappaB pathways. In contrast, Sb(SLD failed to block activation of SAG (20 microg/ml-induced PI3K/AKT pathway; which continued to stimulate NF-kappaB signaling, induce leishmanicidal effects and promote DC activation. Notably, prolonged incubation of DCs with Sb(SLD also inhibited SAG (20 microg/ml-induced activation of PI3K/AKT and NF-kappaB pathways and leishmanicidal effects, which was restored by increasing the dose of SAG to 40 microg/ml. In contrast, Sb(RLD inhibited these SAG-induced events regardless of duration of DC exposure to Sb(RLD or dose of SAG. Interestingly, the inhibitory effects of isogenic Sb(SLD expressing ATP-binding cassette (ABC transporter MRPA on SAG-induced leishmanicidal effects mimicked that of Sb(RLD to some extent, although antimony resistance in clinical LD isolates is known to be multifactorial. Furthermore, NF-kappaB was found to transcriptionally regulate expression of murine gammaglutamylcysteine synthetase heavy-chain (mgammaGCS(hc gene, presumably an important regulator of antimony resistance. Importantly, Sb(RLD but not Sb(SLD blocked SAG-induced mgammaGCS expression in DCs by

  16. Oxidation and mobilization of metallic antimony in aqueous systems with simulated groundwater

    Science.gov (United States)

    Ilgen, A. G.; Majs, F.; Barker, A. J.; Douglas, T. A.; Trainor, T. P.

    2014-05-01

    Antimony (Sb) is a contaminant of concern that can be present in elevated concentrations in shooting range soils due to mobilization from spent lead/antimony bullets. Antimony in shooting range soils has been observed as either metallic Sb(0) or as Sb(V) immobilized by iron (hydr)oxides. The absence of Sb(III) in soils is indicative of rapid Sb(III) oxidation to Sb(V) under surface soil conditions. However, the major controls on antimony oxidation and mobility are poorly understood. To better understand these controls we performed multiple batch experiments under oxic conditions to quantify the oxidation and dissolution of antimony in systems where Sb(0) is oxidized to Sb(III) and further to Sb(V). We also tested how variations in the aqueous matrix composition and the presence of metallic lead (Pb) affect the dissolution, solid phase speciation, and oxidation of antimony. We monitored changes in the aqueous antimony speciation using liquid chromatography inductively coupled plasma mass spectrometry (LC-ICP-MS). To test which solid phases form as a result of Sb(0) oxidation, and therefore potentially limit the mobility of antimony in our studied systems, we characterized the partially oxidized Sb(0) powders by means of extended X-ray absorption fine structure (EXAFS) spectroscopy and powder X-ray diffraction (XRD).

  17. Tin dioxide sol-gel derived films doped with platinum and antimony deposited on porous silicon

    NARCIS (Netherlands)

    Savaniu, C.; Arnautu, A.; Cobianu, C.; Craciun, G.; Flueraru, C.; Zaharescu, M.; Parlog, C.; Paszti, F.; Berg, van den A.

    1999-01-01

    SnO2 sol-gel derived thin films doped simultaneously with Pt and Sb are obtained and reported for the first time. The Sn sources were tin(IV) ethoxide or tin(II) ethylhexanoate, while hexachloroplatinic acid (H2PtCl6) and antimony chloride (SbCl3) were used as platinum and antimony sources, respecti

  18. Comparison of modification with strontium and the refining with antimony in A 356 aluminium alloys

    International Nuclear Information System (INIS)

    Strontium and Antimony treated A356 aluminium alloy samples were metallographically characterized in the as cast and solution and aged conditions. Antimony treated alloy has shown slower spheroidizing kinetics of the Silicon particles during solution treatment, lower porosity level and higher tensile strength and elongation than Strontium treated one. (author)

  19. Leishmania donovani: an in vitro study of antimony-resistant amphotericin B-sensitive isolates

    DEFF Research Database (Denmark)

    Sharief, Abdalla Hassan; Gasim Khalil, Eltahir Awad; Theander, Thor G;

    2006-01-01

    Drug sensitivity of clinically antimony-unresponsive Leishmania donovani isolates from Eastern Sudan was evaluated in an in vitro culture system against sodium stibogluconate (Pentostam) and Amphotericin B. Eight isolates, six from antimony-resistant and two from clinically responsive patients were...

  20. Waste treatment as applied to the problem of recovery of antimony-125

    International Nuclear Information System (INIS)

    In the report we present the average radionuclide and chemical composition of processing solutions in various stages of treatment of spent nuclear fuel. The behavior of antimony-125 during sorption from these solutions was studied. A series of oxide and phosphate compounds was used as sorbents. The best results on recovery of antimony were reached on silica gel. A necessary condition for prolonged high-cycle operation of silica gel in actual practice is its rather complete regeneration. In this connection, we studied completeness of antimony desorption from various sorbents. The best results were obtained with aqueous hydrochloric and oxalic acids. Our study showed the possibility of recovery of antimony-125 from spent nuclear fuel wastes by adsorption on silica gel from processing solutions with subsequent desorption of the target product. In the average the yield of antimony-125 is 85%. (authors)

  1. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    International Nuclear Information System (INIS)

    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103Ru, 134Cs and 124Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10-3 to 5.10-5% of the Ru fed, for Cs the corresponding release fraction ranges between 3.10-3 to 10-4% and for Sb the release fraction ranges between 1.7 10-4 to 1.7 10-5%. The same experiments were performed at a throughput of 1 to 2 1 h-1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103Ru and 134Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  2. 137Cs metabolism during pregnancy

    International Nuclear Information System (INIS)

    Data from two pregnant women contaminated with 137 Cs, body burdens of 0.2 and 300 MBq, respectively, at the time of the Goiania accident, were compared. The first one, with lower 137 Cs body burden was exposed during the fourth month of pregnancy, while the second became pregnant three years and eight months after 137 Cs intake. For the first woman 137 Cs concentrations were similar for the mother, infant and placenta, indicating an easy and homogeneous transport of 137 Cs from mother to fetus. The whole-body monitoring data from the second woman, who became pregnant four years after intake, did not show a reduction in biological half-life during the pregnancy. Cs concentration in the mother was found to be 13 times higher than in the infant. One possible reason for this result is that four after intake. Cs is supposed to be concentrated mainly in skeletal muscle tissue. During the pregnancy the blood flux becomes higher in most of organs and tissues except brain, liver and skeletal muscle tissue. In this case, the physiological changes due to pregnancy did not modify the cesium retention. (author)

  3. Metabolism of antimony-124 in lactating dairy cows

    International Nuclear Information System (INIS)

    Lactating cows received oral and intravenous administrations of radioactive antimony (III) chloride to study its intestinal and urinary excretion, secretion into milk and organ distribution. Milk samples were taken twice a day and the milk, feces and urine assayed using gamma spectroscopy. Cows administered orally were sacrificed at 102 days and those injected intravenously at 70 days. Distribution of 124 Sb in the organs was determined at the time of sacrifice. Excretion of 124Sb occurs mainly via urine, little is secreted into milk. Highest organ concentrations are in the spleen, liver and bone. (U.K.)

  4. Electrostatically defined silicon quantum dots with counted antimony donor implants

    Energy Technology Data Exchange (ETDEWEB)

    Singh, M., E-mail: msingh@sandia.gov; Luhman, D. R.; Lilly, M. P. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Integrated Nanotechnologies, Sandia National Laboratories, Albuquerque, New Mexico 87175 (United States); Pacheco, J. L.; Perry, D.; Garratt, E.; Ten Eyck, G.; Bishop, N. C.; Wendt, J. R.; Manginell, R. P.; Dominguez, J.; Pluym, T.; Bielejec, E.; Carroll, M. S. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)

    2016-02-08

    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants.

  5. Electrostatically defined silicon quantum dots with counted antimony donor implants

    International Nuclear Information System (INIS)

    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants

  6. Antimony implanted strained Si for nMOSFET applications

    OpenAIRE

    Zamani, Atieh

    2009-01-01

    Incorporation of implanted antimony (Sb) in strained-silicon (s-Si) formed on relaxed-SiGe virtual substrates (10 and 30% Ge) has been studied. The implantation doses were 5×1013- 5×1014 cm-2 with an energy of 20 keV. The activation of dopant was performed by an rapid thermal annealing (RTA) treatment at 700 and 800 °C for 30 sec. Projected range of this implantation is about 20 nm which was also confirmed by different techniques. The layers were analyzed in terms of strain relaxation, sheet ...

  7. Treatment of low-level radioactive cesium-137 and technetium-99 liquid wastes by inorganic ion-exchangers

    International Nuclear Information System (INIS)

    This study has been directed towards the testing and evaluation of selected inorganic ion-exchangers that are inexpensive and suitable for the conditioning and disposal of radioactive wastes. The experiments were based on sorption characteristics of inorganic ion-exchange materials and their ability to retain radionuclides. The sorption efficiency of cesium-137 and technetium-99 on exchangers was tested under various conditions including the effect of pH, equilibrium time, temperature and concentration for bentonite, kaolinite, sand and sandy soil, which are classified as natural inorganic exchangers. Titanium dioxide, zeolite, antimony pentioxide and hydrated antimony pentoxide (HAP) were used as synthetic inorganic exchangers. This report also includes a basic study of the cementation process along with the measurement of several important waste from properties such as physical stability, compressive strength and leachability. The percentage sorption efficiency of cesium-137 was found to be 99, 98, 88, 87, 86 and 85 respectively for zeolite, kaolinite, antimony pentoxide, sandy soil, sand and HAP, at 25-500C, pH range 3-9 and 10-20 minutes contact time. The sorption of technetium-99 on antimony pentoxide was 80-90, at 250 C, pH range 1-9 and 5 days contact time. The physical stability tests indicated that all specimens had good homogeneity. Percentages of weight-loss after 28 day cure times at ambient room temperature were in the range of 7-15, 2-6, 6-9, 3-10 and 4-5 for bentonite, kaolinite, zeolite, titanium dioxide and sand respectively. The compressive strength of conditioned waste form consisting of various simulated waste compositions are reported. For the purpose of this study, an arbitrary compressive strength value of 150 kgm/cm2 was established. The proper percentage composition of cemented wastes were 19, 24, 25, 45 and 54 for bentonite, kaolinite, zeolite, titanium dioxide and sand respectively. The leachability for kaolinite cemented waste containing

  8. Redistribution of cesium-137 in southeastern watersheds

    International Nuclear Information System (INIS)

    Sediment samples from 14 southeastern agricultural reservoirs and surface samples from representative soils from the contributing water shed areas were analyzed for 137Cs. The concentrations of 137Cs measured reflect the nature of the watershed, its cover, its use, and man's activities. Since the redistribution of 137Cs was assumed to result from soil erosion, recent erosion rates can be calculated from the measured 137Cs accumulations in sediments and from the decreases in the 137Cs calculated to have been deposited on upland soils. Measured concentrations of 137Cs ranged from 14 to 158 nCi/m2 in surface soils. As much as 525 nCi/m2 of 137Cs was measured in the deposited sediment profile. Watershed budgets for 137Cs were calculated for three representative watersheds using available sediment survey information and the measured 137Cs concentrations

  9. Solubility behaviour of antimony(III) and antimony(V) solids in basic aqueous solutions at 300{sup o}C

    Energy Technology Data Exchange (ETDEWEB)

    Lemire, R.J.; Tosello, N.B.; Halliday, J.D

    1999-12-01

    The major contributions of the isotopes {sup 122}Sb and {sup 124}Sb to activity transport in a CANDU reactor primary heat transport system (HTS), have been associated with oxygen ingress during reactor shutdown. As part of a program to minimize the release and redeposition of these isotopes, the solubilities of antimony(III) and (V) oxides and salts have been measured in basic solutions at temperatures from 25 to 300{sup o}C. The results provide information on the charge and the stability as a function of temperature of antimony solution species and, hence, a guide to the trends in the temperature dependence of the solubilities of antimony solids. In solutions in which oxidation of antimony(III) to antimony(V) is minimized, the solubility of Sb{sub 2}O{sub 3} increases by about two orders of magnitude between 25 and 200{sup o}C, and then levels out or decreases slightly. At 250{sup o}C, in oxidizing solutions, Sb{sub 2}O{sub 5}{center_dot}xH{sub 2}O and simple sodium antimonate(V) were found to be unstable in sodium hydroxide solutions with respect to the solid, Na{sub 2{alpha}}[H(H{sub 2}O)]{sub 2-2{alpha}}Sb{sub 2}O{sub 6}, which has a pyrochlore structure. The solubility of this partially protonated sodium antimonate increases from 25 to 200{sup o}C and decreases at temperatures above 250{sup o}C. These solubility changes for the antimony (V) solids reflect changes in the stability of the anionic antimony solution species (SbO{sub 3}{sup -} or Sb(OH){sub 6}{sup -}), even though the compositions of antimony-containing solids in basic oxidizing solutions are strongly dependent on the cations and their aqueous phase concentrations. All solids used in the present experiments would be expected to generate total solution antimony concentrations {>=} 0.00005 mol{center_dot}dm{sup -3} in any neutral or basic aqueous solutions (assuming no added sodium salts). Therefore, under HTS conditions, precipitation of any antimony oxides or mixed oxides is unlikely. It cannot be

  10. Thermal decomposition kinetics of antimony oxychloride in air

    Institute of Scientific and Technical Information of China (English)

    阳卫军; 唐谟堂; 金胜明

    2002-01-01

    The DTA and XRD techniques were employed to study thermal decomposition mechanism of antimony oxychloride SbOCl in the air. The thermal decomposition reaction occurs in four steps, and the former three steps as: SbOCl(s)→Sb4O5Cl2(s)+SbCl3(g)→Sb8O11Cl2(s)+SbCl3(g)→Sb2O3(s)+SbCl3(g). The forth step is the oxidation of Sb2O3 by air, Sb2O3(s)+O2→Sb2O4(s). The activation energy and the order of the thermal decomposition reaction of antimony oxychloride in three steps presented in DTA curves were calculated according to Kinssinger methods from DTA curves. The values of activation energy and the order are respectively 91.97kJ/mol, 0.73 in the first step, 131.14kJ/mol, 0.63 in the second step and 146.94kJ/mol, 1.58 in the third step.

  11. Alkali oxide-tantalum, niobium and antimony oxide ionic conductors

    Science.gov (United States)

    Roth, R. S.; Brower, W. S.; Parker, H. S.; Minor, D. B.; Waring, J. L.

    1975-01-01

    The phase equilibrium relations of four systems were investigated in detail. These consisted of sodium and potassium antimonates with antimony oxide and tantalum and niobium oxide with rubidium oxide as far as the ratio 4Rb2O:llB2O5 (B=Nb, Ta). The ternary system NaSbO3-Sb2O4-NaF was investigated extensively to determine the actual composition of the body centered cubic sodium antimonate. Various other binary and ternary oxide systems involving alkali oxides were examined in lesser detail. The phases synthesized were screened by ion exchange methods to determine mobility of the mobility of the alkali ion within the niobium, tantalum or antimony oxide (fluoride) structural framework. Five structure types warranted further investigation; these structure types are (1) hexagonal tungsten bronze (HTB), (2) pyrochlore, (3) the hybrid HTB-pyrochlore hexagonal ordered phases, (4) body centered cubic antimonates and (5) 2K2O:3Nb2O5. Although all of these phases exhibit good ion exchange properties only the pyrochlore was prepared with Na(+) ions as an equilibrium phase and as a low porosity ceramic. Sb(+3) in the channel interferes with ionic conductivity in this case, although relatively good ionic conductivity was found for the metastable Na(+) ion exchanged analogs of RbTa2O5F and KTaWO6 pyrochlore phases.

  12. Antimony removal from the polyethylene terephthalate manufacture wastewater

    Directory of Open Access Journals (Sweden)

    Tomas Vengris

    2010-04-01

    Full Text Available In this study, antimony removal by coagulation from polyethylene terephthalate resin production wastewater of „Orion Global PET“ factory in Klaipėda city was investigated, with regard to the dependence of coagulant type and dosage, pH and presence of organics. FeCl3 ∙6H2O, FeSO4 ∙7H2O, AlCl3∙6H2O and TiCl4 salts were used as coagulants. Ti(IV and Fe(III revealed oneself to be the most effective coagulants. Antimony removal effectiveness is moderate and low using FeSO4 ∙7H2O and AlCl3∙6H2O coagulants, respectively. The addition of 10 mg dm-3 Ti(IV and 30 mg dm-3 Fe(III reduces by ~98% of the Sb, when the initial amount of Sb in wastewater is about 1200 mkg/l. The action of Fe(III is practically independent in the pH range 4-9, and that of Ti(IV slightly decreases in the same pH interval. The Sb amount in wastewater can be reduced to 13-20 mkg dm-3, while the initial Sb concentration is 1200 mkg dm-3. The presence of organic compounds in wastewater determines the reduction of Sb removal by coagulation.

  13. Antimony contamination and its effect on Trifolium plants

    Science.gov (United States)

    Corrales, Isabel; Barceló, Juan; Bech, Jaume; Poschenrieder, Charlotte

    2014-05-01

    Antimony is not an essential element and soil Sb contents usually are low.However, soil contamination by Sb has increased in the last years due to the human activities (combustion of fossil fuels, mining, waste incineration, smelting, shooting and road traffic). The main objective of this work was to study the effect of different concentrations of antimony (KSb(OH)6) in order to evaluate the effect on growth and Sb uptake on Trifolium pratense cv. Milvus and Trifolium repens. Our results show that Sb accumulated both in roots and shoots of clover without any negative effect on root growth, cellular viability and lipid peroxidation. This absence of toxicity sympthoms in clover plants could be very dangerous because Sb can be inadvertedly incorporated into the trophic chain causing toxic effects both in animals and humans. The absence of toxic effects on plants does not seem to be due to detoxification by phytochelatins because the use of the gamma-glutamylcysteine synthetase inhibitor, L-buthionine-[S,R]-sulphoximine (BSO) did not enhance Sb toxicity to plants. (Supported by the Spanish MICINN project BFU2010-14873)

  14. Segregation of antimony in InP in MOVPE

    Energy Technology Data Exchange (ETDEWEB)

    Weeke, Stefan

    2008-07-01

    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  15. Leaching Mechanism of Complicated Antimony-Lead Concentrate and Sulfur Formation in Slurry Electrolysis

    Institute of Scientific and Technical Information of China (English)

    WangChengyan; QiuDingfan; JiangPeihai

    2004-01-01

    Anodic reaction mechanism of complicated antimony-lead concentrate in slurry electrolysis was investigated by the anodic polarization curves determined under various conditions. The main reactions on the anode are the oxidations of FeCln(2-n) . Though the oxidation of jamesonite particle on the anode can occur during the whole process, it is less. With the help of mineralogy studies and relevant tests, the leaching reaction mechanism of jameson[to and gudmundite during slurry electrolysis was ascertained. Because of the oxidation reaction of FeCl3 produced by antimony-lead concentrate itself, the non-oxidation complex acid dissolution of jameson[re, the oxidation complex acid dissolution of gudmundite, and the oxidation of air carried by stirring, the leaching ratio of antimony reaches about 35% when HCl-NH4Cl solution is used to leach antimony-lead concentrate directly. So when the theoretical electric quantity is given to oxidation of antimony in slurry electrolysis, all of antimony, lead and iron containing in antimony-lead concentrate, are leached. The formation of sulfur is through the directly redox reaction of Fe3+ and jameson[re. The S2- in jamesonite is oxidized into S0 , and forms the crystals of sulfur again on the spot. The redox reaction of Fe3+ and H2S formed by non-oxidative acid dissolution of jamesonite is less.

  16. Behaviour of antimony during thermal treatment of Sb-rich halogenated waste

    International Nuclear Information System (INIS)

    Antimony compounds have a wide range of industrial applications, particularly as additives in flame retardants. To ensure environmentally friendly waste incineration of Sb-rich wastes, it is essential to strengthen the knowledge about the fate of antimony and the potential formation of harmful species. Investigations should be conducted particularly in relation with the main operational parameters controlling the process, chiefly temperature, residence time and air supply in the oven and in the post-combustion zone, prior final adapted cleaning of the flue-gas stream. Experimental studies focusing on antimony behaviour were undertaken through laboratory-scale thermal treatment at 850 deg. C and 1100 deg. C of a Sb-rich halogenated waste, originating from the sector of flame retardants formulation. The configuration of our laboratory experimental device allowed to achieve only low oxidative conditions in the waste bed, but high oxidative strength coupled with high temperature and sufficient gas residence time in the post-combustion zone, as prescribed during the incineration of hazardous wastes. Atomic absorption spectroscopy was used to assess the partition of antimony in the different compartments of the process. The oxidation degree of antimony in the gas-phase was determined by the use of electrochemical techniques, namely polarography coupled with anodic stripping voltamperometry. The partition of antimony between the residual ash and the gas-phase under moderate oxidative conditions in the waste bed was constant, whatever the temperature: the volatilization rate for antimony was ∼64%, while a ∼36% fraction remained in the residual bottom ashes. But interestingly, while at 850 oC, antimony was mainly present in the gas-phase at a +III oxidation degree, an increase in temperature of 250 oC favoured the presence of antimony to its highest oxidation degree +V in the flue-gas stream, a valence known to be involved in less toxic species.

  17. Antimony powder-modified carbon paste electrodes for electrochemical stripping determination of trace heavy metals

    International Nuclear Information System (INIS)

    Highlights: → New antimony powder-modified carbon paste electrode. → Combination of specific properties of carbon paste substrate and metallic antimony. → No requirement of using toxic antimony(III) salts. → Electrochemical stripping determination of trace heavy metals at ppb levels. → Anodic stripping voltammetric and stripping chronopotentiometric measurements. - Abstract: A new type of the antimony electrode based on a carbon paste bulk-modified with antimony powder (Sb-CPE) is presented for the determination of cadmium(II) and lead(II) ions at the microgram-per-liter concentration level, when using square-wave anodic stripping voltammetric or stripping chronopotentiometric protocol. The Sb-CPE was prepared by mixing fine antimony powder, carbon powder, and silicon oil, thus combining typical features of the carbon paste material with specific electrochemical properties of antimony. Key-operational parameters, including the amount of antimony powder in the carbon paste mixture, effect of the deposition potential and deposition time, were optimized and electroanalytical performance of the Sb-CPE in nondeaerated solution of 0.01 M hydrochloric acid (pH 2) was compared with related bismuth powder-modified carbon paste electrode (Bi-CPE) and with in situ prepared antimony film carbon paste electrode (SbF-CPE). The electrode of interest exhibited well-developed signals and highly linear calibration plots for both metal ions tested. In addition, favorable limits of detection were achieved; namely: 1.4 μg L-1 for Cd(II) and 0.9 μg L-1 for Pb(II). The applicability of the new electrode was demonstrated on the analysis of tap water (spiked sample). Besides voltammetric measurements, the Sb-CPE was preliminary tested also under chronopotentiometric stripping mode in deoxygenated solutions, revealing also an excellent electroanalytical performance.

  18. Structural and optical characterization of thermally evaporated bismuth and antimony films for photovoltaic applications

    Science.gov (United States)

    Srimathy, N.; Ruban Kumar, A.

    2016-05-01

    In this present study, the thin film of bismuth and antimony is coated by thermal evaporation system equipped with the inbuilt ultra high vacuum system. XRD analysis confirmed the rhombohedral structure of Bismuth and Antimony on the prepared film. The surface roughness and physical appearance is analyzed by Atomic force microscopy. The results of Raman Spectroscopy show the wave functions and the spectrum of electrons. The preparation technique and conditions strongly influence the crystalline structure and the phase composition of bismuth and antimony thin films. The electrical and optical properties for the prepared film are analyzed. The results show a great interest and promising applications in Photovoltaic devices.

  19. Varicella zoster virus reactivation during or immediately following treatment of tegumentary leishmaniasis with antimony compounds

    Directory of Open Access Journals (Sweden)

    Andrea Barbieri Barros

    2014-07-01

    Full Text Available Antimony compounds are the cornerstone treatments for tegumentary leishmaniasis. The reactivation of herpes virus is a side effect described in few reports. We conducted an observational study to describe the incidence of herpes zoster reactivation during treatment with antimony compounds. The global incidence of herpes zoster is approximately 2.5 cases per 1,000 persons per month (or 30 cases per 1,000 persons per year. The estimated incidence of herpes zoster in patients undergoing antimony therapy is higher than previously reported.

  20. Coordination- and Redox-Noninnocent Behavior of Ambiphilic Ligands Containing Antimony.

    Science.gov (United States)

    Jones, J Stuart; Gabbaï, François P

    2016-05-17

    Stimulated by applications in catalysis, the chemistry of ambiphilic ligands featuring both donor and acceptor functionalities has experienced substantial growth in the past several years. The unique opportunities in catalysis offered by ambiphilic ligands stem from the ability of their acceptor functionalities to play key roles via metal-ligand cooperation or modulation of the reactivity of the metal center. Ligands featuring group 13 centers, most notably boranes, as their acceptor functionalities have undoubtedly spearheaded these developments, with remarkable results having been achieved in catalytic hydrogenation and hydrosilylation. Motivated by these developments as well as by our fundamental interest in the chemistry of heavy group 15 elements, we became fascinated by the possibility of employing antimony centers as Lewis acids within ambiphilic ligands. The chemistry of antimony-based ligands, most often encountered as trivalent stibines, has historically been considered to mirror that of their lighter phosphorus-based congeners. There is growing evidence, however, that antimony-based ligands may display unique coordination behavior and reactivity. Additionally, despite the diverse Lewis acid and redox chemistry that antimony exhibits, there have been only limited efforts to explore this chemistry within the coordination sphere of a transition metal. By incorporation of antimony into the framework of polydentate ligands in order to enforce the main group metal-transition metal interaction, the effect of redox and coordination events at the antimony center on the structure, electronics, and reactivity of the metal complex may be investigated. This Account describes our group's continuing efforts to probe the coordination behavior, reactivity, and application of ambiphilic ligands incorporating antimony centers. Structural and theoretical studies have established that both Sb(III) and Sb(V) centers in polydentate ligands may act as Z-type ligands toward late

  1. Cesium-137, a drama recounted; Cesio-137, um drama recontado

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Suzane de Alencar

    2013-01-15

    The radiological accident with Cesium-137, which started on Goiania in 1987, did not stop with the end of radiological contamination and continues in a judicial, scientific and narrative process of identification and recognition of new victims. The drama occupies a central place on the dynamics of radiological event, as it extends its limits, inflects its intensity and updates the event. As a narrative of the event, the ethnography incorporates and brings up to date the drama as an analysis landmark and the description of the theme as it is absorbed by a dramatic process. Cesium-137, a drama recounted is a textual experimentation based on real events and characters picked out from statements reported in various narratives about the radiological accident. (author)

  2. 7 CFR 58.137 - Excluded milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Excluded milk. 58.137 Section 58.137 Agriculture... Milk § 58.137 Excluded milk. A plant shall not accept milk from a producer if: (a) The milk has been in...) Three of the last five milk samples have exceeded the maximum bacterial estimate of 500,000 per...

  3. 21 CFR 137.105 - Flour.

    Science.gov (United States)

    2010-04-01

    ... Related Products § 137.105 Flour. (a) Flour, white flour, wheat flour, plain flour, is the food prepared... any natural deficiency of enzymes, malted wheat, malted wheat flour, malted barley flour, or any... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Flour. 137.105 Section 137.105 Food and Drugs...

  4. 21 CFR 137.175 - Phosphated flour.

    Science.gov (United States)

    2010-04-01

    ... Related Products § 137.175 Phosphated flour. Phosphated flour, phosphated white flour, and phosphated wheat flour, conform to the definition and standard of identity, and are subject to the requirements for... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Phosphated flour. 137.175 Section 137.175 Food...

  5. 25 CFR 137.6 - Power development.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Power development. 137.6 Section 137.6 Indians BUREAU OF... CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.6 Power development. The cost of the power development at... power development shall be disposed of as required by the terms and conditions of the act of March...

  6. 21 CFR 137.190 - Cracked wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cracked wheat. 137.190 Section 137.190 Food and... Related Products § 137.190 Cracked wheat. Cracked wheat is the food prepared by so cracking or cutting into angular fragments cleaned wheat other than durum wheat and red durum wheat that, when tested...

  7. 21 CFR 137.195 - Crushed wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Crushed wheat. 137.195 Section 137.195 Food and... Related Products § 137.195 Crushed wheat. Crushed wheat, coarse ground wheat, is the food prepared by so crushing cleaned wheat other than durum wheat and red durum wheat that, when tested by the...

  8. 14 CFR 137.41 - Personnel.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Personnel. 137.41 Section 137.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS... Operating Rules § 137.41 Personnel. (a) Information. The holder of an agricultural aircraft...

  9. 5 CFR 185.137 - Initial decision.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Initial decision. 185.137 Section 185.137 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.137 Initial decision. (a) The ALJ shall issue an initial decision based only on the record,...

  10. 7 CFR 4279.137 - Financial statements.

    Science.gov (United States)

    2010-01-01

    ... accordance with Generally Accepted Accounting Principles will be required. (b) If specific circumstances... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial statements. 4279.137 Section 4279.137... § 4279.137 Financial statements. (a) The lender will determine the type and frequency of submission...

  11. 45 CFR 96.137 - Payment schedule.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Payment schedule. 96.137 Section 96.137 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION BLOCK GRANTS Substance Abuse Prevention and Treatment Block Grant § 96.137 Payment schedule. (a) The Block Grant money that may be...

  12. 21 CFR 211.137 - Expiration dating.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Expiration dating. 211.137 Section 211.137 Food... § 211.137 Expiration dating. (a) To assure that a drug product meets applicable standards of identity, strength, quality, and purity at the time of use, it shall bear an expiration date determined...

  13. Crystal structure and thermodynamic properties of potassium antimony tungsten oxide

    Energy Technology Data Exchange (ETDEWEB)

    Knyazev, Aleksandr V., E-mail: knav@uic.nnov.ru [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation); Tananaev, Ivan G. [Institute of Physical Chemistry and Electrochemistry, Russian Academy of Sciences, 31 Leninsky prospect, Moscow GSP-1, 119991 (Russian Federation); Kuznetsova, Nataliya Yu.; Smirnova, Nataliya N.; Letyanina, Irene A.; Ladenkov, Igor V. [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation)

    2010-02-20

    In the present work potassium antimony tungsten oxide with pyrochlore structure is refined by the Rietveld method (space group Fd3m, Z = 8). The temperature dependences of heat capacity have been measured for the first time in the range from 7 to 370 K for this compound. The experimental data were used to calculate standard thermodynamic functions, namely the heat capacity C{sub p}{sup o}(T), enthalpy H{sup o}(T) - H{sup o}(0), entropy S{sup o}(T) - S{sup o}(0) and Gibbs function G{sup o}(T) - H{sup o}(0), for the range from T {yields} 0 to 370 K. The differential scanning calorimetry was applied to measure the incongruent melting temperature of compound under study. The high-temperature X-ray diffraction was used for the determining thermal expansion coefficients.

  14. Atomistic mechanisms governing structural stability change of zinc antimony thermoelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xiaolong [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); Lin, Jianping, E-mail: jaredlin@163.com [School of Materials Science and Engineering, Xiamen University of Technology, Xiamen 361024 (China); Qiao, Guanjun [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Wang, Zhao, E-mail: zwangzhao@gmail.com [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China)

    2015-01-05

    The structural stability of thermoelectric materials is a subject of growing importance for their energy harvesting applications. Here, we study the microscopic mechanisms governing the structural stability change of zinc antimony at its working temperature, using molecular dynamics combined with experimental measurements of the electrical and thermal conductivity. Our results show that the temperature-dependence of the thermal and electrical transport coefficients is strongly correlated with a structural transition. This is found to be associated with a relaxation process, in which a group of Zn atoms migrates between interstitial sites. This atom migration gradually leads to a stabilizing structural transition of the entire crystal framework, and then results in a more stable crystal structure of β–Zn{sub 4}Sb{sub 3} at high temperature.

  15. Coherent and Incoherent Structural Dynamics in Laser-Excited Antimony

    CERN Document Server

    Waldecker, Lutz; Bertoni, Roman; Vasileiadis, Thomas; Garcia, Martin E; Zijlstra, Eeuwe S; Ernstorfer, Ralph

    2016-01-01

    We investigate the excitation of phonons in photoexcited antimony and demonstrate that the entire electron-lattice interactions, in particular coherent and incoherent electron-phonon coupling, can be probed simultaneously. Using femtosecond electron diffraction (FED) with high temporal resolution, we observe the coherent excitation of the fully symmetric \\Ag\\ optical phonon mode via the shift of the minimum of the atomic potential energy surface. Molecular dynamics simulations are performed to quantify the change in lattice potential and the associated real-space amplitude of the coherent atomic oscillations. In addition, our experimental configuration allows observing the energy transfer from electrons to phonons via incoherent electron-lattice scattering events. Applying a modified two-temperature model, the electron-phonon coupling is determined from the data as a function of electronic temperature.

  16. NEW THIO S2- ADDUCTS WITH ANTIMONY (III AND V HALIDE: SYNTHESIS AND INFRARED STUDY

    Directory of Open Access Journals (Sweden)

    HASSAN ALLOUCH

    2013-12-01

    Full Text Available Five new S2- adducts with SbIII and SbV halides have been synthesized and studied by infrared. Discrete structures have been suggested, the environment around the antimony being tetrahedral, trigonal bipyramidal or octahedral.

  17. Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

    International Nuclear Information System (INIS)

    The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

  18. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity

    OpenAIRE

    Samanta Etel Treiger Borborema; João Alberto Osso Junior; Heitor Franco de Andrade Junior; Nanci do Nascimento

    2016-01-01

    Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine l...

  19. Removal of lead from crude antimony by using NaPo3 as lead elimination reagent

    Directory of Open Access Journals (Sweden)

    Ye L.G.

    2015-01-01

    Full Text Available In order to solve the shortcomings when removing lead from crude antimony in the traditional antimony smelting, a new process was provided using NaPO3 as lead elimination reagent to yield phosphate slag, and it was removed by floating on the surface of the liquid antimony. Reaction mechanism was clarified by using the TG-DTA and XRD techniques and single factor experiments of removal lead from crude antimony were engaged. The results show that PbO and NaPO3 begin endothermic reaction at 863K (590°C, and the reaction mainly form NaPb4(PO43 and NaPbPO4 below 1123K (850°C and above 1123K (850°C, respectively. Sb2O3 and NaPO3 start the reaction at 773K (500°C and generate an antimonic salt compound. The reaction product of the mixture of PbO, Sb2O3 and NaPO3 show that NaPO3 reacted with PbO prior when NaPO3 was insufficient, amorphous antimony glass will be generated only when NaPO3 was adequate. Single factor experiments were taken with NaNO3 as oxidizing agent under argon, effect of reaction time, reaction temperature and dosage of NaPO3 and NaNO3 on smelting results. The average content of lead in refined antimony was 0.05340% and 98.85% of lead were removed under optimal conditions; the content of lead in antimony have meet the requirements of commercial antimony.

  20. Electrochemical antimony removal from accumulator acid: Results from removal trials in laboratory cells

    International Nuclear Information System (INIS)

    Highlights: ► In non-divided cells, antimony did not deposit at cathode due to oxidation of Sb(III) at anode. ► Copper and graphite were found to be the most suitable electrode materials for antimony deposition. ► Sb species covering electrode lowers deposition efficiency with time. ► Thus, periodical renewal of cathode material is necessary. ► Calculated specific electroenergy consumption was relatively high. ► In contrast, absolute energy consumption was low due to small quantities of antimony removed. - Abstract: Regeneration of spent accumulator acid could be an alternative process for crystallization, neutralisation and disposal. Therefore, for the first time in a study of the possibilities of electrochemical removal of antimony and accumulator acid regeneration on a laboratory scale, two synthetic and several real systems containing sulfuric acid of concentrations ranging between 28% and 36%, and antimony species were tested. Discontinuous electrochemical reactors with anion exchange membranes were successfully used in these experiments, which were conducted at a temperature of 35 °C. Removal of antimony using cells that were not divided by a separator, however, was not possible. In selected experiments, by varying the electrode material, type of electrolyte, and cell current, the concentration of antimony could be reduced from the range of 5 ppm to 0.15 ppm. This resulted in current efficiencies between 0.00002% and 0.001%, and in specific electroenergy demands between 100 Wh L−1 and 2000 Wh L−1. In other experiments on substances with antimony contents up to 3500 mg L−1, the current efficiencies obtained were more than a thousandfold higher. In contrast to the formally high relative energy consumption parameters absolute demand parameters are relatively small and favour the electrochemical method in small scale application. Besides plate electrodes, 3D-cathodes were used. Copper- and graphite cathodes produced the best results.

  1. Separating cesium 137 from liquid radioactive wastes by using inorganic exchangers using static and dynamic procedures at various concentration of nitric acid and sodium nitrate

    International Nuclear Information System (INIS)

    Cesium 137 was separated from liquid wastes by ion exchange using ammonium molybdenum phosphate, potassium hexa cyano cobalt ferrate, zirconium hydro phosphate and antimony penta oxy hydrate ion exchangers. The investigation was done by static and dynamic procedures. In static procedure required time for reaching the system to equilibrium or ion exchange completion, the measurement of each exchanger, the effect of nitric acid and concentration of sodium nitrate on the capacity of ion exchangers was investigated. Also in dynamic procedure nitric acid and sodium nitrate concentration ratio on the power of and thereof the capacity of each ion exchanger was determined

  2. Effect of Antimony, Phosphorous and Salinity on Growth, Root Membrane Permeability and Root Antimony, Iron and Zinc Concentration of Corn in Hydroponic Media

    OpenAIRE

    H. Barangizi; M. Afyuni; B. Rezaee

    2010-01-01

    Antimony (Sb) pollution has increased in recent years because of human activities and extensive usage of antimony compounds. To date, only a few researches have been conducted in this field in Iran. The purpose of this research is to determine fresh and dry weight, root permeability percentage and root concentration of Sb, Fe and Zn in the corn. This greenhouse research was performed in hydroponics. A factorial experiment (3 × 2 × 3) with three Sb concentrations (0, 6, 18 mgL-1), with and wit...

  3. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department`s mission as stated in that document. ``The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.``

  4. Hanford Isotope Project strategic business analysis Cesium-137 (Cs-137)

    International Nuclear Information System (INIS)

    The purpose of this business analysis is to address the beneficial reuse of Cesium 137 (Cs-137) in order to utilize a valuable national asset and possibly save millions of tax dollars. Food irradiation is the front runner application along with other uses. This business analysis supports the objectives of the Department of Energy National Isotope Strategy distributed in August 1994 which describes the DOE plans for the production and distribution of isotope products and services. As part of the Department's mission as stated in that document. ''The Department of Energy will also continue to produce and distribute other radioisotopes and enriched stable isotopes for medical diagnostics and therapeutics, industrial, agricultural, and other useful applications on a businesslike basis. This is consistent with the goals and objectives of the National Performance Review. The Department will endeavor to look at opportunities for private sector to co-fund or invest in new ventures. Also, the Department will seek to divest from ventures that can more profitably or reliably be operated by the private sector.''

  5. Dicty_cDB: SLA137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA137 (Link to dictyBase) - - - Contig-U16449-1 SLA137Z (Link... to Original site) - - SLA137Z 491 - - - - Show SLA137 Library SL (Link to library) Clone ID SLA137 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA1-B/SLA137Q.Seq.d/ Representative seq. ID SLA13...7Z (Link to Original site) Representative DNA sequence >SLA137 (SLA137Q) /CSM/SL/SLA1-B/SLA137Q.Seq.d/ XXXXX...ATAAAAAAAAAAAAAAAA sequence update 1997. 5. 8 Translated Amino Acid sequence ---AWVDENGGGTMIPVSVSFEKALLDLSSD

  6. Arsenic and Antimony Content in Soil and Plants from Baia Mare Area, Romania

    Directory of Open Access Journals (Sweden)

    Gabriela Oprea

    2010-01-01

    Full Text Available Problem statement: The objective of this research was to evaluate the degree of soil contamination with arsenic and antimony in Baia Mare, a nonferrous mining and metallurgical center located in the North West region of Romania. The soil in the area is affected by the emissions of powders containing metals from metallurgical factories. Previous studies indicated the soil contamination with copper, zinc, cadmium and lead, but there is few data about the actual level of soil pollution with arsenic and antimony. Approach: The soil samples were collected from 2 districts of Baia Mare: Ferneziu, which is located in the proximity of a lead smelter and Săsar district which is located along the Sasar River in the preferential direction of the wind over a metallurgical factory producing lead. As reference was considered Dura area located in a less polluted hilly area, in the west part of the town. Samples of soil and plants from the residential area of Ferneziu, Săsar and Dura districts were collected. The arsenic determination was carried out by inductively coupled plasma atomic emission spectrometry and the antimony determination by inductively coupled plasma mass spectrometry. Results: In Ferneziu area, the concentration of arsenic in soil ranged between 0.25 and 255 mg kg-1. In Săsar district the arsenic concentration in the soil ranged between 5.5 and 295 mg kg-1. Regarding antimony, in Ferneziu area the concentration ranged between 5.3 and 40.6 mg kg-1; while in Săsar, antimony soils concentrations vary in the range: 0.9-18.4. Arsenic and antimony concentrations in plants were low for almost of the samples, both in Ferneziu and Săsar area indicating a low mobility of these elements in the studied soils. Conclusion: This study indicated the soil pollution with arsenic both in Ferneziu district and in Săsar district. The soil pollution with antimony was found especially in Ferneziu district.

  7. The MRP1-mediated effluxes of arsenic and antimony do not require arsenic-glutathione and antimony-glutathione complex formation.

    Science.gov (United States)

    Salerno, Milena; Petroutsa, Maria; Garnier-Suillerot, Arlette

    2002-04-01

    Arsenic trioxide is an effective treatment for acute promyelocytic leukemia, but resistance to metalloid salts is found in humans. Using atomic absorption spectroscopy, we have measured the rate of uptake of arsenic trioxide and of antimony tartrate in GLC4 and GLC4/ADR cells overexpressing MRP1 and the rate of their MRP1-mediated effluxes as a function of the intracellular GSH concentration. In sensitive cells, after 1 h, a pseudosteady state is reached where intra- and extracellular concentrations of metalloid are the same. This precludes the formation, at short term, of complexes between arsenic or antimony with GSH. In resistant cells reduced intracellular accumulation of arsenic (or antimony), reflecting an increased rate of arsenic (or antimony) efflux from the cells, is observed. No efflux of the metalloid is observed in GSH depleted cells. The two metalloids and GSH are pumped out by MRP1 with the same efficiency. Moreover for the three compounds 50% of the efflux is inhibited by 2 microM MK571. This led us to suggest that As- and Sb-containing species could be cotransported with GSH. PMID:12018890

  8. 137Cs in freshwater fish in Finland

    International Nuclear Information System (INIS)

    The paper deals with an evaluation of the importance of Finnish freshwater fish as a source of 137Cs in the diet. Freshwater fish were analysed for 137Cs in 1982. The 137Cs concentration factors from water to edible fish were determined for the same year. The evaluation is based on an extensive surface water investigation performed from 1965 to 1967. Along with the continuous fallout monitoring since the beginning of the 1960'es, this material makes it possible to valuate the 137Cs levels in surface water right up to the 1980'es. In 1982 the Finns received an average of 90 Bq 137Cs from freshwater fish. This dose constitutes a quarter of the 137Cs uptake from the total food consumtion in Finland in 1982

  9. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    International Nuclear Information System (INIS)

    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas

  10. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Murciego, A. Murciego [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Sanchez, A. Garcia [IRNA-CSIC, Departamento de Geoquimica Ambiental, Aptdo. 257, Salamanca (Spain); Gonzalez, M.A. Rodriguez [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Gil, E. Pinilla [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)]. E-mail: epinilla@unex.es; Gordillo, C. Toro [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Fernandez, J. Cabezas [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Triguero, T. Buyolo [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)

    2007-01-15

    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas.

  11. Cs-137 migration in soil near NPPs

    International Nuclear Information System (INIS)

    A convective-diffusion model has been employed for describing Cs-137 migration in soil. The migration parameters were determined by comparing the calculated vertical distribution profiles with the experimental ones. The migration parameters dependence on the soil state has been studied. Cs-137 penetration rate was found to be function of the soil type, surface state, soil wetness and orography. The obtained values are presented. A method is suggested for revealing the soil surface contamination by Cs-137 produced during NPP operation with distinguishing it from the global contamination background. For this purpose Cs-137 content in the upper 5 mm soil layer is estimated

  12. Cesium-137 in grass from Chernobyl fallout

    International Nuclear Information System (INIS)

    Grass ecosystem was monitored for 137Cs, a relatively long-lived radionuclide, for about 16 years since the Chernobyl reactor accident occurred on April 26, 1986. Cesium-137 in grass gramineae or poaceae the species, ranged from 122.9 Bq kg-1 (September 4, 1986) to 5.8 mBq kg-1 (October 16, 2001) that is a range of five orders of magnitude. It was observed that there was a trend of decreasing 137Cs with time reflecting a removal half-time of 40 months (3 1/3 years), which is the ecological half-life, T ec of 137Cs in grassland

  13. Determination of antimony by using tungsten trap atomic absorption spectrometry

    International Nuclear Information System (INIS)

    An electrically heated tungsten coil was used as a trap in the determination of antimony. The technique consists of three steps. Initially, SbH3 is formed by hydride generation procedure; then the analyte species in vapor form are transported to W-coil trap heated at 370 deg. C. Following the preconcentration step, the trap is heated to 895 deg. C; analyte species are revolatilized and transported to the flame-heated quartz atom cell where atomization and the formation of signal take place. The experimental parameters were optimized both for trap and no-trap studies. The most important experimental parameters are concentrations of HCl and NaBH4 solutions, H2 and Ar gas flow rates, and collection and revolatilization temperatures of W-coil. Accuracy was tested using a certified reference material, waste water EU-L-1. Limit of detection for the system is 16 ng l-1 using a sample of 36 ml collected in 4.0 min. Enhancement factor in sensitivity was 17

  14. NEW ERBIUM DOPED ANTIMONY GLASSES FOR LASER AND GLASS AMPLIFICATION

    Directory of Open Access Journals (Sweden)

    B. Tioua

    2015-07-01

    Full Text Available Because of the special spectroscopic properties of the rare earth ions, rare earth doped glasses are widely used in bulk and fiber lasers or amplifiers. The modelling of lasers and searching for new laser transitions require a precise knowledge of the spectroscopic properties of rare earth ions in different host glasses. In this poster will offer new doped erbium glasses synthesized in silicate crucibles were obtained in the combination Sb2O3-WO3-Na2O. Several properties are measured and correlated with glass compositions. The absorption spectral studies have been performed for erbium doped glasses. The intensities of various absorption bands of the doped glasses are measured and the Judd-Ofelt parameters have been computed. From the theory of Judd-Ofelt, various radiative properties, such as transition probability, branching ratio and radiative life time for various emission levels of these doped glasses have been determined and reported. These results confirm the ability of antimony glasses for glass amplification.

  15. Predictors of an unsatisfactory response to pentavalent antimony in the treatment of American visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Santos Mácia A.

    2002-01-01

    Full Text Available Although treatment of visceral leishmaniasis with pentavalent antimony is usually successful, some patients require second-line drug therapy, most commonly with amphotericin B. To identify the clinical characteristics that predict an inadequate response to pentavalent antimony, a case-control study was undertaken in Teresina, Piaui, Brazil. Over a two-year period, there were 19 cases of VL in which the staff physicians of a hospital prescribed second-line therapy with amphotericin B after determining that treatment with pentavalent antimony had failed. The control group consisted of 97 patients that were successfully treated with pentavalent antimony. A chart review using univariate and multivariate analysis was performed. The cure rate was 90% with amphotericin B. The odds ratio for the prescription of amphotericin B was 10.2 for children less than one year old, compared with individuals aged over 10 years. Patients who presented coinfection had an OR of 7.1 while those on antibiotics had an OR of 2.8. These data support either undertaking a longer course of therapy with pentavalent antimony for children or using amphotericin B as a first-line agent for children and individuals with coinfections. It also suggests that chemoprophylaxis directed toward bacterial coinfection in small children with VL may be indicated.

  16. Copper-promoted cementation of antimony in hydrochloric acid system: A green protocol.

    Science.gov (United States)

    Wu, Lian-Kui; Li, Ying-Ying; Cao, Hua-Zhen; Zheng, Guo-Qu

    2015-12-15

    A new method of recovering antimony in hydrochloric acid system by cementation with copper powder was proposed and carried out at laboratory scale. Thermodynamic analysis and cyclic voltammetry test were conducted to study the cementation process. This is a novel antimony removal technology and quite meets the requirements of green chemistry. The main cement product Cu2Sb is a promising anodic material for lithium and sodium ion battery. And nearly all consumed copper powder are transformed into CuCl which is an important industrial material. The effect of reaction temperature, stoichiometric ratio of Cu to Sb(III), stirring rate and concentration of HCl on the cementation efficiency of antimony were investigated in detail. Optimized cementation condition is obtained at 60 °C for 120 min and stirring rate of 600 rpm with Cu/Sb(III) stoichiometric ratio of 6 in 3 mol L(-1) HCl. At this time, nearly all antimony can be removed by copper powder and the cementation efficiency is over 99%. The structure and morphologies of the cement products were characterized by X-ray diffraction and scanning electron microscopy, respectively. Results show that the reaction temperature has little influence on the morphology of the cement products which consist of particles with various sizes. The activation energy of the cementation antimony on copper is 37.75 kJ mol(-1), indicating a chemically controlled step. Inductively coupled plasma mass spectrometry results show that no stibine generates during the cementation process. PMID:26252996

  17. Determination of traces of uranium and thorium in antimony(III) oxide by ICP-MS

    International Nuclear Information System (INIS)

    Traces of uranium and thorium in antimony(III) oxide were determined by inductively coupled plasma mass spectrometry (ICP-MS). A method of vaporization as the halide was applied to the separation of the analytes from the antimony matrix. Because the above separation method is so simple, reduced of external contamination was expected. In the case of vaporization using hydrochloric acid, however, it was found that antimony trichloride ions overlapped thorium ion of 232 (m/z). To find the most suitable conditions for matrix separation, vaporization behaviors were studied by using different acidic solutions such as HBr, HBr-HClO4 and HBr-H2SO4. Neither HBr+HClO4 nor HBr+H2SO4 was able to reduce the antimony matrix down to an unaffected level on ICP-MS measurement. On the other hand, in the case of the vaporization using hydrobromic acid, almost all the antimony matrix was removed. Determination limits obtained by this method were 0.02 and 0.03 ng g-1 for uranium and thorium, respectively. (author)

  18. Antimony leaching in plastics from waste electrical and electronic equipment (WEEE) with various acids and gamma irradiation

    International Nuclear Information System (INIS)

    Highlights: • We have proposed a method to recover antimony from electronic plastics. • The most efficient acid solution was sodium hydrogen tartrate in dimethyl sulfoxide. • Gamma irradiation did not influence the antimony leaching ability. - Abstract: There has been a recent interest in antimony since the availability in readily mined areas is decreasing compared to the amounts used. It is important in many applications such as flame retardants and in the production of polyester, which can trigger an investigation of the leachability of antimony from plastics using different acids. In this paper, different types of acids are tested for their ability to leach antimony from a discarded computer housing, made of poly(acrylonitrile butadiene styrene), which is a common plastic type used in electrical and electronic equipment. The acid solutions included sodium hydrogen tartrate (0.5 M) dissolved in either dimethyl sulfoxide or water (at ca. 23 °C and heated to ca. 105 °C). The metal content after leaching was determined by inductively coupled plasma optical emission spectroscopy. The most efficient leaching medium was the heated solution of sodium hydrogen tartrate in dimethyl sulfoxide, which leached almost half of the antimony from the poly(acrylonitrile butadiene styrene). Gamma irradiation, which is proposed to improve the mechanical properties in plastics, was used here to investigate the influence of antimony leaching ability. No significant change in the amount of leached antimony could be observed

  19. Mixed Antimony(V Complexes with Different Sugars to Modulate the Oral Bioavailability of Pentavalent Antimonial Drugs

    Directory of Open Access Journals (Sweden)

    Weverson A. Ferreira

    2014-04-01

    Full Text Available Previous studies have shown that the association of the drug meglumine antimoniate (MA with β-cyclodextrin can improve its bioavailability by the oral route. In this work, ribose and maltose were investigated for their ability to form mixed or association complexes with MA, release MA and modulate the serum levels of Sb after oral administration in mice. Analysis of the MA/ribose composition by high performance liquid chromatography coupled to mass spectrometry (LCMS-IT-TOF revealed the presence of mixed meglumine-Sb-ribose and Sb-ribose complexes. Analysis of the MA/maltose composition suggested the formation of MA-maltose association compounds. Circular dichroism characterization of these compositions following dilution in water at 37 °C suggested a partial and slow dissociation of the association compounds. When the MA/ribose composition was administered orally and compared to MA, the serum concentration of Sb was significantly lower after 1 h and greater after 3 h. On the other hand, the MA/maltose composition showed similar serum Sb concentration after 1 h and higher level of Sb after 3 h, when compared to MA. In conclusion, the present study has demonstrated the formation of mixed or association complexes of MA with sugars, such as maltose and ribose, which promoted sustained serum level of Sb after oral administration.

  20. Anodic stripping voltammetry of antimony using gold nanoparticle-modified carbon screen-printed electrodes

    International Nuclear Information System (INIS)

    Carbon screen-printed electrodes (CSPE) modified with gold nanoparticles present an interesting alternative in the determination of antimony using differential pulse anodic stripping voltammetry. Metallic gold nanoparticles deposits have been obtained by direct electrochemical deposition. Scanning electron microscopy measurements show that the electrochemically synthesized gold nanoparticles are deposited in aggregated form. Any undue effects caused by the presence of foreign ions in the solution were also analyzed to ensure that common interferents in the determination of antimony by ASV. The detection limit for Sb(III) obtained was 9.44 x 10-10 M. In terms of reproducibility, the precision of the above mentioned method in %R.S.D. values was calculated at 2.69% (n = 10). The method was applied to determine levels of antimony in seawater samples and pharmaceutical preparations

  1. Response of cutaneous leishmaniasis (chiclero's ulcer) to treatment with meglumine antimoniate in Southeast Mexico.

    Science.gov (United States)

    Vargas-Gonzalez, A; Canto-Lara, S B; Damian-Centeno, A G; Andrade-Narvaez, F J

    1999-12-01

    Cutaneous leishmaniasis, known as chiclero's ulcer in southeastern Mexico, is characterized by a predominantly single, painless, ulcerated lesion, without lymphangitis or adenopathy. When located on the ear, it tends to become chronic, causing destruction of the pinna and disfigurement. It is caused predominantly by Leishmania (L.) mexicana. Although pentavalent antimonials (Sb5+) are the mainstay of leishmanial therapy and have been used for more than 50 years, dosage regimens have been repeatedly modified and the best one has not been fully identified. The main purpose of the present study was to investigate the response of chiclero's ulcer to treatment with meglumine antimoniate. One hundred five patients were treated with meglumine antimoniate at a daily dose of 1 ampule per day (425 mg of Sb5+) until healing. The lesions healed after a mean of 25 days (range = 5-60 days). PMID:10674678

  2. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮

    2001-01-01

    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  3. Geothermal and fluid flowing simulation of ore-forming antimony deposits in Xikuangshan

    Institute of Scientific and Technical Information of China (English)

    YANG Ruiyan; MA Dongsheng; BAO Zhengyu; PAN Jiayong; CAO Shuanglin; XIA Fei

    2006-01-01

    The Xikuangshan Antimony Deposit located in the Mid-Hunan Basin, China, is the largest antimony deposit in the world. Based on the hydrogeological and geochemical data collected from four sections, Xikuangshan-Dajienao (AO), Xikuangshan-Dashengshan (BO), Xikuangshan-Longshan (CO) and Dafengshan (DO) in the Basin, an advanced metallogenic model related to deep-cyclic meteoric water of Xikuangshan Antimony Deposit is put forward in this paper using a model of heat-gravity-driving fluid flow transportation. The simulation results show that the ore-forming fluid of the deposit mainly comes from the Dashengshan and Longshan areas where BO and CO sections are located if the overall basin keeps a constant atmospheric precipitation and infiltration rate during mineralization, and that the average transportation speed of the ore-forming fluids is about 0.2-0.4 m/a.

  4. 137Cs in northern Adriatic sediments

    International Nuclear Information System (INIS)

    The activity of 137Cs in shallow northern Adriatic sediments was obtained on the basis of measurement results from 25 sediment box cores, sampled during the Adriatic Scientific COoperation Program (ASCOP) 16 cruise in the summer 1990. 137Cs was determined in surface sediments (0-3 cm) and 12-15 cm-deep sediment. It was found that the lowest caesium concentrations correspond to sands, which are spread along the Croatian coast. Parallel to the Italian coast, 137Cs concentrations in pelites are the highest. It seems that the influence of Po River is significant for 137Cs activities in recent marine sediments along Italian coast south of Po River delta. Significantly higher 137Cs activities in 0-3 cm sediment layer can be attributed to the deposition caused by Chernobyl accident. (author)

  5. Desorption of 137Cs+ from mosses

    Directory of Open Access Journals (Sweden)

    OLGICA NEDIC

    2002-09-01

    Full Text Available Mosses are biomonitors that accumulate large amounts of various pollutants, including radionuclides. In this work we investigated the possibility of 137Cs extraction from mosses, as well as the significance of species specificity on the efficiency of 137Cs desorption. Salt and acid solutions were used as extraction media. It was shown that a 5 % solution of both ammonium oxalate and phosphoric acid was able to desorb 81.8 % of 137Cs+ from Homalothecium sericeum, which was 39.9 % more than desorption from water. At the same time, most of the desorbed 137Cs+ was incorporated in crystals that precipitated from the solution. An interspecies difference in respect to 137Cs+ desorption was noticed.

  6. Future trends of global atmospheric antimony emissions from anthropogenic activities until 2050

    Science.gov (United States)

    Zhou, Junrui; Tian, Hezhong; Zhu, Chuanyong; Hao, Jiming; Gao, Jiajia; Wang, Yong; Xue, Yifeng; Hua, Shenbin; Wang, Kun

    2015-11-01

    This paper presents the scenario forecast of global atmospheric antimony (Sb) emissions from anthropogenic activities till 2050. The projection scenarios are built based on the comprehensive global antimony emission inventory for the period 1995-2010 which is reported in our previous study. Three scenarios are set up to investigate the future changes of global antimony emissions as well as their source and region contribution characteristics. Trends of activity levels specified as 5 primary source categories are projected by combining the historical trend extrapolation with EIA International energy outlook 2013, while the source-specific dynamic emission factors are determined by applying transformed normal distribution functions. If no major changes in the efficiency of emission control are introduced and keep current air quality legislations (Current Legislation scenario), global antimony emissions will increase by a factor of 2 between 2010 and 2050. The largest increase in Sb emissions is projected from Asia due to large volume of nonferrous metals production and waste incineration. In case of enforcing the pollutant emission standards (Strengthened Control scenario), global antimony emissions in 2050 will stabilize with that of 2010. Moreover, we can anticipate further declines in Sb emissions for all continents with the best emission control performances (Maximum Feasible Technological Reduction scenario). Future antimony emissions from the top 10 largest emitting countries have also been calculated and source category contributions of increasing emissions of these countries present significant diversity. Furthermore, global emission projections in 2050 are distributed within a 1° × 1°latitude/longitude grid. East Asia, Western Europe and North America present remarkable differences in emission intensity under the three scenarios, which implies that source-and-country specific control measures are necessary to be implemented for abating Sb emissions from

  7. Co-doping with antimony to control phosphorous diffusion in germanium

    KAUST Repository

    Tahini, H. A.

    2013-02-15

    In germanium, phosphorous and antimony diffuse quickly and as such their transport must be controlled in order to design efficient n-typed doped regions. Here, density functional theory based calculations are used to predict the influence of double donor co-doping on the migration activation energies of vacancy-mediated diffusion processes. The migration energy barriers for phosphorous and antimony were found to be increased significantly when larger clusters involving two donor atoms and a vacancy were formed. These clusters are energetically stable and can lead to the formation of even larger clusters involving a number of donor atoms around a vacancy, thereby affecting the properties of devices.

  8. Studies on Thin Films of Antimony Vacuum Evaporated from a Knudsen-Type Source

    Directory of Open Access Journals (Sweden)

    K.L. Chaudhary

    2000-10-01

    Full Text Available A Knudsen-type evaporation source was used for the deposition of thin films of antimony to study their growth and microstructure under different rates of evaporation and substrate temperatures when vacuum evaporated onto air-cleaved KC1, mica, amorphous carbon and doped KCl substrates. The crystallisation of these films on exposure to an electron beam of moderate intensity inside the electron microscope was studied, and the orientations of the crystallised films wrt the substrate were established. It has been concluded that antimony films prepared by this source compare well with those prepared by other sources of vacuum evaporation.

  9. Potential value of Cs-137 capsules

    Energy Technology Data Exchange (ETDEWEB)

    Bloomster, C.H.; Brown, D.R.; Bruno, G.A.; Hazelton, R.F.; Hendrickson, P.L.; Lezberg, A.J.; Tingey, G.L.; Wilfert, G.L.

    1985-04-01

    We determined the value of Cs-137 compared to Co-60 as a source for the irradiation of fruit (apples and cherries), pork and medical supplies. Cs-137, in the WESF capsule form, had a value of approximately $0.40/Ci as a substitute for Co-60 priced at approximately $1.00/Ci. The comparison was based on the available curies emitted from the surface of each capsule. We developed preliminary designs for fourteen irradiation facilities; seven were based on Co-60 and seven were based on Cs-137. These designs provided the basis for estimating capital and operating costs which, in turn, provided the basis for determining the value of Cs-137 relative to Co-60 in these applications. We evaluated the effect of the size of the irradiation facility on the value of Cs-137. The cost of irradiation is low compared to the value of the product. Irradiation of apples for disinfestation costs $.01 to .02 per pound. Irradiation for trichina-safe pork costs $.02 per pound. Irradiation of medical supplies for sterilization costs $.07 to .12 per pound. The cost of the irradiation source, either Co-60 or Cs-137, contributed only a minor amount to the total cost of irradiation, about 5% for the fruit and hog cases and about 20% for the medical supply cases. We analyzed the sensitivity of the irradiation costs and Cs-137 value to several key assumptions.

  10. 137Cs concentration in stingray (Dasyatis akajei)

    International Nuclear Information System (INIS)

    137Cs, which is of great interest and importance as an indicator of radioactive pollution in marine environments, is one of the long-lived artificial radio-nuclides introduced by the atmospheric deposition of debris from nuclear explosions mainly before 1962. For the estimation of effects of the effluents from nuclear facilities, it is necessary to know the natural variations in the concentration of 137Cs and factors affecting variations in marine organisms. We observed positive correlation between growth and 137Cs in 4 species among 14 major teleost species from fishing grounds along the coast of Japan. No increase in 137Cs concentration with increase of growth was observed in 2 species. In the remaining species no specific correlation is observed. These differences in the patterns were dependent on a change of feed habits with growth. As little is known of the 137Cs concentration in selachian we have investigated the natural variations of 137Cs in stingray. The correlation between growth and the concentration of 137Cs in stingray will be discussed. (author)

  11. Potential value of Cs-137 capsules

    International Nuclear Information System (INIS)

    We determined the value of Cs-137 compared to Co-60 as a source for the irradiation of fruit (apples and cherries), pork and medical supplies. Cs-137, in the WESF capsule form, had a value of approximately $0.40/Ci as a substitute for Co-60 priced at approximately $1.00/Ci. The comparison was based on the available curies emitted from the surface of each capsule. We developed preliminary designs for fourteen irradiation facilities; seven were based on Co-60 and seven were based on Cs-137. These designs provided the basis for estimating capital and operating costs which, in turn, provided the basis for determining the value of Cs-137 relative to Co-60 in these applications. We evaluated the effect of the size of the irradiation facility on the value of Cs-137. The cost of irradiation is low compared to the value of the product. Irradiation of apples for disinfestation costs $.01 to .02 per pound. Irradiation for trichina-safe pork costs $.02 per pound. Irradiation of medical supplies for sterilization costs $.07 to .12 per pound. The cost of the irradiation source, either Co-60 or Cs-137, contributed only a minor amount to the total cost of irradiation, about 5% for the fruit and hog cases and about 20% for the medical supply cases. We analyzed the sensitivity of the irradiation costs and Cs-137 value to several key assumptions

  12. Biokinetic model for 137 Cs

    International Nuclear Information System (INIS)

    The main objective of this work was to provide a realistic biokinetic model for 137 Cs metabolism. This model was based on the retention of cesium in 57 people contaminated in the Goiania accident, ages 1 to 73 y old, complemented by data obtained in an experiment with beagle dogs, and data taken from the open literature. Cesium is distributed among all tissues and organs of the body. Its main retention site is the skeletal muscle tissue. Mathematically, cesium retention in the body may be described by a sum of three terms exponential equation. The first term represents the fraction which is rapidly eliminated in urine. This fraction is weight dependent (negative correlation). The second term represents the retention of cesium in tissues and organs of the body. For children and adolescents, the second term biological half-life is a function of the weight. For adults, it is correlated with sex. Men present a higher retention of cesium than women. The third term correspond to a retention fraction of the order of 0,1% of the initial body burden. It is characterized by a very long half-life and represents a subcellular retention of cesium in the skeletal muscle tissue. During pregnancy the transfer factor from the mother to the fetus is correlated to the amount of cesium in the blood and it is equal to 1, if the intake of cesium occurs pregnancy. (author)

  13. Investigation of copper-zinc superoxide dismutase Ser-137 and Ala-137 mutants

    International Nuclear Information System (INIS)

    Ser- and Ala-137 mutants of human copper-zinc superoxide dismutase (Cu,ZnSOD) have been thoroughly characterized in an attempt to understand the subtle effect of the nature of the residue at position 137 on the structure of the copper site and on the activity profile. The results show that the nature of the residue at position 137 determines the presence of water in the active cavity as monitored through water 1H nuclear magnetic relaxation dispersion. Also, the hyperfine shifts experienced by the protons of His-48 in the Cu2Co2 derivative are sensitive to the group at the 137 position. These effects are not detected through electronic and EPR spectroscopies. The activity profiles of Ser-137 and Ala-137 mutants are virtually identical and are very close to that of the Ile-137 mutant at pH a between 6 and 7. The affinity of N3- for the Ser-137 and Ala-137 mutants is very similar to that for the wild type. This is again at variance with the Ile-137 derivative that shows an N3- affinity twice as large. 50 refs., 6 figs., 2 tabs

  14. Cs-137 content in a spruce stand

    International Nuclear Information System (INIS)

    The Cs-137 content of a spruce stand was investigated in soil, plant and animal biomasses of a 100 m. 100 m permanent study-site. The total content was 119 kBq.m-2. Most of all, 82.7% were found in soil, of that about 59.5% were bound in the 4 cm thick humus layer. The Cs-137 content of the above growing plant-biomass was 13050 Bq.m-2, these are 11.1% of the total. The Cs-137 contribution, bound in animal biomass was insignificant small. (orig.)

  15. Measurements of cesium-137 internal decontamination

    International Nuclear Information System (INIS)

    In the accident with Cs 137 which took place in Goiania, it could be verified that the majority of the victims presented internal and external contamination. In order to minimize deposits in internal organs and tissues and to enhance the excretion of Cs 137 we started treating the patients with: (1) Prussian Blue, oral administration, in about 46 patients, (2) Diuretics, oral administration, in 17 patients, and (3) Increasing the Cs 137 elimination by the sweat. Those proceedings were done under rigourous clinical evaluation and with data from radiochemical assay of excreta and afterwards with data obtained through the ''in vivo'' analysis though Whole Body Counting (Body Burden). (author)

  16. Diel variation of arsenic, molybdenum and antimony in a stream draining natural As geochemical anomaly

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Nováková, B.; Matoušek, Tomáš; Mihaljevič, M.; Rohovec, Jan; Filippi, Michal

    2013-01-01

    Roč. 31, APR (2013), s. 84-93. ISSN 0883-2927 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:68081715 ; RVO:67985831 Keywords : arsenic * molybdenum * antimony * trace elements * diel cycle Subject RIV: CB - Analytical Chemistry, Separation; DD - Geochemistry (GLU-S) Impact factor: 2.021, year: 2013

  17. Differences in antimony and arsenic releases from lead smelter fly ash in soils

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Šebek, O.; Valigurova, R.; Klementová, Mariana

    2012-01-01

    Roč. 72, Supp. 4 (2012), s. 15-22. ISSN 0009-2819 Institutional research plan: CEZ:AV0Z40320502 Keywords : Antimony * Arsenic * Lead smelting * Fly ash * Soil * Mobility Subject RIV: CA - Inorganic Chemistry Impact factor: 1.351, year: 2012

  18. Transparent Conducting Films of Antimony-Doped Tin Oxide with Uniform Mesostructure Assembled from Preformed Nanocrystals

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rathouský, Jiří; Rasp, M.; Schütz, B.; Niederberger, M.; Fattakhova-Rohlfing, D.

    Vol. 1. Boca Raton : Taylor-Francis, 2010, s. 627-630. ISBN 978-1-4398-3401-5. - ( Nanotech 2010) R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * mesoporous materials * nanoparticles * self-assembly Subject RIV: CF - Physical ; Theoretical Chemistry

  19. Determination of barium and antimony in gun shot residues by neutron activation analysis

    International Nuclear Information System (INIS)

    The antimony contents on both hands of 7 persons before and after firing an automatic pistol were determined by instrumental neutron activation analysis. The gun shot residues were removed from hands by a 4% solution of cellulose acetate in acetone. The average content of antimony on both hands before firing obtained from 70 measurements (35 from each hand) was 0.040 ± 0.010 micro gram, whereas the average contents on the right and the left hands after 1 firing were 0.385 ± 0.036 and 0.144 ± 0.029 micro gram respectively. The ration of the antimony contents after 1 firing to the normal level (before firing) was 9.9 for the right and 3.6 for the left. No significant difference was observed between male and female, smoker and non-smoker. The antimony content after several firings was not much different from that of 1 firing and it reduced to the normal level within 2 days after firing. The barium contents before and after firing were studied from one person. Barium was precipitated as Ba SO4 before counting. An average contents of 0.936 ± 0.551 micro gram for both hands before firing, 4.092 ± 2.687 micro gram for the right hand and 1.363 ± 0.879 micro gram for the left hand after 1 firing were found

  20. Transparent Conducting Films of Antimony-Doped Tin Oxide with Uniform Mesostructure Assembled from Preformed Nanocrystals

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rasp, M.; Rathouský, Jiří; Schütz, B.; Niederberger, M.; Fattakhova-Rohlfing, D.

    2010-01-01

    Roč. 6, č. 5 (2010), s. 633-637. ISSN 1613-6810 R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * msoporous materials * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 7.333, year: 2010

  1. Antimony production by carbothermic reduction of stibnite in the presence of lime

    Directory of Open Access Journals (Sweden)

    Padilla R.

    2014-01-01

    Full Text Available Experimental work on the carbothermic reduction of Sb2S3 in the presence of lime was carried out in the temperature range of 973 to 1123 K to produce antimony in an environmentally friendly manner. The results demonstrated the technical feasibility of producing antimony by this method without producing SO2 gas. Complete conversion of Sb2S3 was obtained at 1023 K in about 1000 seconds and at 1123 K in less than 250 seconds using stibnite-carbon-lime mixtures with molar ratios Sb2S3:CaO:C = 1:3:3. It was found that the reduction proceeds through the formation of an intermediate oxide SbO2, which is subsequently reduced by CO(g to yield antimony metal and CaS. The kinetics of the Sb2S3 reduction was analyzed by using the equation ln(1-X = -kt. The activation energy was 233 kJ mol-1 in the temperature range of 973 to 1123 K. This value would correspond to an antimony catalyzed carbon oxidation by CO2.

  2. Reaction products and corrosion of molybdenum electrode in glass melt containing antimony oxides and sodium sulfate

    Czech Academy of Sciences Publication Activity Database

    Matěj, J.; Langrová, Anna

    2012-01-01

    Roč. 56, č. 3 (2012), s. 280-285. ISSN 0862-5468 Institutional support: RVO:67985831 Keywords : antimony oxides * corrosion * glass melt * Molybdenum electrode * sulfate Subject RIV: DD - Geochemistry Impact factor: 0.418, year: 2012 http://www.ceramics-silikaty.cz/2012/pdf/2012_03_280.pdf

  3. On the segregation behavior of tin and antimony at grain boundaries of polycrystalline bcc iron

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Šandera, P.; Horníková, J.; Pokluda, J.; Godec, M.

    2016-01-01

    Roč. 363, Feb (2016), 140-144. ISSN 0169-4332 R&D Projects: GA ČR GAP108/12/0144 Institutional support: RVO:68378271 Keywords : grain boundary segregation * tin * antimony * Fe based alloy * AES quantification Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.711, year: 2014

  4. Synthesis of antimony tris(mercaptoethyl carboxylates) as thermal stabilizer for polyvinyl chloride

    Institute of Scientific and Technical Information of China (English)

    舒万艮; 刘又年; 陈启元

    2002-01-01

    A novel type of thermal stabilizers-antimony tris(mercaptoethyl carboxylates) (Sb(SCH2CH2OOCR) 3), was synthesized from carboxylic acid, antimony trioxide and 2-mercaptoethanol in two steps. The experimental results show that the molar ratio of carboxylic acid to antimony tris(2-hydroxyethyl mercaptide) is 1.2, when adding 0.6% tetra-n-butyl titanate as catalyst and xylene as isotropic solvent, heating and refluxing for about 2~4h. The thermal stability was measured by heat-aging oven test. The thermal stability time is about 8~40min(at 200℃) when adding 2% tetra-n-butyl titanate in polyvinyl chloride(PVC). Among these stabilizers, antimony tris(mercaptoethyl stearate) has best thermal stability. Its thermal stability is better than that of Ca-Zn complex and basic lead stabilizers, and equal to that of organotin. In addition, the stabilization mechanism of this kind of stabilizers for PVC was discussed briefly.

  5. Transfer of 137Cs into mother's milk

    International Nuclear Information System (INIS)

    The concern of nursing mothers about the contamination of foodstuffs after Chernobyl prompted this investigation of radiocaesium transfer to mother's milk. Between May 1987 and December 1988, duplicates of daily food intakes, as well as the corresponding mothers' milk samples, were collected from 12 nursing mothers for two to four weeks in order to measure the 137Cs activity. Once during the collection period, the total-body activity of each of the mothers involved was measured. Based on our results, 137Cs is transferred into mother's milk not only directly from food intake but also from the accumulated body burden. Approximately 19% of the 137Cs activity from the daily food intake and about 13% of the specific 137Cs body activity of the mother are transferred into 1 litre of mother's milk. (author)

  6. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2016-04-01

    Full Text Available Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine liposomes and to analyze their biological and physicochemical characteristics. METHODS: Liposomes containing meglumine antimoniate (MA or pentavalent antimony salt (Sb were obtained through filter extrusion (FEL and characterized by transmission electron microscopy. Promastigotes of Leishmania infantum were incubated with the drugs and the viability was determined with a tetrazolium dye (MTT assay. The effects of these drugs against intracellular amastigotes were also evaluated by optical microscopy, and mammalian cytotoxicity was determined by an MTT assay. RESULTS: Liposomes had an average diameter of 162nm. MA-FEL showed inhibitory activity against intracellular L. infantum amastigotes, with a 50% inhibitory concentration (IC50 of 0.9μg/mL, whereas that of MA was 60μg/mL. Sb-FEL showed an IC50 value of 0.2μg/mL, whereas that of free Sb was 9μg/mL. MA-FEL and Sb-FEL had strong in vitro activity that was 63-fold and 39-fold more effective than their respective free drugs. MA-FEL tested at a ten-times higher concentration than Sb-FEL did not show cytotoxicity to mammalian cells, resulting in a higher selectivity index. CONCLUSIONS: Antimonial drug-containing liposomes are more effective against Leishmania-infected macrophages than the non-liposomal drugs.

  7. Cesium-137 levels detected in Georgia otters

    International Nuclear Information System (INIS)

    Beginning in the 1940's and continuing through the 50's and early 60's, nuclear devices were tested by aerial detonation in the United States and other countries around the world. Cesium-137 (137Cs) is one of the most important radionuclide by-products due to its abundance and slow decay (30-year half-life). The uptake of 137Cs in animal tissue is the result of its similarity to potassium. The somatic and genetic effects of 137Cs, along with its effect on reproductive cells, can pose great hazards to wildlife species. A reported buildup of 137Cs in white-tailed deer in the lower coastal plain of Georgia during the 1960's was followed by a gradual decline during the 1970's. Although numerous studies have involved terrestrial mammals of Georgia, few have involved aquatic mammals such as the river otter. With continued atmospheric testing by some foreign countries and the increased use of nuclear power as an energy source, there is a need for continued monitoring of radionuclides in wildlife to ascertain the quality of the environment. This study was initiated as part of an overall study of environmental pollutants in the river otter of Georgia and deals with analysis of the 137Cs accumulations in this species

  8. 21 CFR 137.225 - Whole durum flour.

    Science.gov (United States)

    2010-04-01

    ... Flours and Related Products § 137.225 Whole durum flour. Whole durum wheat flour conforms to the..., prescribed for whole wheat flour by § 137.200, except that cleaned durum wheat, instead of cleaned wheat... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Whole durum flour. 137.225 Section 137.225...

  9. 21 CFR 137.205 - Bromated whole wheat flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bromated whole wheat flour. 137.205 Section 137... Cereal Flours and Related Products § 137.205 Bromated whole wheat flour. Bromated whole wheat flour... of ingredients, prescribed for whole wheat flour by § 137.200, except that potassium bromate is...

  10. Extraction-radiochemical study of the ion-association complex of antimony (V) with tetrazolium violet and its thermal behavior

    International Nuclear Information System (INIS)

    The optimum conditions for extraction of ion-associated complexes (IAS) formed from the tetrazolium salt - tetrazolium violet and Sb(V) in hydrochloric acid medium have been studied. An isotope of antimony (125Sb) was used for determination of the recovery factor (R%) and distribution ratio (DSb). The thermal behavior of the antimony complex with tetrazole violet was studied using differential thermal and thermogravimetric analysis. (author) 12 refs.; 3 figs

  11. Electrodes modified with bismuth, antimony and tin precursor compounds for electrochemical stripping analysis of trace metals (a short review)

    OpenAIRE

    Lezi, Nikolitsa; Economou, Anastasios; Barek, Jiří

    2014-01-01

    Over the last decade, intensive research is being carried out towards the development of “green” electrochemical sensors. Bismuth, antimony and tin electrodes have been proposed as potential substitutes of mercury electrodes in electrochemical stripping analysis of trace metals. The main advantage of these metals as electrode materials is their lower toxicity compared to mercury. Among the different configuration of bismuth, antimony and tin electrodes, one of the most attractive inv...

  12. Electrodeposition of SnSbCu Alloy on Copper from an Electrolyte with Varied Content of Antimony Chloride

    Science.gov (United States)

    Valeeva, A. Kh.; Valeev, I. Sh.

    2015-10-01

    The microstructure and chemical composition of electrodeposited alloys of the SnSbCu system with varied concentration of antimony chloride in the electrolyte have been investigated. It is shown that during electrodeposition mechanical-mixture alloys are not formed, but rather intermetallic compounds. It is found that increasing the concentration of antimony chloride in the electrolyte leads to a decrease in the tin content and cracking of the coating.

  13. Investigation into properties of the mixture of perfluoro-2-methyl-bicyclo(4,4,0) decane with antimony fluoride

    International Nuclear Information System (INIS)

    State diagram was constructed for a binary system formed by antimony fluoride and perfluoro-2-methyl-bicyclo-(4,4,0)decane in the temperature range of -58 deg to +56 deg C. Temperature dependence of solubility and the differential molar heat of solubility of solid Sb F5 were determined. Above the melting point of antimony fluoride these components were found to form a system of two sparingly miscible liquids with upper critical dissolution temperature

  14. Distribution of cesium-137 in reindeer

    Directory of Open Access Journals (Sweden)

    Kristina Rissanen

    1990-08-01

    Full Text Available The influence of the Chernobyl accident in 1986 on the Finnish reindeer herding area was much smaller than the effects of the nuclear bomb tests in the 1960s. Only in one small area somewhat more Cs-137 was deposited than in the rest of the reindeer herding area. From that area 20 reindeer were chosen for investigation of the distribution of Cs-137. All tissues, organs, the skeleton, digestive tract, hide, head and hooves were sampled quantitatively. Three reindeer were pregnant and also the foetuses were studied. The Cs-137 amounts were determined by gammaspectrometric measurements. The results showed that the differences in the Cs-137 concentrations between muscle tissue from different parts of an individual reindeer were not more than 10 percent. Thus it is not essential from which part of the reindeer meat samples for surveillance purposes are taken. The concentration of Cs-137 in edible tissues other than muscle was lower except in the kidneys and scapula cartilage.

  15. Treatment of antimony mine drainage: challenges and opportunities with special emphasis on mineral adsorption and sulfate reducing bacteria.

    Science.gov (United States)

    Li, Yongchao; Hu, Xiaoxian; Ren, Bozhi

    2016-01-01

    The present article summarizes antimony mine distribution, antimony mine drainage generation and environmental impacts, and critically analyses the remediation approach with special emphasis on iron oxidizing bacteria and sulfate reducing bacteria. Most recent research focuses on readily available low-cost adsorbents, such as minerals, wastes, and biosorbents. It is found that iron oxides prepared by chemical methods present superior adsorption ability for Sb(III) and Sb(V). However, this process is more costly and iron oxide activity can be inhibited by plenty of sulfate in antimony mine drainage. In the presence of sulfate reducing bacteria, sulfate can be reduced to sulfide and form Sb2S3 precipitates. However, dissolved oxygen and lack of nutrient source in antimony mine drainage inhibit sulfate reducing bacteria activity. Biogenetic iron oxide minerals from iron corrosion by iron-oxidizing bacteria may prove promising for antimony adsorption, while the micro-environment generated from iron corrosion by iron oxidizing bacteria may provide better growth conditions for symbiotic sulfate reducing bacteria. Finally, based on biogenetic iron oxide adsorption and sulfate reducing bacteria followed by precipitation, the paper suggests an alternative treatment for antimony mine drainage that deserves exploration. PMID:27148704

  16. Spatial 137Cs distribution in forest soil

    International Nuclear Information System (INIS)

    This work presents the distribution of radioactive caesium in several types of forest soil originating from the Lesisko reserve (Opole Province, Poland). Vertical distribution of 137Cs isotope was determined in the profiles related to physicochemical properties of different types of soils and their location. Thickness of emerging genetic horizons, structure and morphology of soil profiles were determined. The highest 137Cs activities were found in Of and A horizons. At the same time, there was a sudden drop of 137Cs activity in mineral horizons of soil profiles. By analysis of caesium radioisotope content and its distribution in soil profiles significant correlations were observed between certain physicochemical properties (e.g. pH value, hydrolytic acidity, granulometric composition) of soils in selected forest habitats. (author)

  17. 13.7.Gallbladder and bile duct

    Institute of Scientific and Technical Information of China (English)

    1993-01-01

    950323 CT in predicting the efficacy of oralcholelitholysis with bile acids.FU Xianbo (傅贤波),et al.Dept Surg,3rd Teach Hosp,BeijingMed Univ,Beijing,100083.Natl Med J China1993;73(2):81—83.The efficacy of oral cholelitholytic therapywith chenodeoxycholic acid (CDCA) and ur-sodeoxycholic acid (UDCA) in 137 patients withgallstones was compared with their CT pat-terns.The best dissolving results were obtainedfrom patients with the stones in isodense andfaint category (<50Hu) on CT.All the stoneswith high density or heterogeneous calcificationon CT were insoluble.Therefore,they were con-traindicated for oral cholelitholytie therapy.Ac-cording to the abovr,criteria,the rates for disso-lution ranged from 27.7%(38/137).to 66.7%(38/57),and those for complete dissolutionranged from 9.49%(13/137) to 40.7%(11/

  18. Radiochemical determination of 137Cs in foods

    International Nuclear Information System (INIS)

    A determination of radionuclides in food samples is important in commodities in order to attend to regulatory requirements for international trade. As a long-lived radioisotope of cesium, 137Cs is produced as a result of human nuclear activities and than its contamination level evaluation among others radionuclides in foods is necessary. A methodology for the determination of 137Cs in foods, pork and fish, is described. The procedures covered homogenization and freeze-drying of the samples. The 137Cs was measured by gamma spectrometry using Canberra 50% HPGe detector. The counting was carried out with Monte Carlo software for detection conditions optimization including geometry and chemical data information. A certified sample, SRM IAEA-375, was analyzed in order to evaluate the reliability of the method, and the results showed good agreement between the measured and certified values. (author)

  19. Understanding the radiolabelling mechanism of 99mTc-antimony sulphide colloid

    International Nuclear Information System (INIS)

    The chemistry of antimony trisulphide colloid (ATC) was examined to elucidate the radiolabelling mechanism with 99mTcO4-. Ion exchange chromatography and atomic absorption spectrophotometry techniques determined ATC to be resistant to hydrolysis in 0.1 M hydrochloric acid (HCl) at 25 deg. C or 100 deg. C (>97% recovery, Sb3+ absent). Hydrogen sulphide gas detected did not participate in the mechanism, where antimony trisulphide and 99mTcO4- in HCl/100 deg. C yielded 96% 99mTc-product from a K2S-free formulation (versus 98% when K2S was present). 99mTcO4- was reduced >90% by DMSA or dithiothreitol under the same conditions, identifying involvement of thiol groups. Infrared analysis of Re-ATC showed S-O bonds, indicating excess thiol groups at the colloid surface were oxidised at the expense of 99mTcO4- reduction

  20. A facile and fast route to prepare antimony (Sb) nanostructures without additives

    KAUST Repository

    Shah, M.A.

    2011-12-01

    Herein, we report a safe, low cost and reproducible approach for the synthesis of antimony (Sb) nanostructures with most of them having prism like morphology and having well defined faces in the range of ∼70210 nm. The organics free approach is based on a reaction of antimony powder and pure water at ∼210 °C without using any harmful additives and amines. The XRD pattern confirmed the composition and crystallinity of the grown nanostructures. The reported method besides being organics free is economical, fast and free of pollution, which will make it suitable for large scale production. Furthermore, it is well expected that such a technique could be extended to prepare many other important metal and metal oxide nanostructures. The prospects of the process are bright and promising. © 2012 Sharif University of Technology. Production and hosting by Elsevier B.V. All rights reserved.

  1. Determination by neutron activation analysis of loss of arsenic, antimony, bromine and mercury during lyophilization

    International Nuclear Information System (INIS)

    Neutron activation analysis has been used to monitor the loss of arsenic, as dimethylarsinic acid, (CH3)2AsOOH, or as sodium arsenate (Na2HAsO4.7H2O), antimony (as potassium antimony, tartrate, KSbC4O7.1/2H2O) and bromine (as bromide ion) during lyophilization of acidified and neutral aqueous synthetic and environmental samples. Losses of Sb and As ranged from zero to 60%, while losses of bromine were constant (at 91%) in acidic solutions. The variable losses of As and Sb were due solely to the presence of and partial decomposition of the (CH3)2AsOOH. Electrochemical oxidation of Br- to Br2 is responsible for the high losses of bromine. In addition losses of mercury (as methylmercuric chloride) were 1O0% in both acidic and neutral aqueous synthetic samples during lyophilization. (author)

  2. Deciphering lead and cadmium stripping peaks for porous antimony deposited electrodes

    Directory of Open Access Journals (Sweden)

    Taimoor Aqeel Ahmad

    2016-06-01

    Full Text Available Cadmium and lead are generally taken as model heavy metal ions in water to scale the detection limit of various electrode sensors, using electrochemical sensing techniques. These ions interact with the electrochemically deposited antimony electrodes depending on the diffusion limitations. The phenomenon acts differently for the in-situ and ex-situ deposition as well as for porous and non-porous electrodes. A method has been adopted in this study to discourage the stripping and deposition of the working ions (antimony to understand the principle of heavy metal ion detection. X-ray photoelectron spectroscopy (XPS technique was used to establish the interaction between the working and dissolved ions. In addition to the distinct peaks for each analyte, researchers also observed a shoulder peak. A possible reason for the presence of this peak was provided. Different electrochemical tests were performed to ascertain the theory on the basis of the experimental observations.

  3. Antimony/Graphitic Carbon Composite Anode for High-Performance Sodium-Ion Batteries.

    Science.gov (United States)

    Zhao, Xin; Vail, Sean A; Lu, Yuhao; Song, Jie; Pan, Wei; Evans, David R; Lee, Jong-Jan

    2016-06-01

    Although the room-temperature rechargeable sodium-ion battery has emerged as an attractive alternative energy storage solution for large-scale deployment, major challenges toward practical sodium-ion battery technology remain including identification and engineering of anode materials that are both technologically feasible and economical. Herein, an antimony-based anode is developed by incorporating antimony into graphitic carbon matrices using low-cost materials and scalable processes. The composite anode exhibits excellent overall performance in terms of packing density, fast charge/discharge capability and cyclability, which is enabled by the conductive and compact graphitic network. A full cell design featuring this composite anode with a hexacyanometallate cathode achieves superior power output and low polarization, which offers the potential for realizing a high-performance, cost-effective sodium-ion battery. PMID:27172376

  4. Antimony segregation in stressed SiGe heterostructures grown by molecular beam epitaxy

    International Nuclear Information System (INIS)

    The effects of the growth temperature, composition, and elastic strains in separate layers on the segregation of antimony are studied experimentally for stressed SiGe structures grown by molecular beam epitaxy. It is established that the growth conditions and parameters of the structures exert an interrelated influence on the segregation of Sb: the degree of the influence of the composition and elastic stresses in the SiGe layers on Sb segregation depends on the growth temperature. It is shown that usage of a method previously proposed by us for the selective doping of silicon structures with consideration for the obtained dependences of Sb segregation on the growth conditions and parameters of the SiGe layers makes it possible to form SiGe structures selectively doped with antimony

  5. Synthesis, spectroscopic characterization and antibacterial activity of antimony(III) bis(dialkyldithiocarbamato)alkyldithiocarbonates.

    Science.gov (United States)

    Chauhan, H P S; Bakshi, Abhilasha; Bhatiya, Sumit

    2011-10-15

    Some mixed sulfur donor ligand complexes of antimony(III) of the general formula [(R(2)NCS(2))](2)SbS(2)COR' where R = CH(3), C(2)H(5) and R' = Me, Et, Pr(n), Pr(i), Bu(n) and Bu(i) have been synthesized by the reaction of antimony(III) bis(dialkyldithiocarbamate) chloride with potassium organodithiocarbonate in an equimolar ratio by stirring at room temperature in benzene/CS(2) mixture. These complexes have been characterized by physicochemical [elemental analysis, melting points and molecular weight determinations] and spectral [UV, IR, Far-IR, NMR ((1)H and (13)C), FAB(+) mass and powder X-ray diffraction] studies. Free ligands and synthesized complexes have also been screened against different bacterial strains and results obtained made it desirable to delineate a comparison between free ligands, standard drug used and synthesized complexes. PMID:21764366

  6. Measurement of aluminium, silicon, manganese, copper and antimony in slag, castings and white metal

    International Nuclear Information System (INIS)

    Chemical analysis of the slag showed 24.90% SiO2, 17.88% Al2O3, 0.75% F2O3, 46.4% CaO and 2.34% MgO. In the four cast metal samples the manganese concentration was 0.75%, 0.48%, 0.47% and 0.42%. The white metal contained 59.04% tin, 7.43% antimony, 22.55% lead and 7.08% copper. The slag, casting and white metal samples came from the Industrial Research Centre for Central Africa (CRIAC), having been provided originally by the Société Somkat of Lubumbashi which operates iron, bronze and aluminium foundries. The aluminium, silicon, manganese, copper and antimony concentrations were easily measured, without the need for chemical separation. (author)

  7. Bi-antimony capped Keggin polyoxometalate modified with Cu-ligand fragment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Jiao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Han, Zhangang, E-mail: hanzg116@yahoo.com.cn [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhang, Heng; Yu, Haitao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhai, Xueliang, E-mail: xlzhai253@mail.hebtu.edu.cn [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China)

    2012-10-15

    Three polyoxometalates consisting of bi-antimony capped Keggin-type clusters: [Cu(mbpy){sub 2}]{sub 2}[PMo{sub 12}O{sub 40}Sb{sub 2}]{center_dot}4H{sub 2}O (1), [Cu(mbpy){sub 2}][PMo{sub 12}O{sub 40}Sb{sub 2}] (2) and {l_brace}Cu(mbpy)[Cu(mbpy){sub 2}]{sub 2}{r_brace}[VMo{sub 8}V{sub 4}O{sub 40}Sb{sub 2}]{center_dot}2H{sub 2}O (3) (mbpy=4,4 Prime -dimethyl-2,2 Prime - dipyridyl in 1 and 2; 5,5 Prime -dimethyl-2,2 Prime -dipyridyl in 3) have been synthesized and characterized by IR, X-ray powder diffraction, TG analysis and electrochemical property. Single-crystal analysis revealed that all of three compounds are built upon bi-antimony capped Keggin-type polyoxoanions and Cu-mbpy cations. In 1-3, two Sb{sup III} centers located at the two opposite of anionic surface adopt fundamentally tetragonal pyramidal coordination geometry. Both compounds 1 and 2 consist of P-centered Keggin structure, while compound 3 presents a V-centered Keggin anion. The Keggin-type anions present different structural features: isolated cluster in 1 and Cu-ligand-supported cluster in 2 and 3. - Graphical abstract: Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters modified with Cu-ligand cations have been synthesized and characterized. Highlights: Black-Right-Pointing-Pointer Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters have been synthesized. Black-Right-Pointing-Pointer Two Sb{sup III} centers located at the two opposite of anionic surface adopt tetragonal pyramidal coordination geometry. Black-Right-Pointing-Pointer The anions present different structural features: isolated and Cu-ligand-supported cluster.

  8. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium

    OpenAIRE

    Rajmund Michalski; Sebastian Szopa; Magdalena Jabłońska; Aleksandra Łyko

    2012-01-01

    Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemi...

  9. Metal corrosion studies with the fluorosulphonic acid-antimony pentafluoride superacid system

    International Nuclear Information System (INIS)

    Because of their rapid dissolution of many actinide metals and refractory oxides, superacids such as HSO3F/SbF5 have potential applications in actinide processing. However, material compatibility must first be addressed because of the highly corrosive nature of superacids. This paper describes the qualitative rates of attack of fluorosulphonic acid-antimony pentafluoride superacid on a variety of metal substrates relevant to nuclear processing

  10. Molybdenum-vanadium-antimony mixed oxide catalyst for isobutane partial oxidation synthesized using magneto hydrodynamic forces

    OpenAIRE

    Stuyven, Bernard; Emmerich, Jens; Eloy, Pierre; Van Humbeeck, Jan; Jacobs, Pierre; Kirschhock, Christine; Martens, Johan; Breynaert, Eric

    2014-01-01

    A peculiar effect was observed that the oxidation behavior of antimony oxide prepared in presence of a weak permanent magnetic field is changed. Reactivity of alpha-Sb2O3 (senarmontite) towards oxidation is significantly enhanced after recirculating its suspension in a magneto hydrodynamic (MHD) system. This inspired the MHD synthesis of a molybdenum-vanadiumantimony mixed oxide with superior catalytic activity for selective partial oxidation of isobutane. Traditionally these mixed oxides are...

  11. Temporal and spatial distribution of atmospheric antimony emission inventories from coal combustion in China

    International Nuclear Information System (INIS)

    A multiple-year inventory of atmospheric antimony (Sb) emissions from coal combustion in China for the period of 1980-2007 has been calculated for the first time. Specifically, the emission inventories of Sb from 30 provinces and 4 economic sectors (thermal power, industry, residential use, and others) are evaluated and analyzed in detail. It shows that the total Sb emissions released from coal combustion in China have increased from 133.19 t in 1980 to 546.67 t in 2007, at an annually average growth rate of 5.4%. The antimony emissions are largely emitted by industrial sector and thermal power generation sector, contributing 53.6% and 26.9% of the totals, respectively. At provincial level, the distribution of Sb emissions shows significant variation. Between 2005 and 2007, provinces always rank at the top five largest Sb emissions are: Guizhou, Hunan, Hebei, Shandong, and Anhui. - Highlights: → Atmospheric Sb emission inventory from coal in China during 1980-2007 is developed. → We included 1612 coal samples to determine the provincial mean Sb contents in coal. →Emission inventories of Sb from 30 provinces and 4 economic sectors are evaluated. → Total 546.67t Sb emissions in 2007 are mainly emitted from industrial sector. → There is significant variation for Sb distribution among different provinces. - A multiple-year inventory of atmospheric antimony emissions from coal combustion in China for the period of 1980-2007 has been calculated for the first time.

  12. Antimony in the Contaminated Site of El Triunfo, Baja California Sur, Mexico

    Directory of Open Access Journals (Sweden)

    Marmolejo-Rodríguez A. J.

    2013-04-01

    Full Text Available Antimony has properties similar to arsenic with some of its compounds toxic to humans. Therefore it is necessary to control the wastes accumulated by anthropogenic activities, such as mining, where it is in tailings to be released to the environment. According to the Environment Protection Agency, the maximum value in sediments is 11.2 mg Sb kg–1 and the Earth’s crust average is 0.2 mg Sb kg–1. In this semiarid area, the drainage basin El Carrizal is impacted with wastes of an abandoned gold mine at the Mining District El Triunfo (MD – ET which have tailings with 17,600 mg kg–1 of antimony. In the main dry river (arroyo, the Sb content is between 0.6 and 122 mg kg–1. This element is transported from the source throughout the fluvial basin to discharge into the Pacific Ocean. In the arroyo mouth we collected one sedimentary core and the sediment from dunes (28.6 – 45.7 and 6.43 – 7.74 mg Sb kg–1. This research concluded the antimony is enriched in this semiarid system, with Normalized Enrichment Factors severely enriched mainly in arroyo sediments close to the MD-ET

  13. Morphology and antimony segregation of spangles on batch hot-dip galvanized coatings

    International Nuclear Information System (INIS)

    Spangles produced by batch hot-dip galvanizing process have a rougher surface and a greater surface segregation of alloying element compared with those in continuous hot-dip galvanizing line (CGL), owing to the cooling rate of the former is much smaller than that of the later. Therefore, typical spangles on a batch hot-dipped Zn-0.05Al-0.2Sb alloy coating were investigated. The chemical, morphological characterization and identification of the phases on the spangles were examined by scanning electron microscopy (SEM), backscattered electron imaging (BSE), atomic force microscopy (AFM), energy dispersive spectroscopy (EDS) and X-ray diffraction analysis (XRD). The results showed that the coating surface usually exhibited three kinds of spangles: shiny, feathery and dull spangle, of which extensively antimony surface segregation was detected. The nature of precipitate on the coating surface was identified as β-Sb3Zn4, The precipitated β-Sb3Zn4 particles distributed randomly on the shiny spangle surface, both β-Sb3Zn4 particles and dentritic segregation of antimony dispersed in the dendritic secondary arm spacings of the feathery spangle and on the whole dull spangle surface. The dentritic segregation of antimony and precipitation of Sb3Zn4 compound are discussed by a proposed model.

  14. Methylated arsenic and antimony species in suspended matter of the river Ruhr, Germany

    Directory of Open Access Journals (Sweden)

    L. Duester

    2008-04-01

    Full Text Available The methylated antimony and arsenic species content of sediments derived from a sedimentation bowl of the river Ruhr were monitored over a 12 month period. The most prevalent species detected were monomethylarsenic (MMAs and monomethylantimony (MMSb. The methylantimony and methylarsenic species concentration was found to be directly correlated to the winter spate. As the biological activity in the water body is generally low at this time of the year, it may be concluded that the concentration maxima in winter originated from the translocation of soil- and sediment particles to the river by heavy rains and the melting of snow. A second maximum in Spring/early Summer was observed for the methylarsenic species, and specifically the dimethylarsenic species (DMAs; this occurred in parallel to the algal bloom. A change in the methylarsenic speciation pattern was observed between April, May and June, with DMAs replacing MMAs as the dominant methylarsenic species. For methylated antimony species no seasonal variation in the species pattern was detected. Taken together these data strongly indicate a higher degree of transformation of arsenic compared to antimony in the Ruhr river system in spring and can be taken as a record for a biogeochemical different behaviour of these two elements which are often treated as equivalent in environmental studies.

  15. Studies in atomic-fluorescence spectroscopy-V The fluorescence characteristics and determination of antimony.

    Science.gov (United States)

    Dagnall, R M; Thompson, K C; West, T S

    1967-10-01

    Atomic-fluorescence of antimony may be generated in an air-propane flame by nebulizing aqueous solutions of antimony salts whilst irradiating the flame by means of a microwave-excited electrode-less discharge tube operating at 30 W. The strongest fluorescence is exhibited by the (4)S(11 2 ) --> (4)P(1 3 ) 2311 A resonance line and weaker signals are observed at the 2068 and 2176 A resonance lines and at four intercombination lines, at 2598, 2671, 2770 and 2878 A. A process of thermally assisted direct-line fluorescence is postulated to account for the otherwise inexplicable intensity of the 2598 A line emission. Atomic-fluorescence spectroscopy at 2176 A permits the determination of antimony in the range 0.1-120 ppm with a detection limit of 0.05 ppm. With the same equipment and source, the range of measurement for atomic-absorption was 6-120 ppm and the detection limit was 1 ppm. No interferences were observed from 100-fold molar amounts of Cd, Co, Cu, Fe, Hg, K, Mg, Mn, Mo, Na, NH(4), Pb and Zn or from arsenate, chloride, nitrate, phosphate and sulphate. PMID:18960212

  16. Ultrasound- assisted emulsification microextraction for separation of trace amounts of antimony prior to FAAS determination

    International Nuclear Information System (INIS)

    We describe a simple and rapid method for the ultrasound-assisted microextraction of antimony using the solidified floating organic drop method. The effects of pH, type and volume of the extractant, time of sonication, amount of chelating agent, type and amount of surfactant were investigated and optimized. Bromopyrogollol red is acting as the chelating agent. Antimony(III) ion was extracted into finely dispersed droplets of undecanol after ion-pair formation with the water soluble chelator and the cationic detergent benzyldimethyltetradecylammonium chloride. Flame atomic absorption spectrometry was used for the detection. The resulting calibration is linear in the concentration range from 4. 0 to 900 ng mL-1 of Sb(III) with a correlation coefficient of 0. 9981. The enrichment factor is 67, the detection limit is 0. 62 ng mL-1, and the relative standard deviation is ±3. 6% (at 100 ng mL-1; for n = 10). The method was successfully applied to the determination of antimony in water samples. (author)

  17. Hypoxia-induced soluble CD137 in malignant cells blocks CD137L-costimulation as an immune escape mechanism

    Science.gov (United States)

    Labiano, Sara; Palazón, Asis; Bolaños, Elixabet; Azpilikueta, Arantza; Sánchez-Paulete, Alfonso R.; Morales-Kastresana, Aizea; Quetglas, Jose I.; Perez-Gracia, José L.; Gúrpide, Alfonso; Rodriguez-Ruiz, Maria; Aznar, M. Angela; Jure-Kunkel, Maria; Berraondo, Pedro; Melero, Ignacio

    2016-01-01

    ABSTRACT Hypoxia is a common feature in solid tumors that has been implicated in immune evasion. Previous studies from our group have shown that hypoxia upregulates the co-stimulatory receptor CD137 on activated T lymphocytes and on vascular endothelial cells. In this study, we show that exposure of mouse and human tumor cell lines to hypoxic conditions (1% O2) promotes CD137 transcription. However, the resulting mRNA is predominantly an alternatively spliced form that encodes for a soluble variant, lacking the transmembrane domain. Accordingly, soluble CD137 (sCD137) is detectable by ELISA in the supernatant of hypoxia-exposed cell lines and in the serum of tumor-bearing mice. sCD137, as secreted by tumor cells, is able to bind to CD137-Ligand (CD137L). Our studies on primed T lymphocytes in co-culture with stable transfectants for CD137L demonstrate that tumor-secreted sCD137 prevents co-stimulation of T lymphocytes. Such an effect results from preventing the interaction of CD137L with the transmembrane forms of CD137 expressed on T lymphocytes undergoing activation. Indeed, silencing CD137 with shRNA renders more immunogenic tumor-cell variants upon inoculation to immunocompetent mice but which readily grafted on immunodeficient or CD8+ T-cell-depleted mice. These mechanisms are interpreted as a molecular strategy deployed by tumors to repress lymphocyte co-stimulation via CD137/CD137L. PMID:26942078

  18. Accumulation of antimony and other potentially toxic elements in plants around a former antimony mine located in the Ribes Valley (Eastern Pyrenees)

    Science.gov (United States)

    Bech, Jaume; Corrales, Isabel; Duran, Paola; Roca, Núria; Tume, Pedro; Barceló, Juan; Poschenrieder, Charlotte

    2010-05-01

    Soil contamination by antimony is of increasing environmental concern due to the use of this amphoterous p-block element in many industrial applications such as flame retardant, electronics, alloys, rubber and textile industries. However, little is still known about the response of plants to antimony. Here we report on the accumulation of antimony and other potentially toxic elements (mainly As, Pb and Cu) in plants growing around a former antimony mine in the ribes Valley located in the Eastern Pyrenees (424078E, 4686100N alt. 1145 m.a.s.l) that was operating approximately between the years 1870 to 1960. The ore mineral veins are included in quartz gangue. The main ores were: Sulphides: Stibnite (Sb2S3), Pyrite (FeS2), Sphalerite (ZnS), Arsenopyrite (FeAs), Galenite (PbS), Chalcopyrite (CuFeS2), Tetrahydrite (Cu5Sb2S3). Sulphosals: Boulangerite (5PbS•2Sb2S3), Jamesonite (4PbS•FeS•3Sb2S3), Zinckenite (6PbS•7Sb2S3), Plagionite (5PbS•4Sb2S3), Bournonite PbCu (Sb,As)S3, Pyrargirite (Ag3SbS3). Soil and plant samples were taken at five locations with different levels of Sb, As, and polymetallic contamination. Both pseudototal (aqua regia soluble) and extractable (EDTA) concentrations of metals from sites with low (sites 1 and 2), moderate (site 3 and 4) and high (sites 5 and 6) pollutant burdens were studied. The range of agua regia and EDTA values in mgkg-1 is as follows: Sb 8-2904 and 0.88-44; As: 33-16186 and 3.2-167; Pb: 79-4794 and 49-397; Cu: 66-712 and 48-56 mg•kg-1, respectively). While sites 1 to 4 had alkaline soil pH (7.4-8.7), sites 5 and 6 were acidic with values of 6 and 4.6, respectively. Different herbaceous plant species (Poa annua, Echium vulgare, Sonchus asper, Barbera verna among others) at the low and moderately polluted sites were able to efficiently restrict Sb and As transport to shoots showing average concentration ranges between 5.5 and 23 mg/kg As and 1.21 mg/kg and 4.9 mg/kg Sb. However, at the highly polluted acidic sites (5 and

  19. 21 CFR 137.305 - Enriched farina.

    Science.gov (United States)

    2010-04-01

    ... identity prescribed for farina by § 137.300, except that: (1) It contains in each pound not less than 2.0... a part of a trademark or brand, then other written, printed, or graphic matter that is also a part of the trademark or brand may so intervene, if such statement is in such juxtaposition with...

  20. Cs-137 in milk and in humans

    International Nuclear Information System (INIS)

    In 1984, whole body counters were used on 12 people to detect incorporated Cs-137. The measured concentrations were 1540 mBq/kg on average and reached a maximum of 5440 mBq/kg. These values from Bremen are surprisingly high in comparison with the average values stated by the Federal Board of Health in 1979 and by the KfK in 1981. The author believes this is due to the fact that some of the people examined drink a lot of milk. This opinion - or at least this tendency - was confirmed by using a retention function. The Cs-137 concentrations in milk samples taken purposefully were up to 1320 mBq/l. The results allow the conclusion that person drinking 1 to 1.5 l milk a day take in up to 5 times the quantity of Cs-137 of an average eater. With the people examined in Bremen this lead to a maximum whole body dose of about 10 μSv/a from Cs-137. (orig./HP)

  1. 7 CFR 1150.137 - Procedure.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order National Dairy Promotion and Research Board § 1150.137 Procedure. (a) A majority of the...

  2. 137Cs metabolism in pregnant women

    International Nuclear Information System (INIS)

    Data from two pregnant women contaminated with 137Cs, body burdens of 0.2 and 300 MBq, respectively at the time of the Goiania accident, were compared. The first one, with lower body burden was exposed during the fourth month of pregnancy, while the second became pregnant three years and eight months after 137Cs intake. For the first woman 137Cs concentrations were equal for the mother, infant and placenta, indicating an easy and homogeneous transport of 137Cs from mother to foetus. The whole body monitoring data from the second woman, who became pregnant four years after intake, did not show a reduction in biological half-life during the pregnancy. Cs concentration in the mother was found to be 13 times higher than in the infant. One possible reason for this result is that four years after intake, Cs is supposed to be concentrated mainly in skeletal muscle tissue. During the pregnancy the blood flux becomes higher in most of the organs and tissues except brain, liver and skeletal muscle tissue. (author)

  3. 42 CFR 137.280 - Construction Definitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Construction Construction Definitions § 137... environmental assessment nor an environmental impact statement is required. Any procedures under this section... environmental effect. CEQ means Council on Environmental Quality in the Office of the President....

  4. 14 CFR 137.11 - Certificate required.

    Science.gov (United States)

    2010-01-01

    ... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS AGRICULTURAL AIRCRAFT OPERATIONS Certification Rules § 137.11 Certificate required. (a) Except as provided in paragraphs (c) and (d) of this... dispensing of water on forest fires by rotorcraft external-load means, need not comply with this subpart....

  5. Comparison of oral itraconazole and intramuscular meglumine antimoniate in the treatment of cutaneous leishmaniasis

    International Nuclear Information System (INIS)

    To compare the efficacy and tolerability of oral itraconazole against intramuscular meglumine antimoniate in the treatment of Cutaneous Leishmaniasis (CL). Two hundred eligible and consenting patients of Cutaneous Leishmaniasis (CL) were divided in two groups with 100 patients in each. The number and location of the lesions were documented and clinical types of cutaneous leishmaniasis were noted. The diagnosis was confirmed by skin slit smear and histopathology of the lesional skin. Culture on Nicolle Novy MacNeal (NNN) medium and Leishmanin test was done in all patients. All the patients in both groups were subjected to complete blood picture, urine examination, serum urea and creatinine levels and ECG examination. One group was given itraconazole 100 mg twice daily orally for a duration of 6-8 weeks. The other group was given meglumine antimoniate 10 cc in the form of deep intramuscular injections for 15-30 days. The efficacy of the treatment was judged by clinical and parasitological response. Side effects of the agents were also noted during treatment. Out of 200 patients studied, 185 were males and 15 were females. The mean age of presentation was 30 + 6.6 years. Single lesion was seen in 132 (66%) subjects whereas 68 (34%) subjects had multiple lesions. Slit skin smears were positive in 50 (25%) of the patients. Skin biopsy yielded the presence of LT bodies in 150 (75%) subjects. The culture was positive in 102 (51%) cases. Leishmanin test was positive in 94% subjects. Seventy-five (75%) patients on itraconazole therapy showed complete clinical and parasitological cure in 4-8 weeks duration. A rise in ALT was seen in 12% subjects. Five (5%) subjects did not show any improvement till the end of therapy. Sixty-five (65%) subjects on meglumine antimoniate showed complete healing in 15-30 days. In 35 (35%) of the patients, the treatment had to be stopped due to intolerable side-effects. Four cases of lupoid leishmaniasis and 4 cases of sporotrichoid leishmaniasis

  6. Study on determination of antimony in environmental samples by nuclear technique neutron activation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Tassiane Cristina Gomes; Saiki, Mitiko [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2010-07-01

    Full text: The Interest on determination of antimony in environmental samples has increased significantly in recent years due to the impact caused by human activities and their potential cumulative toxic at low concentrations, apart from not having known biological function. However, the quantification of antimony has interference problems due to low concentrations that hinder its analysis. Therefore becomes of great interest to establish adequate procedures for neutron activation analysis (NAA) to obtain reliable results in environmental samples. In this context, reference materials INCT-TL-1 Tea Leaves, INCT-MPH -2 Mixed Polish Herbs, CTA-VTL-2 Virginia Tobaco Leaves, White Cabbage BCR-679, IAEA 140/TM Seaweed (Focus sp), IAEA -SL-1 Lake Sediment and IAEA-336 Lichen, were selected for analysis and evaluation of results. Aliquots of these standard synthetic materials and antimony were irradiated in the nuclear research reactor IEA-R1 under thermal neutron flux of approximately 5 x 1012 cm{sup -2} s{sup -1} for a period of 8 or 16 hours. After appropriate decay time, the induced gamma activity of the irradiated samples and standard was measured using hyperpure Ge detector coupled to the digital spectrum analyzer DAS 1000, both from Canberra. The radioisotopes measured with gamma ray energies and the half-life were Sb-122 (E{gamma} = 564keV ; t1=2 = 2:7d) and Sb - 124 (E{gamma} = 1692keV; t1=2 60:2d). Antimony concentrations were calculated by the comparative method and the uncertainties of the results were estimated using statistical error of the sample and standard counts Results obtained in these analyses showed a good agreement with certified values and relative errors varying from 0.78 to 13.8%. The values of the standardized difference or Z-scores obtained were lower than 2, indicating that the obtained data were within the range of certified values at a significance level of 68%, demonstrating the suitability of the method used for determination of antimony

  7. Study on determination of antimony in environmental samples by nuclear technique neutron activation analysis

    International Nuclear Information System (INIS)

    Full text: The Interest on determination of antimony in environmental samples has increased significantly in recent years due to the impact caused by human activities and their potential cumulative toxic at low concentrations, apart from not having known biological function. However, the quantification of antimony has interference problems due to low concentrations that hinder its analysis. Therefore becomes of great interest to establish adequate procedures for neutron activation analysis (NAA) to obtain reliable results in environmental samples. In this context, reference materials INCT-TL-1 Tea Leaves, INCT-MPH -2 Mixed Polish Herbs, CTA-VTL-2 Virginia Tobaco Leaves, White Cabbage BCR-679, IAEA 140/TM Seaweed (Focus sp), IAEA -SL-1 Lake Sediment and IAEA-336 Lichen, were selected for analysis and evaluation of results. Aliquots of these standard synthetic materials and antimony were irradiated in the nuclear research reactor IEA-R1 under thermal neutron flux of approximately 5 x 1012 cm-2 s-1 for a period of 8 or 16 hours. After appropriate decay time, the induced gamma activity of the irradiated samples and standard was measured using hyperpure Ge detector coupled to the digital spectrum analyzer DAS 1000, both from Canberra. The radioisotopes measured with gamma ray energies and the half-life were Sb-122 (Eγ = 564keV ; t1=2 = 2:7d) and Sb - 124 (Eγ = 1692keV; t1=2 60:2d). Antimony concentrations were calculated by the comparative method and the uncertainties of the results were estimated using statistical error of the sample and standard counts Results obtained in these analyses showed a good agreement with certified values and relative errors varying from 0.78 to 13.8%. The values of the standardized difference or Z-scores obtained were lower than 2, indicating that the obtained data were within the range of certified values at a significance level of 68%, demonstrating the suitability of the method used for determination of antimony in this type sample

  8. Distribution of Cs-137 in lake sediment

    International Nuclear Information System (INIS)

    This study on Cs-137 from the Chernobyl accident was conducted in Lake Raaksjoen, an oligotrophic, mesohumic lake in central Sweden. The purpose was to determine the areal as well as the vertical distribution of Cs-137 in lake sediment and to see if the results could be explained by parameters such as morphometry of the lake, wind exposure, currents, wave action etc. Sediments cores were taken on 19 sites in March 1992 when the lake still was ice covered and these sampling-sites were spread all over the lake. The sediment cores were taken to the laboratory and sliced into 0.5-1 cm increments down to a sediment depth of 10 cm. The sediment increments were analysed on physical parameters such as density and water content and chemical parameters like C, N, Fe, Mn and Ca together with a measure of Cs-137 concentrations using a sodium iodine detector. The average concentration of cesium-137 in the sediment in Lake Raaksjoen was 30-35 kBq/m2, which coincide with the amount deposited on the lake (30-40 kBq/m2). There was a clear tendency for the concentration to increase with water depth, as a result of sediment focusing. The vertical distribution of Cs-137 was quite uniform for all sampling-sites with a peak about a centimeter down in the sediment and then decreasing concentrations downwards to a negligible value not affected by the Chernobyl accident at a sediment depth of 10 cm. There were no connections found between cesium content and other substances analysed

  9. Standardization of 137mCs+137mBa by Liquid Scintillation

    International Nuclear Information System (INIS)

    A procedure for the preparation of a stable, homogeneous solution of 137Cs+''137mBa, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51 % (k=l). (Author) 5 refs

  10. Dicty_cDB: SHG137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHG137 (Link to dictyBase) - - - Contig-U16411-1 SHG137P (Link to Original ... EISPNSLFLQVLRSAARHQKNNGDSHLAVDHLILGLLDDRDILSVLGDAG ATK --- ---TEAVRRRPYSVVLFDEVEKAHQQVWNVLLQVLDEGRLTDGQGRT ... EISPNSLFLQVLRSAARHQKNNGDSHLAVDHLILGLLDDRDILSVLGDAG ATK --- ---*lkpseedhtv*yclmklkklinkfgmfsykywmkvvlpmvkve ...

  11. Dicty_cDB: VSA137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA137 (Link to dictyBase) - - - Contig-U13981-1 VSA137Z (Link to Original ... i*qeyqiycyn*fyfilsnfqfilksnslf*tnnykqslikslrwqpsy *epf *ittflvvvttyir*kthfqlvwskfqeihnlvvfqkhflhhh*rklmfhl ...

  12. 137Cs in forest ecosystems in Estonia

    International Nuclear Information System (INIS)

    Full text: In the recently published 'Europe's Environment' (1995) one can find the map on 137Cs cumulative deposition in Europe after the Chernobyl accident (source: De Corte et al., 1990). On this map most of the Eastern Europe including Baltic Sea region is practically uncovered. In this reason we decided to present data on accumulation of 137Cs in the forest ecosystems in Estonia. Field sampling for current study has been conducted in 1986 - 1994. 137Cs concentrations were measured in different compartments of model trees, ground vegetation layers, debris and topsoil. The amount of 137Cs varied from 1.9 kBq/m2 in continental Estonia to 28.8 kBq/m2 in north-eastern Ne part of Estonia. The results obtained correspond to data presented in Wahlstroem et al., (1992) for Finland. According to the 'Europe's Environment' criteria northeastern Estonia belongs to the third cumulative deposition zone (10 to 32 kBq/m2). In Estonia the total deposition of 137Cs varies in the range from practically zero to 3.9 kBq/m2 . The calculations of Realo et al. (1994) back to May 1, 1986 gave figures from 0 to 21 kBq/m2. In macro lichens Cetraria, Cladina, Cladonia the rapid changes in 137Cs concentrations were observed: 0.06 - 0.18 kBq/kg in 1982-85, 0.93 - 6.23 kBq/kg in 1986-87, 0.27 -4.26 kBq/kg in 1988-89, 0.05 - 1.46 kBq/kg in 1990-91 and, finally, 0.03 - 0.46 kBq/kg in 1993-94. At the end of the observation period average value of the 137Cs concentrations was the same as maximum before the CRA and decline of the concentrations was 4 times during six years. Average concentrations of 137Cs in two common forest mosses Pleurozium shreberi and Hylocomium splendens was 0.43 kBq/kg of dry matter and in forest debris 0.38 kBq/kg. In 1986 the highest concentration in mushrooms - 16.6 kBq/kg was found in Lactarius sp. (Martin, L., et al., 1991). In 1991 samples of 41 different mushroom species from 63 sample sites mostly in Scots pine stands were analyzed. The highest concentration of

  13. Biological effects of 137Cs, incorporated into organism of rats

    International Nuclear Information System (INIS)

    Results of investigating mutagenous and hemotoxic effects of 137Cs on blood lymphocytes of rats are presented. 137Cs was orally administrated into organism of rats as 270 kBq/g chloride solution. 137Cs mutagenous effect was studied on metaphase plates of rat blood lymphocytes in course of rats lifetime experiment. It is stated that 137Cs inducing severe disturbances of genetic material in a great quantity of blood lymphocytes, causes their total killing

  14. Biodistribution of meglumine antimoniate in healthy and Leishmania (Leishmania infantum chagasi-infected BALB/c mice

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2013-08-01

    Full Text Available Pentavalent antimonials such as meglumine antimoniate (MA are the primary treatments for leishmaniasis, a complex disease caused by protozoan parasites of the genus Leishmania . Despite over 70 years of clinical use, their mechanisms of action, toxicity and pharmacokinetics have not been fully elucidated. Radiotracer studies performed on animals have the potential to play a major role in pharmaceutical development. The aims of this study were to prepare an antimony radiotracer by neutron irradiation of MA and to determine the biodistribution of MA in healthy and Leishmania (Leishmania infantum chagasi-infected mice. MA (Glucantime(r was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes, 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This irradiated compound presented anti-leishmanial activity similar to that of non-irradiated MA in both in vitro and in vivo evaluations. In the biodistribution studies, healthy mice showed higher uptake of antimony in the liver than infected mice and elimination occurred primarily through biliary excretion, with a small proportion of the drug excreted by the kidneys. The serum kinetic curve was bi-exponential, with two compartments: the central compartment and another compartment associated with drug excretion. Radiotracers, which can be easily produced by neutron irradiation, were demonstrated to be an interesting tool for answering several questions regarding antimonial pharmacokinetics and chemotherapy.

  15. Development of an analytical method for antimony speciation in vegetables by HPLC-hydride generation-atomic fluorescence spectrometry.

    Science.gov (United States)

    Olivares, David; Bravo, Manuel; Feldmann, Jorg; Raab, Andrea; Neaman, Alexander; Quiroz, Waldo

    2012-01-01

    A new method for antimony speciation in terrestrial edible vegetables (spinach, onions, and carrots) was developed using HPLC with hydride generation-atomic fluorescence spectrometry. Mechanical agitation and ultrasound were tested as extraction techniques. Different extraction reagents were evaluated and optimal conditions were determined using experimental design methodology, where EDTA (10 mmol/L, pH 2.5) was selected because this chelate solution produced the highest extraction yield and exhibited the best compatibility with the mobile phase. The results demonstrated that EDTA prevents oxidation of Sb(III) to Sb(V) and maintains the stability of antimony species during the entire analytical process. The LOD and precision (RSD values obtained) for Sb(V), Sb(III), and trimethyl Sb(V) were 0.08, 0.07, and 0.9 microg/L and 5.0, 5.2, and 4.7%, respectively, for a 100 microL sample volume. The application of this method to real samples allowed extraction of 50% of total antimony content from spinach, while antimony extracted from carrots and onion samples ranged between 50 and 60 and 54 and 70%, respectively. Only Sb(V) was detected in three roots (onion and spinach) that represented 60-70% of the total antimony in the extracts. PMID:22970588

  16. 21 CFR 137.200 - Whole wheat flour.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Whole wheat flour. 137.200 Section 137.200 Food... Flours and Related Products § 137.200 Whole wheat flour. (a) Whole wheat flour, graham flour, entire wheat flour is the food prepared by so grinding cleaned wheat, other than durum wheat and red...

  17. 25 CFR 137.2 - Availability of water.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Availability of water. 137.2 Section 137.2 Indians BUREAU... COSTS, SAN CARLOS INDIAN IRRIGATION PROJECT, ARIZONA § 137.2 Availability of water. Pursuant to section... notice to announce when water is actually available for lands in private ownership under the project...

  18. 47 CFR 87.137 - Types of emission.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Types of emission. 87.137 Section 87.137... Technical Requirements § 87.137 Types of emission. (a) The assignable emissions, corresponding emission designators and authorized bandwidths are as follows: Class of emission Emission designator...

  19. Quantitative Model for Estimating Soil Erosion Rates Using 137Cs

    Institute of Scientific and Technical Information of China (English)

    YANGHAO; GHANGQING; 等

    1998-01-01

    A quantitative model was developed to relate the amount of 137Cs loss from the soil profile to the rate of soil erosion,According th mass balance model,the depth distribution pattern of 137Cs in the soil profile ,the radioactive decay of 137Cs,sampling year and the difference of 137Cs fallout amount among years were taken into consideration.By introducing typical depth distribution functions of 137Cs into the model ,detailed equations for the model were got for different soil,The model shows that the rate of soil erosion is mainly controlled by the depth distrbution pattern of 137Cs ,the year of sampling,and the percentage reduction in total 137Cs,The relationship between the rate of soil loss and 137Cs depletion i neither linear nor logarithmic,The depth distribution pattern of 137Cs is a major factor for estimating the rate of soil loss,Soil erosion rate is directly related with the fraction of 137Cs content near the soil surface. The influences of the radioactive decay of 137Cs,sampling year and 137Cs input fraction are not large compared with others.

  20. Dicty_cDB: SHC137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHC137 (Link to dictyBase) - - - - SHC137P (Link to Original site) SHC137F ... -05 S23571( S23571 ;S19851) hypothetical protein - fungus ... (Cladosporiu... 52 5e-05 AC007203_3( AC007203 |pid ...

  1. Strontium-90 and cesium-137 in milk

    International Nuclear Information System (INIS)

    The milk samples have been collected from 30 prefectures by prefectural public health laboratories and institutes (raw milk: 4 times per year for the report to WHO, and raw and city milk: 2 times per year), and analysed for strontium-90 and cesium-137 content at Japan Chemical Analysis Center. Collected samples were the raw milk and the city ones for the producing districts and the consuming ones, respectively. Three liters of fresh milk were carbonized in each prefectural public health laboratories and institutes, and then it was asked at Japan Chemical Analysis Center. The ask to which both some carriers and hydrochloric acid were added, was destroyed under heating. The nuclides was dissolved into hydrochloric acid and filtrated, after it was added with nitric acid and heated to dryness. The filtrate was radiochemically analysed for strontium-90 and cesium-137 using the method recommended by Science and Technology Agency. (author)

  2. 90Sr and 137Cs in milk

    International Nuclear Information System (INIS)

    Under the commission of Science and Technology Agency, Japan Chemical Analysis Center has measured the levels of strontium-90 and cesium-137 in milk samples collected in 29 prefectures throughout Japan. Collected samples were the raw milk and the city ones for the producing districts and the consuming districts, respectively. These samples have been collected 2 times a year (for the report to WHO, 4 times of raw milk a year). Three liters of fresh milk were carbonated in each prefectural public health laboratory and institute, and the carbonated samples were collected to Japan Chemical Analysis Center. At Japan Chemical Analysis Center, these collected samples analyzed radiochemically for strontium-90 and cesium-137 using the method applied for the analysis of total diet. (author)

  3. Remediation of soils contaminated by Cs 137

    International Nuclear Information System (INIS)

    After the accident at A-1 reactor in Jaslovske Bohunice NPP (Slovakia) large quantities of soil were also contaminated by cesium-137 after leaks from the liquid waste tanks. This soil was later excavated and is now stored in dedicated radioactive waste depots. Various decontamination methods were tested for the remediation of the samples of this soil. In this paper the electrochemical procedure, electrokinetic mobilisation and thermodesorption procedure were tested

  4. The liquid scintillation counting efficiency for 137mCs+137mBa and ''129 I

    International Nuclear Information System (INIS)

    We compute the liquid scintillation counting efficiency for 137Cs+137mBa and ''129 I taking into account the scintillator chemical composition. We consider the beta transition shape factors for the for bidden beta transitions of these nuclides, and the effects of 137mBa and 129mXe half-lives on the total counting efficiency. (Author) 8 refs

  5. Leachability of antimony from energy ashes. Total contents, leachability and remedial suggestions; Lakning av antimon fraan energiaskor. Totalhalter, lakbarhet samt foerslag till aatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Baeckstroem, Mattias [Oerebro Univ. (Sweden)

    2006-01-15

    In the current project total concentrations for antimony in 31 energy ashes have been compiled. The average concentration of antimony in boiler fly ash and grate boiler fly ash is 192 and 1,140 mg/kg, respectively. The corresponding antimony concentrations for boiler ashes and grate bottom ashes are 86,5 and 61,8 mg/kg, respectively. Multivariate calculations clearly pointed out waste as the major source for antimony in ashes. The difference between total antimony concentration in fly ash and bottom ash is greatest for grate boilers, in average 18 times higher in the fly ash. The difference for CFB/BFB-boilers is only slightly more than 2. However, based on amount, 75% of the total antimony inventory is recovered in the fly ashes for both CFB/BFB and grate boilers. Eleven (eight of which were bottom ashes) out of the 31 samples exceeded the guidelines for inert waste. It is clear that the higher ionic strength in the solutions from the fly ashes contribute to decrease the solubility for critical minerals retaining antimony. In addition, the fly ashes have considerably larger effective surface able to sorb trace elements. A clear and positive covariance was discovered between aluminium and antimony. Furthermore, it was noted that antimony showed no typical anionic behaviour despite the fact that it according to the geochemical calculations should be present as SbO{sub 3}{sup -}. At L/S 10, a maximum of 1% of the total antimony concentration is leached. This should be compared to chloride that had 94% of the total concentration leached at L/S 10. There was no correlation between the leached antimony concentrations and the total antimony concentrations. The sequential extractions also suggest a low leachability for antimony from the ashes. In average only 9,6% is released at pH 7, 7,3% at pH 5, 3,6% during reducing conditions and 3,2% during oxidising conditions. In total, only 24% of the total antimony concentrations is released during the four extraction steps. The

  6. Selective liquid-liquid extraction of antimony(III from hydrochloric acid media by N-n-octylaniline in xylene

    Directory of Open Access Journals (Sweden)

    M. A. ANUSE

    2004-04-01

    Full Text Available N-n-Octylaniline in xylene was used for the extraction separation of antimony(III from hydrochloric acid media. Antimony(III was extracted quantitatively with 10 mL 4 % N-n-octylaniline in xylene. It was stripped from the organic phase with 0.5 M ammonia and estimated photometrically by the iodide method. The effect of metal ion, acid, reagent concentration and various foreign ions was investigated. The method affords binary and ternary separation of antimony(III from tellurium(IV, selenium(IV, lead(II, bismuth(III, tin(IV, germanium(IV, copper(II, gold(III, iron(III and zinc(II. The method is applicable for the analysis of synthetic mixtures, alloys and semiconductor thin films. It is fast, accurate and precise.

  7. Synthesis, characterization and single crystal X-ray analysis of chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III

    Directory of Open Access Journals (Sweden)

    H.P.S. Chauhan

    2015-07-01

    Full Text Available The title compound chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III has been prepared in distilled acetonitrile and characterized by physicochemical [melting point and molecular weight determination, elemental analysis (C, H, N, S & Sb], spectral [FT–IR, far IR, NMR (1H & 13C] studies. The crystal and molecular structure was further confirmed using single crystal X-ray diffraction analysis which features a five-coordinate geometry for antimony(III within a ClS4 donor set. The distortion in the co-planarity of ClSbS3 evidences the stereochemical influence exerts by the lone pair of electrons on antimony(III. Two centrosymmetrically related molecule held together via C–H···Cl secondary interaction result in molecular aggregation of the compound.

  8. Pharmacokinetics and tissue distribution of Antimony after multiple intramuscular administrations in the Hamster

    International Nuclear Information System (INIS)

    The fate of pentavalent antimony (Sb) in different tissues in the body after intramuscular administration is of great interest for the future study of Sb therapy in different sitting. Pharmacokinetics and tissue distribution of antimony (Sb) were studied in the hamster after daily dose of sodium stibogluconate equivalent to 120 mg kg of Sb, administered intramuscularly for two weeks. Liver, spleen, heart, kidney and skin tissues were isolated after blood collection at the specified time. Antimony was measured in these tissues after suitable treatment, ashing and processing, by flame less atomic absorption spectrophotometry. The concentration of Sb time profile in blood showed a linear raid decline with elimination half life (tz1/2) of 1.7h. The concentration of drug (ug/gm) declined in a biphasic manner from almost all tissues. However, the concentrations of Sb were declined in slower fashion from the hamster tissues than from the blood. The maximum concentration of Sb was determined in the kidney tissues (3416+-631ug/gm) while the lowest concentration was in the spleen (209+-187ug/gm). The maximum concentration of Sb in the kidney (ug/gm) was more than 25 fold higher than that measured from blood (ug/ml). The AUC of Sb in the studied tissues was in this rank: kidney>liver>skin>spleen>heart>blood. Surprisingly, the heart, spleen and liver showed a similar t1/2 of 5.2-6.2h while the kidney and skin had a t1/2 of about 3h. Therefore, disposition of Sb seems to kinetically follow multicompartmental compartmental model. The kidneys got the highest concentration of drug which may lead to nephrotoxicity on long term therapy. (author)

  9. Lithium-antimony-lead liquid metal battery for grid-level energy storage

    Science.gov (United States)

    Wang, Kangli; Jiang, Kai; Chung, Brice; Ouchi, Takanari; Burke, Paul J.; Boysen, Dane A.; Bradwell, David J.; Kim, Hojong; Muecke, Ulrich; Sadoway, Donald R.

    2014-10-01

    The ability to store energy on the electric grid would greatly improve its efficiency and reliability while enabling the integration of intermittent renewable energy technologies (such as wind and solar) into baseload supply. Batteries have long been considered strong candidate solutions owing to their small spatial footprint, mechanical simplicity and flexibility in siting. However, the barrier to widespread adoption of batteries is their high cost. Here we describe a lithium-antimony-lead liquid metal battery that potentially meets the performance specifications for stationary energy storage applications. This Li||Sb-Pb battery comprises a liquid lithium negative electrode, a molten salt electrolyte, and a liquid antimony-lead alloy positive electrode, which self-segregate by density into three distinct layers owing to the immiscibility of the contiguous salt and metal phases. The all-liquid construction confers the advantages of higher current density, longer cycle life and simpler manufacturing of large-scale storage systems (because no membranes or separators are involved) relative to those of conventional batteries. At charge-discharge current densities of 275 milliamperes per square centimetre, the cells cycled at 450 degrees Celsius with 98 per cent Coulombic efficiency and 73 per cent round-trip energy efficiency. To provide evidence of their high power capability, the cells were discharged and charged at current densities as high as 1,000 milliamperes per square centimetre. Measured capacity loss after operation for 1,800 hours (more than 450 charge-discharge cycles at 100 per cent depth of discharge) projects retention of over 85 per cent of initial capacity after ten years of daily cycling. Our results demonstrate that alloying a high-melting-point, high-voltage metal (antimony) with a low-melting-point, low-cost metal (lead) advantageously decreases the operating temperature while maintaining a high cell voltage. Apart from the fact that this finding

  10. Development and pharmacokinetic of antimony encapsulated in liposomes of phosphatidylserine using radioisotopes in experimental leishmaniasis

    International Nuclear Information System (INIS)

    Leishmaniasis are a complex of parasitic diseases caused by intra macrophage protozoa of the genus Leishmania, and is fatal if left untreated. Pentavalent antimonials, though toxic and their mechanism of action being unclear, remain the first-line drugs for treatment. Effective therapy could be achieved by delivering antileishmanial drugs to these sites of infection. Liposomes are phospholipid vesicles that promote improvement in the efficacy and action of drugs in target cell. Liposomes are taken up by the cells of mononuclear phagocytic system (MPS). The purpose of this study was to develop a preparation of meglumine antimonate encapsulated in liposomes of phosphatidylserine and to study its pharmacokinetic in healthy mice to establish its metabolism and distribution. Quantitative analysis of antimony from liposomes demonstrated that Neutron Activation Analysis was the most sensitive technique with almost 100 % of accuracy. All liposome formulations presented a mean diameter size of 150 nm. The determination of IC50 in infected macrophage showed that liposome formulations were between 10 - 63 fold more effective than the free drug, indicating higher selectivity index. By fluorescence microscopy, an increased uptake of fluorescent-liposomes was seen in infected macrophages during short times of incubation compared with non-infected macrophages. Biodistribution studies showed that meglumine antimonate irradiated encapsulated in liposomes of phosphatidylserine promoted a targeting of antimony for MPS tissues and maintained high doses in organs for a prolonged period. In conclusion, these data suggest that meglumine antimonate encapsulated in liposomes showed higher effectiveness than the non-liposomal drug against Leishmania infection. The development of liposome formulations should be a new alternative for the chemotherapy of infection diseases, especially Leishmaniasis, as they are used to sustain and target pharmaceuticals to the local of infection. (author)

  11. The LABCG2 Transporter from the Protozoan Parasite Leishmania Is Involved in Antimony Resistance.

    Science.gov (United States)

    Perea, Ana; Manzano, José Ignacio; Castanys, Santiago; Gamarro, Francisco

    2016-06-01

    Treatment for leishmaniasis, which is caused by Leishmania protozoan parasites, currently relies on a reduced arsenal of drugs. However, the significant increase in the incidence of drug therapeutic failure and the growing resistance to first-line drugs like antimonials in some areas of Northern India and Nepal limit the control of this parasitic disease. Understanding the molecular mechanisms of resistance in Leishmania is now a matter of urgency to optimize drugs used and to identify novel drug targets to block or reverse resistant mechanisms. Some members of the family of ATP-binding cassette (ABC) transporters in Leishmania have been associated with drug resistance. In this study, we have focused our interest to characterize LABCG2's involvement in drug resistance in Leishmania. Leishmania major parasites overexpressing the ABC protein transporter LABCG2 were generated in order to assess how LABCG2 is involved in drug resistance. Assays of susceptibility to different leishmanicidal agents were carried out. Analysis of the drug resistance profile revealed that Leishmania parasites overexpressing LABCG2 were resistant to antimony, as they demonstrated a reduced accumulation of Sb(III) due to an increase in drug efflux. Additionally, LABCG2 was able to transport thiols in the presence of Sb(III) Biotinylation assays using parasites expressing LABCG2 fused with an N-terminal green fluorescent protein tag revealed that LABCG2 is partially localized in the plasma membrane; this supports data from previous studies which suggested that LABCG2 is localized in intracellular vesicles that fuse with the plasma membrane during exocytosis. In conclusion, Leishmania LABCG2 probably confers antimony resistance by sequestering metal-thiol conjugates within vesicles and through further exocytosis by means of the parasite's flagellar pocket. PMID:27021316

  12. Antimony film sensor for sensitive rare earth metal analysis in environmental samples.

    Science.gov (United States)

    Makombe, Martin; van der Horst, Charlton; Silwana, Bongiwe; Iwuoha, Emmanuel; Somerset, Vernon

    2016-07-01

    A sensor for the adsorptive stripping voltammetric determination of rare earth elements has been developed. The electrochemical procedure is based on the oxidation of the rare earth elements complexed with alizarin complexone at a glassy carbon electrode that was in situ modified with an antimony film, during an anodic scan from -0.2 V to 1.1 V (vs. Ag/AgCl) and deposition potential of -0.1 V (vs. Ag/AgCl). The factors influencing the adsorptive stripping capability were optimised, including the complexing agent concentration, plating concentration of antimony and deposition time. The detection of rare earth elements (La, Ce and Pr) were realised in 0.08 M sodium acetate (pH = 5.8) solution as supporting electrolyte, with 2 × 10(-6) M alizarin complexone and 1.0 mg L(-1) antimony solution. Under the optimised conditions, a deposition time of 360 s was obtained and a linear response was observed between 1 and 25 µg L(-1). The reproducibility of the voltammetric measurements was found to be within 5.0% RSD for 12 replicate measurements of cerium(III) concentration of 5 µg L(-1) using the same electrode surface. The detection limits obtained using stripping analysis was 0.06, 0.42 and 0.71 μg L(-1) for Ce(III), La(III) and Pr(III), respectively. The developed sensor has been successfully applied for the determination of cerium, lanthanum and praseodymium in municipal tap water samples. PMID:27065049

  13. Determination of PM10 deposition based on antimony flux to selected urban surfaces

    International Nuclear Information System (INIS)

    Deposition of PM10 particles to several types of urban surfaces was investigated within this study. Antimony was chosen as a tracer element to calculate dry deposition velocities for PM10, since antimony proved to be present almost exclusively in PM10 particles in ambient urban air. During 18 months, eight sampling sites in Berlin and Karlsruhe, two cities in Germany, were operated. PM10 concentrations and dry deposition were routinely sampled as two week averages. Additionally, leaf-samples were collected at three sites with tall vegetation. The obtained deposition velocities ranged from 0.8 to 1.3 cm s-1 at roadside sites and from 0.4 to 0.5 cm s-1 at the other sites. With reference to the whole canopy, additional deposition velocities of about 0.5 cm s-1 were obtained for leaf surfaces. As a consequence, it can be concluded that vegetation-covered areas beside streets show the highest potential to capture particles in urban areas. - Highlights: → Deposition velocities of PM10 were determined using Sb as a tracer element. → Dry PM10 deposition velocities ranged from 0.8 to 1.3 cm s-1 at roadside sites. → Dry PM10 deposition velocities ranged from 0.4 to 0.5 cm s-1 at other urban sites. → Additional deposition velocities of 0.5 cm s-1 were obtained for leaf surfaces. - Antimony is used as a tracer element to calculate dry deposition velocities of PM10 particles to selected urban surfaces.

  14. Reactive barriers for 137Cs retention

    International Nuclear Information System (INIS)

    137Cs was dispersed globally by cold war activities and, more recently, by the Chernobyl accident. Engineered extraction of 137Cs from soils and groundwaters is exceedingly difficult. Because the half life of 137Cs is only 30.2 years, remediation might be more effective (and less costly) if 137Cs bioavailability could be demonstrably limited for even a few decades by use of a reactive barrier. Essentially permanent isolation must be demonstrated in those few settings where high nuclear level wastes contaminated the environment with 135Cs (half life 2.3x106 years) in addition to 137Cs. Clays are potentially a low-cost barrier to Cs movement, though their long-term effectiveness remains untested. To identify optimal clays for Cs retention Cs resorption was measured for five common clays: Wyoming Montmorillonite (SWy-1), Georgia Kaolinites (KGa-1 and KGa-2), Fithian Illite (F-Ill), and K-Metabentonite (K-Mbt). Exchange sites were pre-saturated with 0.16 M CsCl for 14 days and readily exchangeable Cs was removed by a series of LiNO3 and LiCl washes. Washed clay were then placed into dialysis bags and the Cs release to the deionized water outside the bags measured. Release rates from 75 to 139 days for SWy-1, K-Mbt and F- 111 were similar; 0.017 to 0.021% sorbed Cs released per day. Both kaolinites released Cs more rapidly (0.12 to 0.05% of the sorbed Cs per day). In a second set of experiments, clays were doped for 110 days and subjected to an extreme and prolonged rinsing process. All the clays exhibited some capacity for irreversible Cs uptake so most soils have some limited ability to act as a natural barrier to Cs migration. However, the residual loading was greatest on K-Mbt (∼ 0.33 wt% Cs). Thus, this clay would be the optimal material for constructing artificial reactive barriers

  15. Fractionation of 137Cs and Pu in natural peatland

    International Nuclear Information System (INIS)

    High Cs-137 concentrations in plants growing on peatland inspired us to investigate the quantity of its bioavailable fraction in natural peat. Our investigation aims to: a) estimate the quantity of bioavailable Cs-137 and Pu present in peat, b) verify the similarity of Cs-137 and K-40 behaviours, and c) perform a quantification of Cs-137 and Pu transfer from peat to plants. We analysed the vertical distribution of Cs-137 and Pu isotopes in the peat and their concentrations in plants growing on these places. Bioavailability of radionuclides was investigated by sequential extraction. Sequential analyses revealed that it was the upper layer which contained the majority of Cs-137 in an available form while deeper layers retained Cs-137 in immobile fractions. We can conclude that 18% of all Cs-137 in the peat is still bioavailable. Despite of the low quantity of bioavailable fraction of Cs-137 its transfer factor reached extremely high values. In the case of Pu, 64% of its total amount was associated with fulvic/humic acids which resulted in the high transfer factor from peat to plants. 27 years after the Chernobyl nuclear accident, the significant part of radionuclides deposited in peatland is still bioavailable. - Highlights: • Decrease of exchangeable 137Cs and its increase in residual fraction with depth. • High 137Cs transfer factor contrary to its low quantity in bioavailable fractions. • Fulvic/humic acids are a more effective carrier for Pu than for Cs

  16. Separation of antimony from synthetic cloth. Application in forensic science using neutron activation analysis

    International Nuclear Information System (INIS)

    A simple ion-exchange separation procedure was developed for selective removal of antimony from synthetic cloth to facilitate determination of several trace elements frequently used to identify gunshot residues by neutron activation analysis. Radiotracers of Sb, Ba, Cu, Co, As, Zn, Hg and Ag were employed to optimize the developed procedure. The method involves the quantitative retention of the above elements, except of Sb, from 0.2M ammonium carbonate solution using Chelex 100 resin and subsequent quantitative elution of the elements of interest with 2M nitric acid for gamma-ray spectrometry. The procedure was tested by simulated gunshot residues. (author)

  17. Investigation of adsorption interaction of cadmium oxide with antimony (3) in alkaline solutions

    International Nuclear Information System (INIS)

    Adsorption processes on cadmium oxide in pure antimonite alkaline (KOH) solutions and in the presence of organic additions (sodium salt of carboxymethylcellulose, straw oil) have been studied. It is shown, that in the systems being studied, the chemosorptional interaction, leading to a sharp change in the adsorbent surface state is observed. It is established that the formation of a surface high-disperse cadmium oxide-antimony com ound on the cadmium oxide results in practically complete suppression of the cadmium oxide hydration process in aqueous solutions

  18. Polymorphism and properties of Bi{sub 2}WO{sub 6} doped with pentavalent antimony

    Energy Technology Data Exchange (ETDEWEB)

    Kharitonova, E.P.; Belov, D.A. [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Gagor, A.B.; Pietraszko, A.P. [W. Trzebiatowski Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Okólna 2, 50-950 Wrocław (Poland); Alekseeva, O.A. [Shubnikov Institute of Crystallography, Russian Academy of Sciences, Leninsky pr. 59, 119333 Moscow (Russian Federation); Voronkova, V.I., E-mail: voronk@polly.phys.msu.ru [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation)

    2014-04-05

    Highlights: • The limit of Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions is at x = 0.05. • Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} does not fully transform into high-temperature monoclinic phase. • Sb{sup 5+} has a weak effect on the temperatures of the ferroelectric transitions. • γ→γ{sup ‴} transition near 650 °C was observed as strong permittivity peak at 0.01–8 Hz. • The conductivity of Bi{sub 2}W{sub 0.96}Sb{sub 0.04}O{sub 6−y} at 800 °C reaches 0.02 S/cm. -- Abstract: Antimony-containing solid solutions isostructural with bismuth tungstate, Bi{sub 2}WO{sub 6}, have been prepared in air as polycrystalline samples by solid-state reactions and as single crystals by unseeded flux growth. The antimony in the solid solutions is in a pentavalent state and substitutes for tungsten in the structure of Bi{sub 2}WO{sub 6}. The Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions have been shown to exist in the composition range 0 ⩽ x ⩽ 0.05. We have examined the effect of Sb{sup 5+} doping on the polymorphism and properties of Bi{sub 2}WO{sub 6}. In contrast to undoped Bi{sub 2}WO{sub 6}, antimony-substituted bismuth tungstate does not completely transform into its high-temperature, monoclinic phase at 960 °C and remains two-phase up to temperatures approaching its melting point. Antimony substitution for tungsten has a weak effect on the temperatures of the ferroelectric phase transitions. Heterovalent substitution of Sb{sup 5+} for W{sup 6+} is accompanied by the formation of extra oxygen vacancies and an increase in the electrical conductivity of the solid solutions by one to two orders of magnitude relative to undoped Bi{sub 2}WO{sub 6}.

  19. Influence of arsenic,antimony and cobalt impurities on the cathodic process in zinc electrowinning

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    By means of an electrochemical study,the influence of arsenic,antimony and cobalt on cathodic polarization in the zinc electrowinning process,the associated kinetic equations and parameters,and the polarization mechanism have been studied.The results show that the experimental values of the kinetic parameters are in accord with the theoretical values in the ZnSO4/H2SO4 solution with a single impurity is added.In contrast,the charge transfer coefficient α is smaller than the theoretical value in the ZnSO4/H2SO4 solution when the three impurities are added together.

  20. Determination of arsenic, selenium and antimony by neutron activation analysis. Application to hair samples

    International Nuclear Information System (INIS)

    A fast rabbit system for instrumental activation analysis with reactor neutrons is described. Its use in the determination of selenium in hair is discussed. A survey is given of the correction factors which are inherent to the use of short-lived radionuclides. An alternative to INAA is NAA based on the separation of arsenic, selenium and antimony by hydride evaporation and adsorption to active carbon. Data for some Standard Reference Materials are given. This work was done under research contract 2440/RI/RB with the IAEA

  1. Impact of Biofield Treatment on Physical, Structural and Spectral Properties of Antimony Sulfide

    OpenAIRE

    Trivedi, Mahendra Kumar

    2015-01-01

    Antimony sulfide (Sb2S3) has gained extensive attention in solar cells due to their potential as a low-cost and earth abundant absorber material. In solar cell absorber, the optoelectrical properties such as energy band gap and absorption coefficient of Sb2S3play an important role, which have strong relationships with their crystal structure, lattice parameter and crystallite size. Hence in the present investigation, Sb2S3 powder samples were exposed to biofield treatment, and furthe...

  2. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Science.gov (United States)

    Liu, Zhimeng; Zhu, Mengfu; Wang, Zheng; Wang, Hong; Deng, Cheng; Li, Kui

    2016-05-01

    A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2)/carbon aerogel (CA) for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  3. Electromagnetic absorption and shielding behavior of polyaniline-antimony oxide composites

    Science.gov (United States)

    Faisal, Muhammad; Khasim, Syed

    2013-02-01

    This work highlights the microwave absorption and electromagnetic interference (EMI) shielding properties of synthesized polyaniline (PAni)-antimony oxide (Sb2O3) composites in the 8-12 GHz (X-band) range. These composites showed absorption dominated EMI shielding effectiveness (EMI SEA) of -34 to -40 dB (> 99 % attenuation), indicating their shielding potential throughout the X-band. Our analyses reveal that the Sb2O3 particles in PAni matrix have key impact in determining the microwave absorption properties of the composites.

  4. Surface functionalization of mesoporous antimony doped tin oxide by metalorganic reaction

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Haase, F.; Rathouský, Jiří; Fattakhova-Rohlfing, D.

    2012-01-01

    Roč. 137, č. 1 (2012), s. 207-212. ISSN 0254-0584 Institutional support: RVO:61388955 Keywords : oxides * organometallic compounds * chemical synthesis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.072, year: 2012

  5. CD137-mediated immunotherapy for allergic asthma

    OpenAIRE

    Polte, Tobias; Foell, Juergen; Werner, Christoph; Hoymann, Heinz-Gerd; Braun, Armin; Burdach, Stefan; Mittler, Robert S.; Hansen, Gesine

    2006-01-01

    The prevalence of asthma continues to increase. Asthma is caused by a Th2 cell–driven immune response. Its optimal treatment remains a challenge, and a sufficient immunotherapeutic approach to treating asthma has yet to be found. Using a murine asthma model, we show that a single injection of an anti-CD137 (4-1BB) mAb prevents the development of airway hyperreactivity, eosinophilic airway inflammation, excessive mucus production, and elevated IgE during the observation period of 7 weeks. Most...

  6. Separation of 137Cs from nuclear waste

    International Nuclear Information System (INIS)

    Sodium zirconate is one member of a family of new inorganic ion exchange materials which have high affinity for all actinides and fission product cations except for Cs+. A combination of cold, tracer and high level liquid waste experiments with sodium zirconate has shown that 70 to 80 and 80 to 100% of the Cs+ in high level liquid waste remains in solution following batch or column equilibration, respectively. The fact that 137Cs can be obtained in relatively pure form permits subsequent conversion directly to an insoluble radiation source. This is of prime importance in areas such as sewage sludge sterilization via γ-ray irradiation. (author)

  7. Caesium-137 Chloride Retention following Accidental Ingestion

    International Nuclear Information System (INIS)

    Four men became contaminated with caesium-137 chloride due to leaks in a 100 c source. The source was believed to be completely leak proof, since the caesium chloride was contained in a welded stainless-steel capsule which was covered with an outer steel jacket of standard Oak Ridge design. Most of the contamination occurred while the men were cleaning the components of a pneumatic device used to move the source. The most heavily- contaminated individual placed his mouth over the end of a transport tube and attempted to blow some ''dust'' out of the tube. The other men handled various parts of the transport mechanism and wiped ''dust'' out of holes with their fingers. None of the men washed their hands before eating lunch. When radioactive contamination was discovered on the following day, immediate efforts were made to decontaminate the men. Arrangements for whole-body counts were also made and, on the fifth day following contamination, the men reported to the Radiation Exposure Evaluation laboratory. The body burdens on the fifth day ranged from 35 - 970 nc of caesium-137. During the next five to six days the burdens dropped rapidly and on the eleventh day ranged from 28- 780 nc. After the eleventh day the body burdens of caesium-137 changed much more slowly. Whole-body counts made between the 11th and 160th day yielded biological half-lives of 76, 95 and 126 d for the three most heavily-contaminated individuals. During the period of rapid excretion all urine and faeces were collected and counted. These counts indicated a considerable superficial contamination prior to the eleventh day since only a portion of the removed caesium-137 was found in the urine and stool specimens. The body burdens of the four men are compared with normals of the same size, build, age and diet habits. A short discussion of normal burdens is included. A brief description of the counting system, data handling techniques and calibration procedures is also included. (author)

  8. Effect of antimony incorporation on structural properties of CuInS{sub 2} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Ben Rabeh, M., E-mail: mohamedbenrabeh@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Chaglabou, N., E-mail: nadia_chaglabou@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Kanzari, M., E-mail: Mounir.Kanzari@ipeit.rnu.t [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia)

    2010-02-15

    CuInS{sub 2} (CIS) single crystals doped with 1, 2, 3 and 4 atomic percent (at.%) of antimony (Sb) were grown by the horizontal Bridgman method. The effect of Sb doping on the structural properties of CIS crystal was studied by means of X-ray diffraction (XRD), energy dispersive X-ray analysis (EDAX), scanning electron microscopy (SEM) and PL measurements. X-ray diffraction data suggests that the doping of Sb in the CIS single crystals does not affect the tetragonal (chalcopyrite) crystal structure and exhibited a (1 1 2) preferred orientation. In addition, with increasing Sb concentration, the X-ray diffraction analysis show that Sb doped CIS crystals are more crystallized and the diffraction peaks of the CuInS{sub 2} phase were more pronounced in particular the (1 1 2) plane. EDAX study revealed that Sb atoms can occupy the indium site and/or occupying the sulfur site to make an acceptor. PL spectra of undoped and Sb doped CIS crystals show two emission peaks at 1.52 and 1.62 eV, respectively which decreased with increasing atomic percent antimony. Sb doped CIS crystals show p-type conductivity.

  9. Understanding the radiolabelling mechanism of {sup 99m}Tc-antimony sulphide colloid

    Energy Technology Data Exchange (ETDEWEB)

    Tsopelas, Chris E-mail: ctsopela@mail.rah.sa.gov.au

    2003-12-01

    The chemistry of antimony trisulphide colloid (ATC) was examined to elucidate the radiolabelling mechanism with {sup 99m}TcO{sub 4}{sup -}. Ion exchange chromatography and atomic absorption spectrophotometry techniques determined ATC to be resistant to hydrolysis in 0.1 M hydrochloric acid (HCl) at 25 deg. C or 100 deg. C (>97% recovery, Sb{sup 3+} absent). Hydrogen sulphide gas detected did not participate in the mechanism, where antimony trisulphide and {sup 99m}TcO{sub 4}{sup -} in HCl/100 deg. C yielded 96% {sup 99m}Tc-product from a K{sub 2}S-free formulation (versus 98% when K{sub 2}S was present). {sup 99m}TcO{sub 4}{sup -} was reduced >90% by DMSA or dithiothreitol under the same conditions, identifying involvement of thiol groups. Infrared analysis of Re-ATC showed S-O bonds, indicating excess thiol groups at the colloid surface were oxidised at the expense of {sup 99m}TcO{sub 4}{sup -} reduction.

  10. A Black Phosphate Conversion Coating on Steel Surface Using Antimony(III)-Tartrate as an Additive

    Science.gov (United States)

    Li, Feng; Wang, Guiping

    2016-05-01

    A novel black phosphate conversion coating was formed on steel surface through a Zn-Mn phosphating bath containing mainly ZnO, H3PO4, Mn(H2PO4)2, and Ca(NO3)2, where antimony(III)-tartrate was used as the blackening agent of phosphatization. The surface morphology and composition of the coating were characterized by scanning electron microscopy, energy dispersion spectroscopy, and x-ray photoelectron spectroscopy. Corrosion resistance of the coating was studied by potentiodynamic polarization curves and electrochemical impedance spectroscopy. The pH value of the solution had significant influence on the formation and corrosion resistance of the coating. The experimental results indicated that the Sb plays a vital role in the blackening of phosphate conversion coating. The optimal concentration of antimony(III)-tartrate in the phosphating bath used in this experiment was 1.0 g L-1, as higher values reduced the corrosion resistance of the coating. In addition, by saponification and oil seals, the corrosion duration of the black phosphate coating in a copper sulfate spot test can be as long as 20 min.

  11. Effect of electronic contribution on temperature-dependent thermal transport of antimony telluride thin film

    International Nuclear Information System (INIS)

    Highlights: • We investigated thermal transport of the antimony telluride thin films. • The contribution of the electronic thermal conductivity increased up to ∼77% at 300 K. • We theoretically analyze and explain the high contribution of electronic component. - Abstract: We study the theoretical and experimental characteristics of thermal transport of 100 nm and 500 nm-thick antimony telluride (Sb2Te3) thin films prepared by radio frequency magnetron sputtering. The thermal conductivity was measured at temperatures ranging from 20 to 300 K, using four-point-probe 3-ω method. Out-of-plane thermal conductivity of the Sb2Te3 thin film was much lesser in comparison to the bulk material in the entire temperature range, confirming that the phonon- and electron-boundary scattering are enhanced in thin films. Moreover, we found that the contribution of the electronic thermal conductivity (κe) in total thermal conductivity (κ) linearly increased up to ∼77% at 300 K with increasing temperature. We theoretically analyze and explain the high contribution of electronic component of thermal conductivity towards the total thermal conductivity of the film by a modified Callaway model. Further, we find the theoretical model predictions to correspond well with the experimental results

  12. Antimony retention and release from drained and waterlogged shooting range soil under field conditions.

    Science.gov (United States)

    Hockmann, Kerstin; Tandy, Susan; Lenz, Markus; Reiser, René; Conesa, Héctor M; Keller, Martin; Studer, Björn; Schulin, Rainer

    2015-09-01

    Many soils polluted by antimony (Sb) are subject to fluctuating waterlogging conditions; yet, little is known about how these affect the mobility of this toxic element under field conditions. Here, we compared Sb leaching from a calcareous shooting range soil under drained and waterlogged conditions using four large outdoor lysimeters. After monitoring the leachate samples taken at bi-weekly intervals for >1.5 years under drained conditions, two of the lysimeters were subjected to waterlogging with a water table fluctuating according to natural rainfall water infiltration. Antimony leachate concentrations under drained conditions showed a strong seasonal fluctuation between 110 μg L(-1) in summer and soil solution indicated that this decrease in Sb(V) concentrations was attributable to the reduction of Sb(V) to Sb(III) and the stronger sorption affinity of the latter to iron (Fe) (hydr)oxide phases. Our results demonstrate the importance of considering seasonal and waterlogging effects in the assessment of the risks from Sb-contaminated sites. PMID:25592464

  13. Phase effects on chemical behaviors of tin, antimony and tellurium fission products in aqueous solutions

    International Nuclear Information System (INIS)

    The oxidation states of tin, antimony and tellurium isotopes formed predominantly (>91%) by fission were investigated in aqueous solutions of 233U irradiated in a reactor. Results were corrected for the thermal reactions with the bulk radiolysis products using tracers for each element. In 0.4 M H2SO4 solutions containing 4.3 mM 233UO22+, 1.5 mM Te(IV) and 1.5 mM Te(VI), the fraction of Te(IV) is 98 +- 2% in the absence of oxygen and 92 +- 3% in the presence of oxygen. In frozen solutions of the same composition, the fraction of Te(IV) is 83 +- 2% in the absence of oxygen and 81 +- 3% in the presence of oxygen. Similar differences are also found in the case of the antimony isotopes in 0.4 M H2SO4 solutions and the tin isotopes in 1 M HCl solutions. For the interpretation of the differences, the reducing action of the species diffusing from the track of the fission fragments is considered. (author)

  14. Effect of indium and antimony doping in SnS single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Chaki, Sunil H., E-mail: sunilchaki@yahoo.co.in; Chaudhary, Mahesh D.; Deshpande, M.P.

    2015-03-15

    Highlights: • Single crystals growth of pure SnS, indium doped SnS and antimony doped SnS by direct vapour transport (DVT) technique. • Doping of In and Sb occurred in SnS single crystals by cation replacement. • The replacement mechanism ascertained by EDAX, XRD and substantiated by Raman spectra analysis. • Dopants concentration affects the optical energy bandgap. • Doping influences electrical transport properties. - Abstract: Single crystals of pure SnS, indium (In) doped SnS and antimony (Sb) doped SnS were grown by direct vapour transport (DVT) technique. Two doping concentrations of 5% and 15% each were employed for both In and Sb dopants. Thus in total five samples were studied viz., pure SnS (S1), 5% In doped SnS (S2), 15% In doped SnS (S3), 5% Sb doped SnS (S4) and 15% Sb doped SnS (S5). The grown single crystal samples were characterized by evaluating their surface microstructure, stoichiometric composition, crystal structure, Raman spectroscopy, optical and electrical transport properties using appropriate techniques. The d.c. electrical resistivity and thermoelectric power variations with temperature showed semiconducting and p-type nature of the as-grown single crystal samples. The room temperature Hall Effect measurements further substantiated the semiconducting and p-type nature of the as-grown single crystal samples. The obtained results are deliberated in detail.

  15. The analysis of antimony species by using ESI-MS and HPLC-ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Lintschinger, J.; Schramel, O.; Kettrup, A. [GSF-Forschungszentrum fuer Umwelt und Gesundheit GmbH, Institut fuer Oekologische Chemie, Ingolstaedter Landstrasse 1, Gebaeude 22, D-85758 Neuherberg (Germany)

    1998-05-01

    A new method for the separation of organic antimony as trimethylantimony dichloride (TMSbCl{sub 2}) and inorganic Sb(V) and Sb(III) by using anion exchange high-performance liquid chromatography coupled with inductively-coupled plasma mass spectrometry (ICP-MS) is presented. In comparison with previous work the detection limits for both species were significantly decreased, down to 5 ngL{sup -1}, mainly by avoiding any contamination from the chromatographic device. Using an ultrasonic nebulizer (USN) improved the detection limits for inorganic Sb species, but was useless for the HPLC method due to problems in the recovery of the TMSbCl{sub 2}. Matrix interferences of the chromatographic determination were studied in detail and the method was applied to environmental samples assumed to contain organic antimony species. Additionally, the molecular structure of the TMSbCl{sub 2} in solution was studied by using electrospray-ionization mass spectrometry (ESI-MS) showing that this species occurs most probably as [TMSbOH]{sup +} in aqueous solutions. (orig.) With 7 figs., 2 tabs., 14 refs.

  16. Migration of antimony from PET containers into regulated EU food simulants.

    Science.gov (United States)

    Sánchez-Martínez, María; Pérez-Corona, Teresa; Cámara, Carmen; Madrid, Yolanda

    2013-11-15

    Antimony migration from polyethylene terephthalate (PET) containers into aqueous (distilled water, 3% acetic acid, 10% and 20% ethanol) and fatty food simulants (vegetable oil), as well as into vinegar, was studied. Test conditions were according to the recent European Regulation 10/2011 (EU, 2011). Sb migration was assayed by ICP-MS and HG-AFS. The results showed that Sb migration values ranged from 0.5 to 1.2μg Sb/l, which are far below the maximum permissible migration value for Sb, 40μg Sb/kg, (EU, Regulation 10/2011). Parameters as temperature and bottle re-use influence were studied. To assess toxicity, antimony speciation was performed by HPLC-ICP-MS and HG-AFS. While Sb(V) was the only species detected in aqueous simulants, an additional species (Sb-acetate complex) was measured in wine vinegar. Unlike most of the studies reported in the literature, migration tests were based on the application of the EU directive, which enables comparison and harmonisation of results. PMID:23790852

  17. Evaluation of antimony microparticles supported on biochar for application in the voltammetric determination of paraquat.

    Science.gov (United States)

    Gevaerd, Ava; de Oliveira, Paulo R; Mangrich, Antonio S; Bergamini, Márcio F; Marcolino-Junior, Luiz H

    2016-05-01

    This work describes the construction and application of carbon paste electrodes modified with biochar and antimony microparticles (SbBCPE) for voltammetric determination of paraquat using a simple and sensitive procedure based on voltammetric stripping analysis. Some parameters such as amount of biochar and antimony used in the composition of the carbon paste and instrumental parameters were examined in detail. Under optimized conditions, an analytical curve was obtained for paraquat determination employing SbBCPE, which showed a linear response ranging from 0.2 to 2.9μmolL(-1), with limit of detection and quantification of 34nmolL(-1) and 113nmolL(-1), respectively, after paraquat pre-concentration of 120s. The repeatability study presented a RSD=2.0% for 10 consecutive measurements using the same electrode surface and the reproducibility study showed a RSD=2.7% for measurements with 10 different electrode surfaces. The proposed sensor was successfully applied for paraquat determination in tap water and citric fruit juice spiked samples and good recoveries were obtained without any sample pre-treatment, showing its promising analytical performance. PMID:26952405

  18. High levels of antimony in dust from e-waste recycling in southeastern China

    International Nuclear Information System (INIS)

    Environmental contamination due to uncontrolled e-waste recycling is an emerging global issue. Antimony (Sb) is a toxic element used in semiconductor components and flame retardants for circuit board within electronic equipment. When e-waste is recycled, Sb is released and contaminates the surrounding environment; however, few studies have characterized the extent of this problem. In this study, we investigated Sb and arsenic (As) distributions in indoor dust from 13 e-waste recycling villages in Guiyu, Guangdong Province, southeastern China. Results revealed significantly elevated concentrations of Sb (6.1-232 mg/kg) in dust within all villages, which were 3.9-147 times higher than those from the non e-waste sites, indicating e-waste recycling was an important source of Sb pollution. On the contrary, As concentrations (5.4-17.7 mg/kg) in e-waste dusts were similar to reference values from the control sites. Therefore, dusts emitted from e-waste recycling may be characterized by high Sb/As ratios, which may help identify the contamination due to the e-waste recycling activities. - Highlights: → Antimony and arsenic concentrations in dust from e-waste recycling were investigated. → E-waste recycling is an important emerging source of Sb pollution. → Sb/As ratios may help identify the e-waste contamination.

  19. Contrasting distribution of trace elements between representative antimony deposits in southern China

    International Nuclear Information System (INIS)

    The Xuefeng uplifted belt and the neighboring Xikuangshan region of southern China is the largest antimony producing area in the world. The mineralizing solution which was responsible for the antimony deposition is considered to be derived mainly from deep crustal fluids during a large tectonic movement of the Jurassic time. We analyzed trace elements of ore minerals and fluid inclusions from this area by CSIRO's micro-PIXE to understand characteristics of the mineralizing solution. We selected three representative 'super-large' deposits, one in the Xikuangshan area and the others within the Xuefeng belt: (1) Xikuangshan (simple Sb) which is structurally controlled by large-scale transcrustal faults and fractures, and mainly hosted by limestone; (2) Wuxi (Sb-Au-W), embedded in slate and structurally controlled by large-scale faults and fractures; and (3) Banxi (simple Sb) which is hosted by slate and controlled by local fractures. Our preliminary result indicated that the trace element distribution is highly contrasting for these three deposits corresponding to each geologic setting. Our case study showed that being combined with field evidence, micro-PIXE can contribute to understand large tectonic movements and to establish an effective exploration model for super-large mineral deposits

  20. Structure and properties of antimony-doped lanthanum molybdate La2Mo2O9

    International Nuclear Information System (INIS)

    Polycrystalline samples of the composition La2Mo2−xSbxO9−y, where 0 ≤ x ≤ 0.05, were prepared by solid-phase synthesis. Single crystals of La2Mo1.96Sb0.04O8.17 were obtained by spontaneous crystallization from flux. The structure of the metastable βms phase of this compound was determined at room temperature by X-ray diffraction. It was found that the La, Mo, and O1 atoms are displaced from the threefold axis on which they are located in the high-temperature β phase. It was shown that molybdenum atoms in the crystal structure are partially replaced by antimony atoms, which are located on the threefold axis. In antimony-doped crystals, lanthanum atoms partially return to the site on the threefold axis and the coordination environment of molybdenum cations becomes more ordered, thus facilitating the stabilization of the cubic phase at room temperature. Calorimetric measurements (DSC) showed that the introduction of Sb as the dopant into the La2Mo2O9 structure leads to a decrease in the temperature of the α → β phase transition from 570 to 520°C and to the partial suppression of this transition. The temperature behavior of the conductivity confirms the DSC data. Thus, doping with Sb contributes to the stabilization of the cubic phase at room temperature.

  1. Organically complexed iron enhances bioavailability of antimony to maize (Zea mays) seedlings in organic soils.

    Science.gov (United States)

    Ptak, Corey; McBride, Murray

    2015-12-01

    Antimony (Sb) is a metalloid belonging to group 15 of the periodic table. Chemical similarities between arsenic (As) and Sb produce concerns about potential health effects of Sb and enrichment in the environment. Antimony is found in oxic environments predominately as an oxyanionic species, antimonite (Sb[OH](6-)). As a result of its net negative charge, Sb[OH](6-) was not initially predicted to have strong interactions with natural organic matter. Oxyanionic species could bind the negatively charged organic matter via a ternary complexation mechanism, in which cationic metals mediate the strong association between organic matter functional groups and oxyanions. However, these interactions are poorly understood in how they influence the bioavailability of oxyanionic contaminants to plants. Iron (Fe) additions to organic soils have been found to increase the number of organically complexed Fe sites suitable for Sb exchange, resulting in a reduced bioavailable fraction of Sb. The bioavailability of Sb to maize seedlings as a function of organically complexed Fe was examined using a greenhouse study. A significant increase in plant tissue Sb was observed as organically complexed Fe increased, which was not predicted by methods commonly used to assess bioavailable Sb. Extraction of soils with organic acids common to the maize rhizosphere suggested that organic acid exudation can readily mobilize Sb bound by organic Fe complexes. PMID:26076768

  2. Antimony isotopic composition in river waters affected by ancient mining activity.

    Science.gov (United States)

    Resongles, Eléonore; Freydier, Rémi; Casiot, Corinne; Viers, Jérôme; Chmeleff, Jérôme; Elbaz-Poulichet, Françoise

    2015-11-01

    In this study, antimony (Sb) isotopic composition was determined in natural water samples collected along two hydrosystems impacted by historical mining activities: the upper Orb River and the Gardon River watershed (SE, France). Antimony isotope ratio was measured by HG-MC-ICP-MS (Hydride Generation Multi-Collector Inductively Coupled Plasma Mass Spectrometer) after a preconcentration and purification step using a new thiol-cellulose powder (TCP) procedure. The external reproducibility obtained for δ(123)Sb measurements of our in-house Sb isotopic standard solution and a certified reference freshwater was 0.06‰ (2σ). Significant isotopic variations were evident in surface waters from the upper Orb River (-0.06‰≤δ(123)Sb≤+0.11‰) and from the Gardon River watershed (+0.27‰≤δ(123)Sb≤+0.83‰). In particular, streams that drained different former mining sites exploited for Sb or Pb-Zn exhibited contrasted Sb isotopic signature, that may be related to various biogeochemical processes occurring during Sb transfer from rocks, mine wastes and sediments to the water compartment. Nevertheless, Sb isotopic composition appeared to be stable along the Gardon River, which might be attributed to the conservative transport of Sb at distance from mine-impacted streams, due to the relative mobile behavior of Sb(V) in natural oxic waters. This study suggests that Sb isotopic composition could be a useful tool to track pollution sources and/or biogeochemical processes in hydrologic systems. PMID:26452900

  3. One-step synthesis of antimony-doped tin dioxide nanocrystallites and their property

    Institute of Scientific and Technical Information of China (English)

    ZHENG Min; WANG Bao

    2009-01-01

    Antimony-doped tin dioxide(ATO) nanoparticles with primary diameter in the range of 9-10 nm were rapidly synthesized via a novel combustion technique, starting with antimony trichloride and tin tetrachloride as metal sources and self-assembly compounds as fuels. The combustion phenomena and characteristics of products were controlled by assembling components in fuel compounds according to appropriate molar ratio. The as-synthesized products were characterized by XRD, SEM, TEM and XPS, respectively. The electrical conductivity was evaluated through measuring the antistatic property of polyester fiber treated by the as-synthesized products. The results show that a mild combustion phenomena without release of smoke can be taken on and perfect azury rutile ATO crystal with complete substitution can be formed rapidly under the appropriate synthetic conditions. The antistatic property of the polyester fiber treated by the as-synthesized ATO products is enhanced remarkably. The triboelectricity voltage below 1.0 kV, half life below 1.0 s and surface resistance below 1.0×106 Ω can be attained.

  4. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic

    International Nuclear Information System (INIS)

    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. - Highlights: ► We examined the distribution of antimony in topsoil and moss in Ny-Ålesund, Arctic. ► The distribution of Sb is associated with traffic and historical mining activities. ► The weathering of coal bed cannot lead to the Sb increase in the surface environment. ► The distribution of Sb in moss could reflect the accumulation of Sb pollution. ► Moss can be a useful tool for monitoring Sb in highly and lightly polluted areas. - The distribution of Sb in Ny-Ålesund is partially associated with traffic and historical mining activities, and moss can be a useful tool for monitoring Sb in both highly and lightly polluted areas.

  5. Determination of antimony in nail and hair by thermal neutron activation analysis

    International Nuclear Information System (INIS)

    The concentration of antimony in nail and hair was determined by thermal neutron activation analysis. Samples were collected from the workers of an antimony refinery, inhabitants near the refinery, and residents in control area. They were irradiated by Kyoto University 5000 kW Reactor for 1 h, and cooled for 30 to 100 days. After cooling, the concentration of Sb in nail and hair was estimated by measuring the intensity of γ-ray from 124Sb of the samples, then the samples were washed by 0.1 % aqueous solution of nonionic surface active agent in an ultrasonic cleaner. The γ-ray spectrometry was done again (after washing). The concentration of Sb in nail before washing was 730 ppm for the workers, 2.46 ppm for habitants near the refinery, and 0.19 ppm for the control; after washing, it became 230 ppm for the workers, 0.63 ppm for habitants, and 0.09 ppm for the control. The concentration of Sb in hair before and after washing was 222 ppm and 196 ppm for the workers, and 0.21 ppm and 0.15 ppm for the control, respectively. (author)

  6. Morphology-controlled growth of crystalline antimony sulfide via a refluxing polyol process

    Science.gov (United States)

    Zhang, Rui; Chen, Xiangying; Mo, Maosong; Wang, Zhenghua; Zhang, Meng; Liu, Xinyuan; Qian, Yitai

    2004-02-01

    By refluxing antimony trichloride (SbCl 3) and thiourea in various solvents at suitable reaction conditions, antimony sulfide (Sb 2S 3) crystallites with a diversity of well-defined morphologies were synthesized. Sb 2S 3 rods with the average diameter of 800 nm and the length of 7 μm, as well as microtubes with the average outer diameter of 1.2 μm, the average inner diameter of 800 nm and the length of 8 μm, were obtained in 1,2-propanediol at 180°C for 10 min. In contrast, a series of experiments under different conditions were carried out to investigate the influencing factors on the reaction. The as-synthesized products were characterized by powder X-ray diffraction, field-emission scanning electron microscopy, transmission electron microscope and X-ray photoelectron spectra. The results indicate Sb 2S 3 crystals with different morphologies, including rod-like, tube-like, bowknot-like, flower-like, straw-bundled-like, taken under different experimental conditions. It is found that the reaction temperature, time, solvent and poly(vinyl pyrrolidone) (as a polymer capping reagent) play important roles in the formation of the final Sb 2S 3 crystallites with different morphologies. Also, the possible growth mechanism is discussed.

  7. Highly conducting nanosized monodispersed antimony-doped tin oxide particles synthesized via nanoaqueous sol-gel method

    Czech Academy of Sciences Publication Activity Database

    Müller, V.; Rathouský, Jiří; Rasp, M.; Štefanić, G.; Günther, S.; Niederberger, M.; Fattakhova-Rohlfing, D.

    Vol. 1. Boca Raton : Taylor-Francis, 2010, s. 340-343. ISBN 978-1-4398-3401-5. - ( Nanotech 2010) R&D Projects: GA ČR GA104/08/0435 Institutional research plan: CEZ:AV0Z40400503 Keywords : antimony-doped tin oxide * TCO * nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry

  8. Ambulatory oesophageal pH monitoring : a comparison between antimony, ISFET, and glass pH electrodes

    NARCIS (Netherlands)

    Hemmink, Gerrit J. M.; Weusten, Bas L. A. M.; Oors, Jac; Bredenoord, Albert J.; Timmer, Robin; Smout, Andre J. P. M.

    2010-01-01

    Background and aim Ambulatory oesophageal pH-impedance monitoring is a widely used test to evaluate patients with reflux symptoms. Several types of pH electrodes are available: antimony, ion sensitive field effect transistor (ISFET), and glass electrodes. These pH electrodes have not been compared d

  9. Determination of antimony in environment samples by gas phase chemiluminescence detection following flow injection hydride generation and cryotrapping.

    Science.gov (United States)

    Ye, Yousheng; Sang, Jianchi; Ma, Hongbing; Tao, Guanhong

    2010-06-15

    A novel method for the determination of antimony in environmental samples was developed with gas phase chemiluminescence detection following flow injection hydride generation and cryotrapping. The stibine, generated from samples by borohydride reduction of antimony using flow injection technique, was separated by using a new gas-liquid separator, dried with an ice-salt cryogenic bath and concentrated in a glass U-tube immersed in liquid nitrogen. Re-vaporization of stibine based on its boiling point was achieved by allowing the tube to warm at room temperature. A gas phase chemiluminescence signal was produced during the ozonation of the hydride in a reflective chamber. Under optimal conditions, the proposed method was characterized by a wide linear calibration range from 1.0microgL(-1) to 10.0mgL(-1) with a detection limit of 0.18microgL(-1) (n=11). The relative standard deviation for 10.0microgL(-1) antimony was 3.56% (n=11) and the sampling rate was 15 samples h(-1). Blank signal was reduced by the purification of reagents and the interference from transition metal ions was eliminated by the addition of L-cysteine into samples. The method was applied to the determination of antimony in environmental samples with satisfactory results. PMID:20441930

  10. Comparative phytotoxicity of methylated and inorganic arsenic- and antimony species to Lemna minor, Wolffia arrhiza and Selenastrum capricornutum

    NARCIS (Netherlands)

    L. Duester; H.G. van der Geest; S. Moelleken; A.V. Hirner; K. Kueppers

    2011-01-01

    The alkylation of metalloids through the transfer of methyl groups is an important factor in the biogeochemical cycling of elements like arsenic and antimony. In the environment, many different organic and inorganic forms of these elements can therefore be found in soils, sediments or organisms. Stu

  11. A cloud point extraction for spectrophotometric determination of ultra- trace antimony without chelating agent in environmental and biological samples

    International Nuclear Information System (INIS)

    We report on a simple, sensitive and reliable method for the cloud point extraction of antimony (Sb) and its subsequent spectrophotometric detection. It is based on the color reaction of Sb (III) with iodide in acidic medium and subsequent micelle-mediated extraction of tetraiodoantimonate using a non-ionic surfactant in the absence of any chelating agent. The effects of reaction and extraction parameters were optimized. The calibration plot is linear in the range of 0.80-95 ng mL-1 of antimony in the sample solution, with a regression coefficient (r) of 0.9994 (for n=9). The detection limit (at SNR=3) is 0.23 ng mL-1, and the relative standard deviations at 10 and 70 ng mL-1 of antimony are 3.32 and 1.85 % (at n=8), respectively. The method compared favorably to other methods and was applied to determine antimony in seawater, anti-leishmania drug (glucantime), and human serum. (author)

  12. Effect of Annealing on the Properties of Antimony Telluride Thin Films and Their Applications in CdTe Solar Cells

    Directory of Open Access Journals (Sweden)

    Zhouling Wang

    2014-01-01

    Full Text Available Antimony telluride alloy thin films were deposited at room temperature by using the vacuum coevaporation method. The films were annealed at different temperatures in N2 ambient, and then the compositional, structural, and electrical properties of antimony telluride thin films were characterized by X-ray fluorescence, X-ray diffraction, differential thermal analysis, and Hall measurements. The results indicate that single phase antimony telluride existed when the annealing temperature was higher than 488 K. All thin films exhibited p-type conductivity with high carrier concentrations. Cell performance was greatly improved when the antimony telluride thin films were used as the back contact layer for CdTe thin film solar cells. The dark current voltage and capacitance voltage measurements were performed to investigate the formation of the back contacts for the cells with or without Sb2Te3 buffer layers. CdTe solar cells with the buffer layers can reduce the series resistance and eliminate the reverse junction between CdTe and metal electrodes.

  13. The use of colloidal nano gold as an effective modifier for the determination of antimony, arsenic and lead by ETAAS

    International Nuclear Information System (INIS)

    Complete text of publication follows. Colloidal nano gold was prepared and used as a modifier for the determination of antimony, arsenic and lead by electrothermal atomic absorption spectrometry. The effects of pyrolysis and atomization temperature, the amounts of interferants and modifier on the sensitivities of antimony, arsenic and lead in the presence of modifier were investigated. In addition, the contribution of another modifying reagent Mg(NO3)2 mixed with colloidal nano gold was also investigated. The modifier allows the use of pyrolysis temperatures between 1200 deg C and 1300 deg C for antimony, arsenic and lead. In the presence of colloidal nano gold modifier, the tolerance limits of NaCl and Na2SO4 for the quantitative recoveries of antimony, arsenic and lead were investigated. After optimization of experimental conditions, the three elements were successfully determined in some model solutions containing some sulphate and chloride salts as well as in CRM water samples at 95% confidence level using pure aqueous standards. The effectiveness of modifier was compared with that of the mixed universal modifier (Mg+Pd).

  14. Cesium-137 contamination in Arctic Ocean ice

    International Nuclear Information System (INIS)

    Sea ice and ice-borne sediment samples were collected across the western Arctic basin on the joint US/Canada Arctic Ocean Section during August 1994. Samples were processed on board and returned at the completion of the cruise to Oak Ridge National Laboratory for analysis. Sediment was observed on the surface and in the ice from the southern ice limit in the Chukchi Sea to the North Pole. Preliminary results on the ice-borne sediment samples show widespread elevated concentrations of 137Cs, ranging from 4.9 to 73 mBq g dry weight-1. An analysis of the measurements indicate that sea ice is primary transport mechanism by which contaminated sediments are redistributed throughout the Arctic Ocean and possibly exported into the Greenland Sea and North Atlantic through Fram Strait. The wide variability in the ice-borne sediment concentrations of 137Cs measured along the transect argues that contaminants incorporated on the Siberian shelves can follow much more variable trajectories than is suggested by mean ice drift calculations. 2 figs

  15. Accumulation of cesium-137 by useful mollusca

    International Nuclear Information System (INIS)

    There are few data available on the radioactive contamination of marine mollusca, especially cephalopoda. Therefore, in this paper, data obtained on the radioactive contamination of cephalopoda were compared with those on pelecypoda and gastropoda. The uptake and elimination experiments were carried out by means of radioisotope tracer methods, and the concentration factors of 137Cs due to radioactive fallout were estimated. The contamination of cephalopoda was also compared with those of other marine organisms in terms of concentration factor. The activity ratios in the organs or tissues of octopus were in the range of 3.5 and 12.8 on the 14th day after the beginning of exposure and those of squid were in the range of 8.8 and 10.9 on the 6th day after the commencement of the experiment. The biological half time was 90 days for octopus from the observation over 75 days, while it was 31 days for clam from the results of 75 days' experiment. The concentration factors of 137Cs due to radioactive fallout were in the range of 3 and 23 for cephalopoda, 7 and 28 for pelecypoda and 24 and 30 for gastropoda, respectively. It was concluded that no difference in the concentration factors was clearly observable among the classes of mollusca, but the values were substantially similar to those of crustaceans and slightly lower than those of marine fish. (auth.)

  16. 21 CFR 137.180 - Self-rising flour.

    Science.gov (United States)

    2010-04-01

    ... Flours and Related Products § 137.180 Self-rising flour. (a) Self-rising flour, self-rising white flour, self-rising wheat flour, is an intimate mixture of flour, sodium bicarbonate, and one or more of the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising flour. 137.180 Section 137.180...

  17. Murine immunization by cesium-137 irradiation attenuated Schistosoma mansoni cercariae

    International Nuclear Information System (INIS)

    Cesium-137, becoming a more readily available ionizing gamma radiation source for laboratory use, was shown to effectively attenuate Schistosoma mansoni cercariae for vaccine production. In parallel comparison studies with the murine model, cesium-137 attenuated cercariae consistently afforded better protection than did the cobalt-60 prepared vaccine. Dose-response data indicated that the optimal total irradiation with cesium-137 was between 45 and 50 Krad

  18. Murine immunization by cesium-137 irradiation attenuated Schistosoma mansoni cercariae

    Energy Technology Data Exchange (ETDEWEB)

    Stek, M. Jr.; Minard, P.; Cruess, D.F.

    1984-06-01

    Cesium-137, becoming a more readily available ionizing gamma radiation source for laboratory use, was shown to effectively attenuate Schistosoma mansoni cercariae for vaccine production. In parallel comparison studies with the murine model, cesium-137 attenuated cercariae consistently afforded better protection than did the cobalt-60 prepared vaccine. Dose-response data indicated that the optimal total irradiation with cesium-137 was between 45 and 50 Krad.

  19. Fallout 137Cs in soils from North Western Libya

    International Nuclear Information System (INIS)

    Fallout levels of 137Cs in surface soil from North Western Libya have been measured using gamma-ray spectrometry. The activity concentrations of 137Cs in soil ranged from 975 to 1720 mBq x kg-1. The areal activity concentrations ranged from 1300 to 2250 mBq x m-2, and were highly correlated with annual precipitation. The effective dose from external exposure to 137Cs is found to be 3 nSv x y-1. (author)

  20. 21 CFR 146.137 - Frozen orange juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen orange juice. 146.137 Section 146.137 Food... Beverages § 146.137 Frozen orange juice. (a) Frozen orange juice is orange juice as defined in § 146.135, except that it is frozen. (b) The name of the food is “Frozen orange juice”. Such name may be preceded...

  1. Putative bioindicator of 137Cs in Perna viridis

    International Nuclear Information System (INIS)

    Green lipid mussels (Perna viridis L.) are utilized as bioindicators and bioconcentrators not only for marine radionuclide contamination but also for heavy metal bioaccumulation. Depurated P. viridis were incubated in 137Cs-spiked aquarium for 4 days. Soluble protein fractions of soft tissue obtained were electrophoresed (SDS-PAGE) to determine the exposure effects of 137Cs on P. viridis. Results showed the presence of a 154-kDa protein in 137Cs-spiked samples which could be a potential bioindicator of 137Cs in P. viridis. Other differences involving two more proteins (∼94-kDa and∼61 KDa) are reported. (Author)

  2. Fractionation of (137)Cs and Pu in natural peatland.

    Science.gov (United States)

    Mihalík, Ján; Bartusková, Miluše; Hölgye, Zoltán; Ježková, Tereza; Henych, Ondřej

    2014-08-01

    High Cs-137 concentrations in plants growing on peatland inspired us to investigate the quantity of its bioavailable fraction in natural peat. Our investigation aims to: a) estimate the quantity of bioavailable Cs-137 and Pu present in peat, b) verify the similarity of Cs-137 and K-40 behaviours, and c) perform a quantification of Cs-137 and Pu transfer from peat to plants. We analysed the vertical distribution of Cs-137 and Pu isotopes in the peat and their concentrations in plants growing on these places. Bioavailability of radionuclides was investigated by sequential extraction. Sequential analyses revealed that it was the upper layer which contained the majority of Cs-137 in an available form while deeper layers retained Cs-137 in immobile fractions. We can conclude that 18% of all Cs-137 in the peat is still bioavailable. Despite of the low quantity of bioavailable fraction of Cs-137 its transfer factor reached extremely high values. In the case of Pu, 64% of its total amount was associated with fulvic/humic acids which resulted in the high transfer factor from peat to plants. 27 years after the Chernobyl nuclear accident, the significant part of radionuclides deposited in peatland is still bioavailable. PMID:24631917

  3. Speciation of 137Cs in the Baltic sea water

    International Nuclear Information System (INIS)

    A possibility of application of Filtrac 391 and Nuclepore filters, Ky-2-8-C exchanger and the Mtilon-T fiber impregnated with Fe, Co, Ni ferrocyanides for separation of particulate and ionic 137Cs in the sea water was investigated. Physico-chemical forms of 137Cs were investigated in the Baltic Sea water during 1995-1997. It was determined that 137Cs was mainly present in ionic form (62-93 %) both in the near-shore and open waters. Concentration of particulate 137Cs ranged from 255 to 625 Bq/kg (dry weight).The distribution coefficient (Kd) of radiocaesium reached values of 2100-9700. (author)

  4. Surface erosion assessment in New Zealand using caesium-137

    International Nuclear Information System (INIS)

    The 137Cs technique has provided the first quantitative, medium-term data on rates of soil redistribution by surface erosion on both cropland and rangeland in New Zealand. Research has also provided data on natural short-range variability of 137Cs in uneroded soils, and a technique for independently estimating 137Cs input values from rainfall. The greatest research need remains the development of robust, accurate calibration procedures for converting 137Cs measurements to rates of erosion. Emphasis has been on application of the technique to provide field-based data on erosion rates, with limited research to further develop the technique. This paper summarises recent research in these two areas

  5. Determination of natural isotopic variation in antimony using inductively coupled plasma mass spectrometry for an uncertainty estimation of the standard atomic weight of antimony

    International Nuclear Information System (INIS)

    The isotopic variation of industrially produced antimony was estimated using multiple-collector inductively coupled plasma mass spectrometry. A reproducible 123Sb/121Sb ratio of ±0.004% (2 standard deviations) was routinely obtained using a Sn doping mass discrimination correction technique. Only a small isotopic variation of about 0.05% was observed among industrially important Sb materials (five commercially available reagents and two ore minerals). The degree of Sb isotopic variation to determine the uncertainty in Sb atomic weight can be reduced by this new analytical technique to 0.00025 compared to the currently accepted IUPAC isotopic variation determined by conventional mass spectrometry of ±0.001. Heavy isotope enrichment of Sb in a drainage water sample from a stibnite mining area was found. This heavy isotope enrichment tendency in an aqueous environment may be useful in detecting anthropogenic Sb input from industrial emission by the smelting process via air because Sb of anthropogenic origin will have lighter isotope enrichment features. (author)

  6. Spin dynamics of complex oxides, bismuth-antimony alloys, and bismuth chalcogenides

    Science.gov (United States)

    Sahin, Cuneyt

    The emerging field of spintronics relies on the manipulation of electron spin in order to use it in spin-based electronics. Such a paradigm change has to tackle several challenges including finding materials with sufficiently long spin lifetimes and materials which are efficient in generating pure spin currents. This thesis predicts that two types of material families could be a solution to the aforementioned challenges: complex oxides and bismuth based materials. We derived a general approach for constructing an effective spin-orbit Hamiltonian which is applicable to all nonmagnetic materials. This formalism is useful for calculating spin-dependent properties near an arbitrary point in momentum space. We also verified this formalism through comparisons with other approaches for III-V semiconductors, and its general applicability is illustrated by deriving the spin-orbit interaction and predicting spin lifetimes for strained strontium titanate (STO) and a two-dimensional electron gas in STO (such as at the LAO/STO interface). Our results suggest robust spin coherence and spin transport properties in STO related materials even at room temperature. In the second part of the study we calculated intrinsic spin Hall conductivities for bismuth-antimony (BISb) semimetals with strong spin-orbit couplings, from the Kubo formula and using Berry curvatures evaluated throughout the Brillouin zone from a tight-binding Hamiltonian. Nearly crossing bands with strong spin-orbit interaction generate giant spin Hall conductivities in these materials, ranging from 474 ((h/e)O--1cm--1) for bismuth to 96((h/e)O--1cm --1) for antimony; the value for bismuth is more than twice that of platinum. The large spin Hall conductivities persist for alloy compositions corresponding to a three-dimensional topological insulator state, such as Bi0.83Sb0.17. The spin Hall conductivity could be changed by a factor of 5 for doped Bi, or for Bi0.83Sb0.17, by changing the chemical potential by 0.5 e

  7. Antimony: a traffic-related element in the atmosphere of Buenos Aires, Argentina.

    Science.gov (United States)

    Gómez, Darío R; Fernanda Giné, María; Claudia Sánchez Bellato, Ana; Smichowski, Patricia

    2005-12-01

    Vehicular traffic is one of the main sources of antimony in highly populated urban areas like Buenos Aires where an overall traffic density of 1 500 000 vehicles per day (corresponding to 7500 vehicles km(-2)) is estimated. In this context, a study was undertaken to ascertain the levels of Sb and other traffic-related elements (TRE) in the atmosphere of this city. To this end, sixty-seven samples of PM-10 particulate matter were collected during eight days in nine representative sampling sites located downtown Buenos Aires and spread over an area of about 30 km2. The collection of particulate matter was performed on ash-free glass-fibre filters using high volume samplers with PM-10 sampling heads. A combination of aqua regia and perchloric acid was used for leaching metals from filters. The resulting solutions were evaporated and then diluted with 0.1 mol l(-1) HCl. Antimony was determined by inductively coupled plasma-quadrupole mass spectrometry (ICP-QMS) at ng g(-1) levels. Concentrations of Sb varied from 12.9 +/- 0.9 to 375 +/- 23 microg g(-1)(equivalent to 0.87 +/- 0.06 to 15.3 +/- 0.8 ng m(-3)). Statistical analysis was performed on the data set including the measured PM-10 mass and Sb concentrations for the monitored period. Correlations of Sb with other TRE namely, Cu and Mo were also assessed. The highest concentrations of Sb were detected at two sites (Hospital Alemán and Casa Rapallini) located in streets with traffic consisting mostly of passenger cars and showing a "stop-and-go" pattern in peak hours. Antimony levels in the Buenos Aires PM-10 are by far below the level of 0.5 mg m(-3)(for an 8 hour workday, 40 hour work week) set by the US Occupational Safety and Health Administration (OSHA) for occupational exposure. However, monitoring of Sb and other TRE should be carried out in a systematic fashion to detect the possibility of increases in from the present levels. PMID:16307067

  8. Knockdown of GPR137,G Protein-coupled receptor 137, Inhibits the Proliferation and Migration of Human Prostate Cancer Cells.

    Science.gov (United States)

    Ren, Jizhong; Pan, Xiuwu; Li, Lin; Huang, Yi; Huang, Hai; Gao, Yi; Xu, Hong; Qu, Fajun; Chen, Lu; Wang, Linhui; Hong, Yi; Cui, Xingang; Xu, Danfeng

    2016-05-01

    GPR137 belongs to the G protein-coupled receptor family involving the regulation of transmembrane signal transduction that launches pivotal cellular functions. However, its function in prostate cancer (PCa) has been rarely reported. It was found in this study that GPR137 was upregulated in PCa tissues as compared with that in paracancerous tissues. To see whether GPR137 could serve as a potential therapeutic target for PCa, GPR137 was knocked down to verify its biological function in PCa cells. Lentivirus-introduced short hairpin RNA (shRNA) was designed to silence GPR137 gene. It was found that silencing of GPR137 gene suppressed the proliferation and colony formation of PCa cell lines PC-3 and DU145. Further study indicated that growth inhibition by GPR137 knockdown was associated with cell cycle arrest at G0/G1 phase. Furthermore, silencing of GPR137 repressed the invasion and migration abilities of PC-3 cells via downregulating slug and snail and upregulating E-cadherin. Collectively, these findings imply that GPR137 plays an important role in the occurrence and progression of PCa and may prove to be a potential therapeutic target for the treatment of advanced PCa. PMID:26669804

  9. Mechanisms of 137Cs migration in coniferous forest soils

    International Nuclear Information System (INIS)

    Field and laboratory studies demonstrate two processes involved in 137Cs migration in coniferous forest soil. The data illustrate that the effects of leaching and litter accumulation combine, over the time interval since deposition, to achieve the observed distribution of 137Cs in the soil profile. Today, under normal field conditions the rate of 137Cs leaching from forest humus is low and even extreme environmental conditions do not increase greatly the extent of 137Cs mobilisation by leaching. A three-phase model of 137Cs migration in the organic horizons of coniferous forest soils is proposed. The phases are discrete but at any point in time the behaviour of some portion of deposited 137Cs will be characteristic of one of the three phases. In the first phase 137Cs intercepted by the canopy is washed to the forest floor where a proportion (20-40% is reported) rapidly percolates through the organic horizons reaching the underlying soil; the remainder is retained in the organic horizons. In the second phase, which our study estimates to last about 5 years, the 137Cs contained within the Ol and Of horizons moves to the Oh horizon. Accumulation of relatively uncontaminated litter on top of the Ol horizon contributes to this migration, while 137Cs mobilised from the Ol and Of horizons by decomposition is leached to the Oh horizon. The 137Cs which reaches the Oh horizon, either by leaching or by decomposition and burial, enters the third phase in which the pace of migration is greatly reduced. Decomposition is slowest in the Oh horizon and the accumulation and turnover of Oh material is also very slow. At the site investigated in this study the bulk of the deposited 137Cs is in this third phase and we suggest that this phase will persist for many years to come

  10. The electrical characterizations of selenium (Se) doped gallium antimony (GaSb) single crystal

    Science.gov (United States)

    Choudhari, Rashmi; Deshpande, Manisha; Maske, Dilip; Gadkari, Dattatray

    2016-05-01

    The growth of Se doped GaSb bulk crystal is carried out using Vertical directional solidification (VDS) technique. High purity Gallium and Antimony is taken as source material and selenium as doping material. From grown ingot substrate were obtained in wafer form using diamond cutter. The electrical characteristics such as Hall measurement is used to find the carrier concentration and mobility, while Van der pauw for measuring resistivity of the sample The GaSb:Se sample shows high resistivity and mobility. The grown crystal was detached from the ampoule wall with high crystal quality. The measured resistivity of GaSb:Se is 9.9×10-3ohm-cm, the mobility is 1464cm3/Vsec and carrier concentration is 5.08×1017 per cm3.

  11. Sequential solvent extraction for forms of antimony in five selected coals

    Science.gov (United States)

    Qi, C.; Liu, Gaisheng; Kong, Y.; Chou, C.-L.; Wang, R.

    2008-01-01

    Abundance of antimony in bulk samples has been determined in five selected coals, three coals from Huaibei Coalfield, Anhui, China, and two from the Illinois Basin in the United States. The Sb abundance in these samples is in the range of 0.11-0.43 ??g/g. The forms of Sb in coals were studied by sequential solvent extraction. The six forms of Sb are water soluble, ion changeable, organic matter bound, carbonate bound, silicate bound, and sulfide bound. Results of sequential extraction show that silicate-bound Sb is the most abundant form in these coals. Silicate- plus sulfide-bound Sb accounts for more than half of the total Sb in all coals. Bituminous coals are higher in organic matterbound Sb than anthracite and natural coke, indicating that the Sb in the organic matter may be incorporated into silicate and sulfide minerals during metamorphism. ?? 2008 by The University of Chicago. All rights reserved.

  12. Supermolecular template route to fabrication of well crystallized hollow antimony microspheres

    Institute of Scientific and Technical Information of China (English)

    GU Li; CHEN Shu-da; WEI Xiao-yan

    2006-01-01

    Hollow spheres of elemental antimony (Sb) with good crystallinity, high contrast and thin wall were prepared in the solutions of poly(ethylene glycol) (PEG) and oleic acid(OA) associations at the refluxed temperature. The complexes of Sb3+ with tartaric acid were used as precursors, which can avoid the hydrolysis of SbCl3 and the resulting impurity of products. The average diameter and thickness of the as-prepared hollow sphere are about 300 nm and less than 20 nm, respectively. The formation of hollow spheres depends on the template function of PEG and OA associations, which can be confirmed through the theoretical analysis and results of control experiments. The specific surface area reaches 34.669 m2/g.

  13. Surface morphology of crystalline antimony islands on graphite at room temperature

    International Nuclear Information System (INIS)

    Antimony islands of different shapes and dimensions were grown on highly oriented pyrolytic graphite (HOPG) at room temperature in ultrahigh vacuum. Three-dimensional (3D) spherical, 2D thin films and 1D nanorods of Sb on graphite were studied using in situ scanning tunnelling microscopy. Sb was evaporated in the form of Sb4, which interacts with HOPG weakly and exhibits a high surface mobility, resulting in preferential nucleation of 3D spherical islands at defect sites. Surface diffusion and aggregation lead to the formation of nanoparticles with various shapes and sizes. The shape and size of islands depend on growth parameters, i.e. flux and deposition time. The 3D and 2D structures of Sb on graphite have the same bulk crystalline rhombohedral (α-Sb) structure, but the 1D nanorods show a highly compressed structure different from the α-Sb lattice

  14. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Directory of Open Access Journals (Sweden)

    Zhimeng Liu

    2016-05-01

    Full Text Available A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2/carbon aerogel (CA for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  15. Focused ion beam induced synthesis of a porous antimony nanowire network

    International Nuclear Information System (INIS)

    We present a focused ion beam-based approach for the synthesis of an antimony nanofiber network. The nanofibers, with a homogeneous distribution of diameters of about 25 nm and lengths up to several microns, are synthesized in a self-assembling process without any additional material source at room temperature. It is possible to recrystallize the as-grown amorphous nanofibers by moderate rapid thermal annealing at 473 K. These results have been verified by means of scanning electron microscopy, Auger electron spectroscopy, high-resolution transmission electron microscopy, selected area electron diffraction, and energy dispersive x-ray analysis. As this approach is not limited solely to the material discussed here, other substrates (e.g., GaSb and Ge) and ion sources should extend this method to other materials, which offers a great potential for future nanoscale devices and applications

  16. Novel fabrication of an electrochromic antimony-doped tin oxide film using a nanoparticle deposition system

    Science.gov (United States)

    Kim, Hyungsub; Park, Yunchan; Choi, Dahyun; Ahn, Sung-Hoon; Lee, Caroline Sunyong

    2016-07-01

    Novel deposition method of Antimony-doped tin oxide (ATO) thin films was introduced using a nanoparticle deposition system (NPDS) to fabricate an electrochromic (EC) device. NPDS is a dry deposition method that simplifies the ATO deposition process by eliminating the need for solvents or binders. In this study, an ATO EC layer was deposited using NPDS. The surface morphology and electrochemical and optical transmittance properties were characterized. The optical transmittance change in the ATO EC device was ∼35% over the wavelength range of 350-800 nm, and the cyclic transmittance was stable. The ATO film deposited using NPDS, exhibited a coloration efficiency of 15.5 cm2 C-1. Therefore, our results suggest that ATO EC devices can be fabricated using a simple, cost-effective NPDS, which allows nanoparticles to be deposited directly without pre- or post-processing.

  17. Microbial diversity and community structure in an antimony-rich tailings dump.

    Science.gov (United States)

    Xiao, Enzong; Krumins, Valdis; Dong, Yiran; Xiao, Tangfu; Ning, Zengping; Xiao, Qingxiang; Sun, Weimin

    2016-09-01

    To assess the impact of antimony (Sb) on microbial community structure, 12 samples were taken from an Sb tailings pile in Guizhou Province, Southwest China. All 12 samples exhibited elevated Sb concentrations, but the mobile and bioaccessible fractions were small in comparison to total Sb concentrations. Besides the geochemical analyses, microbial communities inhabiting the tailing samples were characterized to investigate the interplay between the microorganisms and environmental factors in mine tailings. In all samples, Proteobacteria and Actinobacteria were the most dominant phyla. At the genus level, Thiobacillus, Limnobacter, Nocardioides, Lysobacter, Phormidium, and Kaistobacter demonstrated relatively high abundances. The two most abundant genera, Thiobacillus and Limnobacter, are characterized as sulfur-oxidizing bacteria and thiosulfate-oxidizing bacteria, respectively, while the genus Lysobacter contains arsenic (As)-resistant bacteria. Canonical correspondence analysis (CCA) indicates that TOC and the sulfate to sulfide ratio strongly shaped the microbial communities, suggesting the influence of the environmental factors in the indigenous microbial communities. PMID:27188777

  18. Nuclear quadrupole resonance of iodine pentafluoride and its complexes with antimony pentafluoride

    International Nuclear Information System (INIS)

    The spectra of nuclear quadrupole resonance (NQR) have been obtained at 77 deg K for I127 and Sbsup(121,128) in the IF5, IF5xSbF5, IF5x2SbF5, CsIF6, and RbIF6 compounds. An agreement between quadrupole spectra and structural data have been observed. The results of studying IF5 by NQR, gamma resonance and microwave spectroscopy have been compared. It has been established that unshared electron pair of an iodine atom is stereochemically active which leads to a considerable distortion of octahedral symmetry of coordination polyhedron of the iodine atoms. The structure of complexes of iodine pentafluoride with antimony pentafluoride is given

  19. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic.

    Science.gov (United States)

    Jia, Nan; Sun, Liguang; He, Xin; You, Kehua; Zhou, Xin; Long, Nanye

    2012-12-01

    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. PMID:22885219

  20. A novel composite material based on antimony(III) oxide and amorphous silica

    Energy Technology Data Exchange (ETDEWEB)

    Zemnukhova, Ludmila A. [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation); Panasenko, Alexander E., E-mail: panasenko@ich.dvo.ru [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation)

    2013-05-01

    The composite material nSb₂O₃·mSiO₂·xH₂O was prepared by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. It has been shown that the composition of the material is influenced by the ratio of the initial components and the acidity of the reaction medium. The morphology of the material particles and its specific surface area have been determined. The thermal and optic properties were also investigated. - Graphical abstract: Novel composite material containing amorphous silica and crystal antimony(III) oxide has been synthesized by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. Highlights: • The composite material nSb₂O₃·mSiO₂·xH₂O was prepared in an aqueous medium. • The composition of the material is controllable by a synthesis conditions. • The morphology of the material and its optic properties have been determined.

  1. Evaluations of antimony and strontium interaction in an Al–Si–Cu–Zn die cast alloy

    Energy Technology Data Exchange (ETDEWEB)

    Farahany, Saeed, E-mail: saeedfarahany@gmail.com; Idris, Mohd Hasbullah; Ourdjini, Ali

    2014-05-01

    Graphical abstract: - Highlights: • Probable interactions between Sb and Sr in a complex Al–Si alloy were evaluated. • Sequence of addition did not affect thermal and microscopical characteristics. • Threshold ratio for the Sb and Sr interaction is proposed. - Abstract: The interaction between antimony and strontium in an ADC12 die casting alloy is investigated comprehensively by using a computer aided cooling curve thermal analysis coupled with microstructure inspection. The results of the thermal analysis show significant changes in Al–Si eutectic reaction based on different concentrations of Sb and Sr. Sb reduces the efficiency of Sr in modifying the eutectic Si. Based upon the data obtained in this study, the threshold Sr/Sb ratio should exceed about 0.5 in order to obtain fully modified structure. Moreover, a pre-eutectic reaction of Al{sub 2}Si{sub 2}Sr intermetallic was detected for high concentrations of Sr.

  2. Synthesis and optical properties of antimony oxide glasses doped with holmium trioxide

    Science.gov (United States)

    Raghunatha, S.; Eraiah, B.

    2016-05-01

    Holmium doped lithium-antimony-lead borate glasses having 1mol% AgNO3 with composition 50B2O3-20PbO-25Sb2O3-5Li2O have been prepared using single step melt quenching technique. The XRD spectrum confirms amorphous nature of glasses. The optical absorbance studies were carried out on these glasses. The optical direct band gap energies were found to be in the range of 3.10 eV to 3.31 eV and indirect band gap energies were found to be in the range of 2.28 eV to 3.00 eV. The refractive indexes have been calculated by using Lorentz-Lorenz formula and the calculated values in the range of 2.31 to 2.37.

  3. Properties of antimony doped ZnO thin films deposited by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Sadananda Kumar, N., E-mail: sadanthara@gmail.com; Bangera, Kasturi V.; Shivakumar, G. K. [National Institute of Technology Karnataka, Surathkal, Thin Films Laboratory, Department of Physics (India)

    2015-07-15

    Antimony (Sb) doped zinc oxide (ZnO) thin films were deposited on the glass substrate at 450°C using spray pyrolysis technique. Effect of Sb doping on surface morphology structural, optical and electrical properties were studied. X-ray diffraction (XRD) analysis showed that both the undoped and doped ZnO thin films are polycrystalline in nature with (101) preferred orientation. SEM analysis showed a change in surface morphology of Sb doped ZnO thin films. Doping results in a marked increase in conductivity without affecting the transmittance of the films. ZnO films prepared with 3 at % Sb shows the lowest resistivity of 0.185 Ohm cm with a Hall mobility of 54.05 cm{sup 2} V{sup –1} s{sup –1}, and a hole concentration of 6.25 × 10{sup 17} cm{sup –3}.

  4. First-Principles Study of Antimony Doping Effects on the Iron-Based Superconductor CaFe(SbxAs1-x)2

    Science.gov (United States)

    Nagai, Yuki; Nakamura, Hiroki; Machida, Masahiko; Kuroki, Kazuhiko

    2015-09-01

    We study antimony doping effects on the iron-based superconductor CaFe(SbxAs1-x)2 by using the first-principles calculation. The calculations reveal that the substitution of a doped antimony atom into As of the chainlike As layers is more stable than that into FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers, which only exist in the novel 112 system, is responsible for rising up the critical temperature. We discuss antimony doping effects on the electronic structure. It is found that the calculated band structures with and without the antimony doping are similar to each other within our framework.

  5. First-principles study of antimony doping effects on the iron-based superconductor CaFe(SbxAs1−x)2

    International Nuclear Information System (INIS)

    We study antimony doping effects on the iron-based superconductor CaFe(SbxAs1−x)2 by using the first-principles calculation. The calculations reveal that the substitution of a doped antimony atom into As of the chainlike As layers is more stable than that into FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers, which only exist in the novel 112 system, is responsible for rising up the critical temperature. We discuss antimony doping effects on the electronic structure. It is found that the calculated band structures with and without the antimony doping are similar to each other within our framework. (author)

  6. Optical properties of Eu3+-doped antimony-oxide-based low phonon disordered matrices

    Science.gov (United States)

    Som, Tirtha; Karmakar, Basudeb

    2010-01-01

    A new series of monolithic Eu2O3-doped high antimony oxide (40-80 mol%) content disordered matrices (glasses) of low phonon energy (about 600 cm-1) in the K2O-B2O3-Sb2O3 (KBS) system was prepared by the melt-quench technique. Infrared reflection spectroscopy was used to establish the low phonon energy of the glasses. Amorphicity and devitrification of the glasses were confirmed by x-ray diffraction analysis. UV-vis absorption spectra of Eu3+ have been measured and the band positions have been justified with quantitative calculation of the nephelauxetic parameter and covalent bonding characteristics of the host. These Eu2O3-doped glasses upon excitation at 393 nm radiation exhibit six emission bands in the range 500-750 nm due to their low phonon energy. Of these, the magnetic dipole ^{5}\\mathrm {D}_{0} \\to {}^{7} \\mathrm {F_{1}} transition shows small Stark splitting while the electric dipole ^{5}\\mathrm {D}_{0} \\to {}^{7}\\mathrm {F}_{2} transition undergoes remarkable Stark splitting into two components. They have been explained by the crystal field effect. The Judd-Ofelt parameters, Ωt = 2,4,6, were also evaluated and the change of Ωt with the glass composition was correlated with the asymmetric effect at Eu3+ ion sites and the fundamental properties like covalent character and optical basicity. We are the first to report the spectroscopic properties of the Eu3+ ion in KBS low phonon antimony glasses.

  7. Impact of arsenic on uptake and bio-accumulation of antimony by arsenic hyperaccumulator Pteris vittata

    International Nuclear Information System (INIS)

    Individual uptake of As and Sb species in Pteris vittata have been investigated, but little information is available how uptake is affected if both metalloids are simultaneously present in different amounts. We investigated the uptake of antimony and its speciation in Pteris vittata cultivated in quartz substrate with, versus without, co-contamination with arsenic and a contaminated soil for 7 weeks. Applying HPLC-ICP-MS technique Sb(V), Sb(III), As(III), and As(V) could be identified as main species in aqueous extracts of roots and fronds with up to 230 mg kg−1 of total Sb in the roots. Adding increasing amounts of As to the quartz substrate resulted in increasing uptake of Sb. In contrast to As, which is readily transferred to the fronds, Sb is primarily accumulated in the roots with Sb(V) being the dominant species (>90% of Sb). The addition of As doesn't result in enhanced translocation of Sb into the fronds. Highlights: ► Antimonate is bioavailable to P. vittata grown for 7 weeks in different substrates. ► Antimony is primarily accumulated in the roots with Sb(V) being the dominant species. ► Sb(III) is present to a somewhat higher portion in the fronds than in the roots. ► Increasing amounts of As(V) in substrate resulted in increasing uptake of Sb(V). ► Addition of As is not accompanied by any alteration of Sb translocation to fronds. -- Roots of Pteris vittata cultivated under green-house conditioned in substrates containing antimonate accumulates Sb(V). This was promoted by As(V)

  8. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    International Nuclear Information System (INIS)

    A new antimony-based glass system (K2O-B2O3-Sb2O3) having low phonon energy (about 600 cm-1) doped with Sm3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm2O3. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the 4G5/2→6H5/2, 4G5/2→6H7/2 and 4G5/2→6H9/2 transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G5/2) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1)

  9. Study of soil erosion using environmental isotope cesium-137 (137Cs)

    International Nuclear Information System (INIS)

    The environmental tracer hay a potential to be used to trace sediment movement. Caesium (Cs), a radionuclide released from nuclear weapon tests is strongly absorbed on clay. The '1'3'7 Cs content in soil profile has been used to estimate soil loss due to water erosion in agricultural land. Soil samples were collected at the study and reference sites using a sampling frame with dimensions of 20 cm x 50 cm x 24 cm. In each depth-incremental soil sampling, the plate was placed on the soil surface and hammered into the soil, a scrapper plate was used to slice off soil in 2 cm increment to a depth of 40 cm. The '1'3'7 Cs content in an undisturbed site accumulated in the upper portion of the soil profile whereas in the disturbed sites the contents are nearly mixed within the plough layer. The eroded soil contained less '1'3'7 Cs compared to the uneroded sites. An empirical model is used to quantify the soil loss. The estimated erosion rates on slopes located at D, E, F are found to be 0. 54 ± 0. 03 tonne/hectare/year, 1.42 ± 0.12 tonne/hectare/year and 0.060 ± 0.009 tonne/hectare/year giving the average of 0.069 ± 0.08 tonne/hectare/year. This result suggest '1'3'7 Cs have the considerable value in data collection for long term-erosion studies. (author)

  10. 14 CFR 137.39 - Economic poison dispensing.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Economic poison dispensing. 137.39 Section... AIRCRAFT OPERATIONS Operating Rules § 137.39 Economic poison dispensing. (a) Except as provided in... economic poison that is registered with the U.S. Department of Agriculture under the Federal...

  11. 10 CFR 26.137 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.137 Section 26....137 Quality assurance and quality control. (a) Quality assurance program. Each licensee testing facility shall have a quality assurance program that encompasses all aspects of the testing...

  12. Correlation of erosion measurements and soil caesium-137 content

    International Nuclear Information System (INIS)

    This paper reports a calibration between measured soil loss from small plots and measured soil 137Cs content (expressed as a percentage loss relative to the 137Cs content of a local stable reference soil). The regression represents a simple and rapid tool for the estimation of net soil loss from sites which have a uniform and continuous history of land-use. (author)

  13. Accumulation and distribution 137Сs in predators’ organism

    Directory of Open Access Journals (Sweden)

    A. V. Gulakov

    2007-10-01

    Full Text Available Data of the long-term research of accumulation and distribution 137Cs radionuclide in organisms of predatory wild animals from the alienation zone of the Chernobyl nuclear power station are presented. Essential fluctuations of the 137Cs contents in muscular tissue are noted. The results have large practical value for management of the hunting facilities on the radioactively polluted territories.

  14. 14 CFR 21.137 - Location of manufacturing facilities.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Location of manufacturing facilities. 21.137 Section 21.137 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... manufacturing facilities. The Administrator does not issue a production certificate if the...

  15. 21 CFR 133.137 - Washed curd cheese for manufacturing.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Washed curd cheese for manufacturing. 133.137... Standardized Cheese and Related Products § 133.137 Washed curd cheese for manufacturing. Washed curd cheese for manufacturing conforms to the definition and standard of identity prescribed for washed curd cheese by §...

  16. Cumulative deposition of 137Cs in the soil of Korea

    International Nuclear Information System (INIS)

    The cumulative deposition of 137Cs in the soil of Korea has been studied. Using γ-ray spectrometry, the concentrations of 137Cs were determined for the soil samples collected to a depth of 20 cm. The average accumulated depositions of 137Cs were estimated roughly to be 2,501 ±499 Bq m-2 in the forest and 1,058 ±322 Bq m-2 in the hill. The inventory value of 137Cs in the forest is about two times higher than that in the hill. Except for some cases, the concentrations of 137Cs in the undisturbed soils decreased exponentially with increasing the soil depth. The influences of rainfall, organic matter content, clay content and pH on the deposition of 137Cs were studied using the field method. Among these factors, the organic matter content played the most important role in the retention and relative mobility of 137Cs in the soil. The other factors such as rainfall, clay content and pH showed weak correlation with the deposition of 137Cs in the soil

  17. 36 CFR 223.137 - Causes for debarment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Causes for debarment. 223.137... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Suspension and Debarment of Timber Purchasers § 223.137 Causes for debarment. The debarring official may debar a purchaser for any of the following causes:...

  18. 14 CFR 137.51 - Operation over congested areas: General.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Operation over congested areas: General. 137.51 Section 137.51 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS AGRICULTURAL AIRCRAFT OPERATIONS Operating Rules...

  19. 49 CFR 229.137 - Sanitation, general requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Sanitation, general requirements. 229.137 Section... Cab Equipment § 229.137 Sanitation, general requirements. (a) Sanitation compartment. Except as provided in paragraph (b) of this section, all lead locomotives in use shall be equipped with a...

  20. 34 CFR 300.137 - Equitable services determined.

    Science.gov (United States)

    2010-07-01

    ... Private Schools § 300.137 Equitable services determined. (a) No individual right to special education and related services. No parentally-placed private school child with a disability has an individual right to... 34 Education 2 2010-07-01 2010-07-01 false Equitable services determined. 300.137 Section...

  1. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    OpenAIRE

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt; Gammelgaard, Bente; Stürup, Stefan; Hansen, Helle Rüsz

    2011-01-01

    In solution antimony exists either in the pentavalent or trivalent oxidation state. As Sb(III) is more toxic than Sb(V), it is important to be able to perform a quantitative speciation analysis of Sb’s oxidation state. The most commonly applied chromatographic methods used for this redox speciation analysis do, however, often show a low chromatographic Sb recovery when samples of environmental or biological origin are analysed. In this study we explored basal chemistry of antimony and found t...

  2. Sediment environmental capacity of 137Cs in Daya Bay

    Institute of Scientific and Technical Information of China (English)

    ZHANG Junli; CHEN Jiajun; XU Jialin; LI Yuanxin; HUANG Naiming

    2007-01-01

    Sediment environmental capacity of pollutants is very important for marine environmental management.Based on the methodology of a study on water,soil environmental capacity,and mass conservation theory in a system,the concept and model on sediment environmental capacity for 137Cs in Daya Bay were developed.The static capacity for 137Cs in the upper sediment near the shore at a shallow area was calculated,and the annual dynamic capacity and total dynamic capacity were also calculated through determination of the typical biomass in the sediment.The results showed that the estimated environmental capacity for 137Cs in sediments was approximately equal to the current input of 137Cs into the sediments.Controlling the input of 137Cs in the sediments within the environmental capacity guarantees the sustainability of the current situation of the Daya Bay ecosystem and avoidance of a significant degradation of the system.

  3. {sup 137}Cs accumulation in coastal sediments in Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Pettersson, H.B.L.; Salih, I. [Linkoeping Univ. (Sweden). Dept. of Radiation Physics; Herrmann, J. [Federal Maritime and Hydrographic Agency, Hamburg (Germany)

    2005-09-15

    Seabed sediment samples were collected in 1998, 2000 and 2001 at 20 sites located in the Baltic Sea and 4 sites in the Skagerrak. The objectives of the sampling campaigns were (i) to establish the coastal sediment distribution of {sup 137}Cs, (ii) to evaluate the vertical core distribution of {sup 137}Cs, (iii) to study the sediment accumulation rates, and (iv) to assess the sediment inventories of {sup 137}Cs. The results show a very high variation in {sup 137}Cs concentrations and an almost 100-fold difference in inventories, showing predominance of Chernobyl derived {sup 137}Cs in the Baltic Proper compared to the western Baltic and the Skagerrak areas. Sediment accumulation rates were highly dependent on sediment types and ranged from 0.05 to 1.8 cm/y.

  4. Evaluating gully erosion using 137Cs and 210Pb/137Cs ratio in a reservoir catchment

    International Nuclear Information System (INIS)

    Water erosion in the hilly areas of west China is the main process contributing to the overall sediment of the Yellow River and the Yangtze River. The impact of gully erosion in total sediment output has been mostly neglected. Our objective was to assess the sediment production and sediment sources at both the hillslope and catchment scales in the Yangjuangou reservoir catchment of the Chinese Loess Plateau, northwest China. Distribution patterns in sediment production caused by water erosion on hills and gully slopes under different land use types were assessed using the fallout 137Cs technique. The total sediment production from the catchment was estimated by using the sediment record in a reservoir. Sediment sources and dominant water erosion processes were determined by comparing 137Cs activities and 210Pb/137Cs ratios in surface soils and sub-surface soils with those of sediment deposits from the reservoir at the outlet of the catchment. Results indicated that landscape location had the most significant impact on sediment production for cultivated hillslopes, followed by the terraced hillslope, and the least for the vegetated hillslope. Sediment production increased in the following order: top>upper>lower>middle for the cultivated hillslope, and top>lower>upper>middle for the terraced hillslope. The mean value of sediment production declined by 49% for the terraced hillslope and by 80% for the vegetated hillslope compared with the cultivated hillslope. Vegetated gully slope reduced the sediment production by 38% compared with the cultivated gully slope. These data demonstrate the effectiveness of terracing and perennial vegetation cover in controlling sediment delivery at a hillslope scale. Averaged 137Cs activities and 210Pb/137Cs ratios in the 0-5 cm surface soil (2.22-4.70 Bq kg-1 and 20.70-22.07, respectively) and in the 5-30 cm subsoil (2.60 Bq kg-1 and 28.57, respectively) on the cultivated hills and gully slopes were close to those of the deposited

  5. Decreased antimony uptake and overexpression of genes of thiol metabolism are associated with drug resistance in a canine isolate of Leishmania infantum.

    Science.gov (United States)

    Gómez Pérez, Verónica; García-Hernandez, Raquel; Corpas-López, Victoriano; Tomás, Ana M; Martín-Sanchez, Joaquina; Castanys, Santiago; Gamarro, Francisco

    2016-08-01

    Visceral leishmaniasis (VL) caused by the protozoan parasite Leishmania infantum, is one of the most important zoonotic diseases affecting dogs and humans in the Mediterranean area. The presence of infected dogs as the main reservoir host of L. infantum is regarded as the most significant risk for potential human infection. We have studied the susceptibility profile to antimony and other anti-leishmania drugs (amphotericin B, miltefosine, paromomycin) in Leishmania infantum isolates extracted from a dog before and after two therapeutic interventions with meglumine antimoniate (subcutaneous Glucantime(®), 100 mg/kg/day for 28 days). After the therapeutic intervention, these parasites were significantly less susceptible to antimony than pretreatment isolate, presenting a resistance index of 6-fold to Sb(III) for promastigotes and >3-fold to Sb(III) and 3-fold to Sb(V) for intracellular amastigotes. The susceptibility profile of this resistant L. infantum line is related to a decreased antimony uptake due to lower aquaglyceroporin-1 expression levels. Additionally, other mechanisms including an increase in thiols and overexpression of enzymes involved in thiol metabolism, such as ornithine decarboxylase, trypanothione reductase, mitochondrial tryparedoxin and mitochondrial tryparedoxin peroxidase, could contribute to the resistance as antimony detoxification mechanisms. A major contribution of this study in a canine L. infantum isolate is to find an antimony-resistant mechanism similar to that previously described in other human clinical isolates. PMID:27317865

  6. Remediation of antimony-rich mine waters: Assessment of antimony removal and shifts in the microbial community of an onsite field-scale bioreactor.

    Science.gov (United States)

    Sun, Weimin; Xiao, Enzong; Kalin, Margarete; Krumins, Valdis; Dong, Yiran; Ning, Zengping; Liu, Tong; Sun, Min; Zhao, Yanlong; Wu, Shiliang; Mao, Jianzhong; Xiao, Tangfu

    2016-08-01

    An on-site field-scale bioreactor for passive treatment of antimony (Sb) contamination was installed downstream of an active Sb mine in Southwest China, and operated for one year (including a six month monitoring period). This bioreactor consisted of five treatment units, including one pre-aerobic cell, two aerobic cells, and two microaerobic cells. With the aerobic cells inoculated with indigenous mine water microflora, the bioreactor removed more than 90% of total soluble Sb and 80% of soluble antimonite (Sb(III)). An increase in pH and decrease of oxidation-reduction potential (Eh) was also observed along the flow direction. High-throughput sequencing of the small subunit ribosomal RNA (SSU rRNA) gene variable (V4) region revealed that taxonomically diverse microbial communities developed in the bioreactor. Metal (loid)-oxidizing bacteria including Ferrovum, Thiomonas, Gallionella, and Leptospirillum, were highly enriched in the bioreactor cells where the highest total Sb and Sb(III) removal occurred. Canonical correspondence analysis (CCA) indicated that a suite of in situ physicochemical parameters including pH and Eh were substantially correlated with the overall microbial communities. Based on an UPGMA (Unweighted Pair Group Method with Arithmetic Mean) tree and PCoA (Principal Coordinates Analysis), the microbial composition of each cell was distinct, indicating these in situ physicochemical parameters had an effect in shaping the indigenous microbial communities. Overall, this study was the first to employ a field-scale bioreactor to treat Sb-rich mine water onsite and, moreover, the findings suggest the feasibility of the bioreactor in removing elevated Sb from mine waters. PMID:27208755

  7. 137Cs in the western South Pacific Ocean

    International Nuclear Information System (INIS)

    The 137Cs activities were determined for seawater samples from the East Caroline, Coral Sea, New Hebrides, South Fiji and Tasman Sea (two stations) Basins of the western South Pacific Ocean by γ spectrometry using a low background Ge detector. The 137Cs activities ranged from 1.4 to 2.3 Bq m-3 over the depth interval 0-250 m and decreased exponentially from the subsurface to 1000 m depth. The distribution profiles of 137Cs activity at these six western South Pacific Ocean stations did not differ from each other significantly. There was a remarkable difference for the vertical profiles of 137Cs activity between the East Caroline Basin station in this study and the GEOSECS (Geochemical Ocean Sections Study) station at the same latitude in the Equatorial Pacific Ocean; the 137Cs inventory over the depth interval 100-1000 m increased from 400 ± 30 Bq m-2 to 560 ± 30 Bq m-2 during the period from 1973 to 1992. The total 137Cs inventories in the western South Pacific Ocean ranged from 850 ± 70 Bq m-2 in the Coral Sea Basin to 1270 ± 90 Bq m-2 in the South Fiji Basin. Higher 137Cs inventories were observed at middle latitude stations in the subtropical gyre than at low latitude stations. The 137Cs inventories were 1.9-4.5 times (2.9 ± 0.7 on average) and 1.7-4.3 times (3.1 ± 0.7 on average) higher than that of the expected deposition density of atmospheric global fallout at the same latitude and that of the estimated 137Cs deposition density in 10o latitude by 10 deg. longitude grid data obtained by Aoyama et al. [Aoyama M, Hirose K, Igarashi Y. Re-construction and updating our understanding on the global weapons tests 137Cs fallout. J Environ Monit 2006;8:431-438], respectively. The possible processes for higher 137Cs inventories in the western South Pacific Ocean than that of the expected deposition density of atmospheric global fallout may be attributable to the inter-hemisphere dispersion of the atmospheric nuclear weapons testing 137Cs from the northern

  8. Sodium Antimony Gluconate Induces Generation of Reactive Oxygen Species and Nitric Oxide via Phosphoinositide 3-Kinase and Mitogen-Activated Protein Kinase Activation in Leishmania donovani-Infected Macrophages

    OpenAIRE

    Mookerjee Basu, Jayati; Mookerjee, Ananda; Sen, Prosenjit; Bhaumik, Suniti; Sen, Pradip; Banerjee, Subha; Naskar, Ksudiram; Choudhuri, Soumitra K.; Saha, Bhaskar; Raha, Sanghamitra; Roy, Syamal

    2006-01-01

    Pentavalent antimony complexes, such as sodium stibogluconate and sodium antimony gluconate (SAG), are still the first choice for chemotherapy against various forms of leishmaniasis, including visceral leishmaniasis, or kala-azar. Although the requirement of a somewhat functional immune system for the antileishmanial action of antimony was reported previously, the cellular and molecular mechanism of action of SAG was not clear. Herein, we show that SAG induces extracellular signal-regulated k...

  9. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    Energy Technology Data Exchange (ETDEWEB)

    Sehmel, G.A.

    1989-05-01

    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ..delta..G/sub f,298//sup o/, ..delta..H/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (..delta..H/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs.

  10. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    International Nuclear Information System (INIS)

    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ΔG/sub f,298//sup o/, ΔH/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (ΔH/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs

  11. Interest of lymphoscintigraphy with 99sup(m)Tc-labelled antimony sulfide in the arms after breast carcinoma treatment

    International Nuclear Information System (INIS)

    2 mCi of antimony sulfide colloid labelled with sup(99m)Tc were injected subcutaneously between the digits in 25 patients with postoperative lymphoedema of the arm for breast carcinoma. The two arms are examined successively, the normal one being used as control. The lymphoscintigraphy is realised with a gamma camera during an hour. The information obtained is threefoled; on the peripheral block's importance, the place where the lymphatic flow is stopped, and the presence in 40% of patients of axillary lymph nodes. The diminution of the lymphatic flow is not in correlation with the lymphoedema's importance. Lymphoscintigraphy with sup(99m)Tc antimony sulfide colloid is a simple examination but some side effects may occur. In 7 patients, post-injection lymphangitis was observed, with favorable evolution under antibiotic treatment. The lymphoscintigraphy can give some interesting information on the evolution of treated lymphoedema

  12. Antimony incorporation in InAs quantum dots grown on GaAs substrate by molecular beam epitaxy

    Science.gov (United States)

    Rihani, J.; Sallet, V.; Christophe, H. J.; Oueslati, M.; Chtourou, R.

    2008-01-01

    We have grown InAs(Sb) quantum dots (QDs) on GaAs (0 0 1) substrates by molecular beam epitaxy (MBE) using two different antimony exposures ( ΦSb). Atomic force microscopy (AFM) and photoluminescence (PL) spectroscopy were carried out to investigate the dot size evolution as function of the incorporated antimony content in InAs/GaAs QDs material. Anomalous asymmetric-band feature was observed in room temperature photoluminescence (RTPL) spectra of the investigated QD samples grown at relatively high temperature (490 °C). From the temperature-dependent PL measurements, it was found that the asymmetric-band feature is associated with the ground-states transitions from QDs with bimodal size distribution. The analysis of the pump power dependent PL spectra allows us to suggest a type II band lineup for the InAsSb/GaAs QDs materials system.

  13. Distribution of 137Cs in water leachates of forest humus

    International Nuclear Information System (INIS)

    The distribution of 137Cs in water extracts of organic layers of forest soils was investigated using an ultrafiltration method. Samples were taken from two sites in the Bavarian Alps. The different horizons of the organic layers were extracted by column elution with water and 50 mmol/litre CsCl solution. Water extracts were fractionated using membranes with the molecular weight cutoff of 500, 1000 and 3000 Dalton to determine the molecular weight distribution of dissolved organic carbon (DOC). The activity of 137Cs associated with the different DOC-fractions was measured by direct gammaspectrometry. Cesium-137 in the fraction smaller than 500 Dalton was defined as 'ionic'. The results indicated a change of the binding sites depending on the degree of decomposition and humification in the profile. Organic bound 137Cs was identified in all extracts. High mobilities of DOC and 137Cs were observed in the same horizons, fractionation showed then low-molecular-weight DOC and 137Cs mainly in ionic form. In horizons with high-molecular-weight DOC the portion of organic bound 137Cs ranged up to 40%. (author)

  14. Spatial variability and Cesium-137 inventories in native forest

    International Nuclear Information System (INIS)

    With the nuclear fission discovery and development of nuclear weapons in 1940s, artificial radioisotopes were introduced in the environment. This contamination is due to worldwide fallout by superficial nuclear tests realized from early 1950s to late 1970s by USA, former URSS, UK, France and China. One of theses radioisotopes that have been very studied is cesium-137. Cesium-137 has a half-life of 30.2 years and its biological behavior is similar to the potassium. The behavior in soil matrix, depth distribution, spatial variability and inventories values of cesium-137 has been determinate for several regions of the world. In Brazil, some research groups have worked on this subject, but there are few works published about theses properties of cesium-137. The aim of this paper was study the depth distribution, spatial variability, and inventory of cesium-137 in native forest. Two native forests (Mata 1 and Mata UEL) were sampling in region of Londrina, PR. The results shows that there is a spatial variability of 40% for Mata 1 and 42% for Mata UEL. The depth distribution of cesium-137 for two forests presented a exponential form, characteristic to undisturbed soil. Cesium-137 inventory determinate for Mata 1 was 358 Bq m-2 and for Mata UEL was 320 Bq m-2. (author)

  15. Co-administration of glycyrrhizic acid with the antileishmanial drug sodium antimony gluconate (SAG) cures SAG-resistant visceral leishmaniasis.

    Science.gov (United States)

    Bhattacharjee, Amrita; Majumder, Saikat; Majumdar, Suchandra Bhattacharyya; Choudhuri, Soumitra Kumar; Roy, Syamal; Majumdar, Subrata

    2015-03-01

    Since there are very few affordable antileishmanial drugs available, antimonial resistance has crippled antileishmanial therapy, thereby emphasising the need for development of novel therapeutic strategies. This study aimed to evaluate the antileishmanial role of combined therapy with sodium antimony gluconate (SAG) and the triterpenoid glycyrrhizic acid (GA) against infection with SAG-resistant Leishmania (GE1F8R). Combination therapy with GA and SAG successfully limited infection with SAG-resistant Leishmania in a synergistic manner (fractional inhibitory concentration index resistant Leishmania and co-treated with GA and SAG exhibited a significant reduction in hepatic and splenic parasite burden. In probing the mechanism, it was observed that GA treatment suppressed the expression and efflux activity of P-glycoprotein (P-gp) and multidrug resistance-associated protein 1 (MRP1), two host ABC transporters responsible for antimony efflux from host cells infected with SAG-resistant parasites. This suppression correlated with greater intracellular antimony retention during SAG therapy both in vitro and in vivo, which was reflected in the reduced parasite load. Furthermore, co-administration of GA and SAG induced a shift in the cytokine balance towards a Th1 phenotype by augmenting pro-inflammatory cytokines (such as IL-12, IFNγ and TNFα) and inducing nitric oxide generation in GE1F8R-infected macrophages as well as GE1F8R-infected mice. This study aims to provide an affordable leishmanicidal alternative to expensive antileishmanial drugs such as miltefosine and amphotericin B. Furthermore, this report explores the role of GA as a resistance modulator in MRP1- and P-gp-overexpressing conditions. PMID:25600891

  16. The Potential Impact of Biofield Energy Treatment on the Atomic and Physical Properties of Antimony Tin Oxide Nanopowder

    OpenAIRE

    Trivedi, Mahendra Kumar

    2015-01-01

    Antimony tin oxide (ATO) is known for its high thermal conductivity, optical transmittance, and wide energy band gap, which makes it a promising material for the display devices, solar cells, and chemical sensor industries. The present study was undertaken to evaluate the effect of biofield energy treatment on the atomic and physical properties of ATO nanopowder. The ATO nanopowder was divided into two parts: control and treated. The treated part was subjected to Mr. Trivedi’s biofield ...

  17. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony

    OpenAIRE

    D. Medlen; D. Bolibruchova

    2012-01-01

    The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eut...

  18. EFFECT OF GRAIN BOUNDARY SEGREGATION OF ANTIMONY ON RELAXATION AT GRAIN BOUNDARIES IN SILICON-IRON ALLOYS

    OpenAIRE

    Iwasaki, Y.; Fujimoto, K

    1981-01-01

    A sharp grain boundary peak appears in both 2 and 3% silicon-iron alloys due to a substitutional solute of silicon. This peak is highly sensitive to the segregation of the third element of antimony and, contrary to orthodox solute peaks in binary and ternary alloys, largely decreases in magnitude on heating after a segregation treatment. The subsequent measurement on cooling returns the peak to the ordinary magnitude. As a function of annealing time at a temperature of segregation, the height...

  19. Exploring screen printing technology on thermoelectric energy harvesting with printing copper-nickel and bismuth-antimony thermocouples

    OpenAIRE

    Cao, Zhuo; Koukharenko, Elena; Torah, R; Beeby, SP

    2013-01-01

    This paper reports the fabrication and testing of copper (Cu) - nickel (Ni) and bismuth (Bi) - antimony (Sb) based thermocouples fabricated using screen printing technology. The transport properties of the printed thermoelectric material were measured in room temperature while the Seebeck voltage and power output of the printed thermocouples were tested under a variety temperature gradient. Initial thermoelectric materials have been integrated in inks and then deposited on substrate by the si...

  20. Potentiometric stripping analysis of antimony based on carbon paste electrode modified with hexathia crown ether and rice husk

    International Nuclear Information System (INIS)

    Highlights: → Potentiometric stripping analysis (PSA) employed for the determination of antimony. → Hexathia-18C6 and rice husk modified carbon paste electrode developed for the analysis. → Lowest detection limit obtained for the determination of Sb(III) using PSA. → Analysis of Sb in pharmaceutical formulations, human hair, blood serum, urine and sea water. → Rice husk used as a modifier for the first time in electrochemistry. - Abstract: An electrochemical method based on potentiometric stripping analysis (PSA) employing a hexathia 18C6 (HT18C6) and rice husk (RH) modified carbon paste electrode (HT18C6-RH-CPE) has been proposed for the subnanomolar determination of antimony. The characterization of the electrode surface has been carried out by means of scanning electron microscopy, cyclic voltammetry, electrochemical impedance spectroscopy and chronocoulometry. By employing HT18C6-RH-CPE, a 12-fold enhancement in the PSA signal (dt/dE) was observed as compared to plain carbon paste electrode (PCPE). Under the optimized conditions, dt/dE (s V-1) was proportional to the Sb(III) concentration in the range of 1.42 x 10-8 to 6.89 x 10-11 M (r = 0.9944) with the detection limit (S/N = 3) of 2.11 x 10-11 M. The practical analytical utilities of the modified electrode were demonstrated by the determination of antimony in pharmaceutical formulations, human hair, sea water, urine and blood serum samples. The prepared modified electrode showed several advantages, such as simple preparation method, high sensitivity, very low detection limit and excellent reproducibility. Moreover, the results obtained for antimony analysis in commercial and real samples using HT18C6-RH-CPE and those obtained by inductively coupled plasma-atomic emission spectrometry (ICP-AES) are in agreement at the 95% confidence level.

  1. Potentiometric stripping analysis of antimony based on carbon paste electrode modified with hexathia crown ether and rice husk

    Energy Technology Data Exchange (ETDEWEB)

    Gadhari, Nayan S.; Sanghavi, Bankim J. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India); Srivastava, Ashwini K., E-mail: aksrivastava@chem.mu.ac.in [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai 400098 (India)

    2011-10-03

    Highlights: {yields} Potentiometric stripping analysis (PSA) employed for the determination of antimony. {yields} Hexathia-18C6 and rice husk modified carbon paste electrode developed for the analysis. {yields} Lowest detection limit obtained for the determination of Sb(III) using PSA. {yields} Analysis of Sb in pharmaceutical formulations, human hair, blood serum, urine and sea water. {yields} Rice husk used as a modifier for the first time in electrochemistry. - Abstract: An electrochemical method based on potentiometric stripping analysis (PSA) employing a hexathia 18C6 (HT18C6) and rice husk (RH) modified carbon paste electrode (HT18C6-RH-CPE) has been proposed for the subnanomolar determination of antimony. The characterization of the electrode surface has been carried out by means of scanning electron microscopy, cyclic voltammetry, electrochemical impedance spectroscopy and chronocoulometry. By employing HT18C6-RH-CPE, a 12-fold enhancement in the PSA signal (dt/dE) was observed as compared to plain carbon paste electrode (PCPE). Under the optimized conditions, dt/dE (s V{sup -1}) was proportional to the Sb(III) concentration in the range of 1.42 x 10{sup -8} to 6.89 x 10{sup -11} M (r = 0.9944) with the detection limit (S/N = 3) of 2.11 x 10{sup -11} M. The practical analytical utilities of the modified electrode were demonstrated by the determination of antimony in pharmaceutical formulations, human hair, sea water, urine and blood serum samples. The prepared modified electrode showed several advantages, such as simple preparation method, high sensitivity, very low detection limit and excellent reproducibility. Moreover, the results obtained for antimony analysis in commercial and real samples using HT18C6-RH-CPE and those obtained by inductively coupled plasma-atomic emission spectrometry (ICP-AES) are in agreement at the 95% confidence level.

  2. Measurement of Caesium-137 in the Normal Person

    International Nuclear Information System (INIS)

    During the period June 1959 to October 1963 the Landstuhl whole-body counter has measured the caesium-137 content of more than 15 000 normal persons. The monthly averages of these measurements indicate a steady increase In the caesium-137 content since June 1962. This increase has become more rapid during the period June 1963 to October 1963. A further evaluation of the monthly averages since June 1962 indicates a mean biologic half-life of caesium-137 of 140 d for persons older than 22 yr. A comparison of the mean caesium-137 content of persons between 8 and 17 yr of age with those older than 22 appears to indicate that the biologic half-life of caesium-137 is shorter in the younger people. This is in agreement with earlier data from this counter concerning measurements of caesium-137 content between June 1959 and December 1960: these data showed a lower caesium-137 content in children than in adults. Another evaluation of recent data from this unit concerns the standard deviation (sigma) of the caesium-137 content in a large population. From this population the sigma of measured caesium/g body potassium values is 33%. This is more than twice the sigma of the body potassium content of this same population. By comparing a group of persons who have undergone several repeat assays over an extended period of time with the monthly means of the total population measured, it has been found that the large sigma of caesium-137 content cannot be caused solely by the varying diets of the population measured. (author)

  3. Pollution of drug-technical materials by cesium-137

    International Nuclear Information System (INIS)

    Drug-technical raw materials are medicinal plants (flowers, folium, grasses, mushrooms, roots, fruits, berry, kidney, cortex), used in pharmacy. To limit receipt cesium-137 in people body in 1993 in the Republic of Belarus were created 'Temporary permission levels of the cesium-137 radionuclides contents in drug-technical raw materials' were created (TPL-1993). The permission levels of cesium-137 are following: for drug-technical raw material (flowers, folium, grass, mushrooms, roots and other plants parts) - 1850 Bq/kg, for dried up fruits and berries - 2590 Bq/kg. (Author)

  4. The β decay of tellurium 135 and 137

    International Nuclear Information System (INIS)

    Tellurium 135 and 137 nuclei were produced in thermal neutron fission of 235U separated by on-line isotope separator and deposited on a movable tape. Gamma ray singles, γ-γ, β-γ coincidences and time sequenced γ spectra were collected using Ge(Li) detectors and scintillator (NE 102 A) telescope. The half-lives and mass excesses of 135Te and 137Te were measured and level schemes of 135I and 137I have been established. The level scheme of 135I has been compared to different shell model calculations

  5. 137Cs contaminated waste disposal in cement factory: Environmental problems

    International Nuclear Information System (INIS)

    In the course of utilization (May-June '91) of aluminum slags polluted by 137Cs at the cement factory Presacementi in Robilante (Cuneo, Italy) and during the following months, samples were taken in particular points of the plant, at fixed frequencies. Samples were analyzed to determine 137Cs concentration. Collected data were used to study the behaviour of the element throughout the process. Emissions and ground level air concentrations were estimated from the available data. Contamination of the manufactured cement were monitored until negligible values of 137Cs concentration were attained

  6. Cesium-137 seasonal balance in the Nemuna River, Lithuania

    International Nuclear Information System (INIS)

    Seasonal variations of 137Cs outflow to the Curonian Gulf from the Nemunas-Neris waters were studied under the non-typical climate conditions of 1996. 137Cs accumulation dominated in the total annual balance of this nuclide in the Nemunas-Neris water system, since high concentrations were characteristic only in the spring flood season. The removal of 137Cs from the Nemunas-Neris River bed was the main process in autumn and winter. Presented data indicate the main inputs and outputs of radioactive pollution in the main water system of Lithuania and show that radionuclide input to Lithuania from Belarus is still important. (author)

  7. Separation of Lead from Crude Antimony by Pyro-Refining Process with NaPO3 Addition

    Science.gov (United States)

    Ye, Longgang; Hu, Yuejie; Xia, Zhimei; Chen, Yongming

    2016-06-01

    The main purpose of this study was to separate lead from crude antimony through an oxidation pyro-refining process and by using sodium metaphosphate as a lead elimination reagent. The process parameters that will affect the refining results were optimized experimentally under controlled conditions, such as the sodium metaphosphate charging dosage, the refining temperature and duration, and the air flow rate, to determine their effect on the lead content in refined antimony and the lead removal rate. A minimum lead content of 0.0522 wt.% and a 98.6% lead removal rate were obtained under the following optimal conditions: W_{{{NaPO}_{{3}} }} = 15% W Sb (where W represents weight), a refining temperature of 800°C, a refining time of 30 min, and an air flow rate of 3 L/min. X-ray diffractometry and scanning electron microscopy showed that high-purity antimony was obtained. The smelting operation is free from smoke or ammonia pollution when using monobasic sodium phosphate or ammonium dihydrogen phosphate as the lead elimination reagent. However, this refining process can also remove a certain amount of sulfur, cobalt, and silicon simultaneously, and smelting results also suggest that sodium metaphosphate can be used as a potential lead elimination reagent for bismuth and copper refining.

  8. Evaluation of potential dietary toxicity of heavy metals in some common Nigerian beverages: A look at antimony, tin and mercury

    Directory of Open Access Journals (Sweden)

    I.I. Roberts

    2011-11-01

    Full Text Available There is currently little information on the composition of heavy metals in beverages imported and locally produced in Nigeria. The study quantitatively determined the composition of antimony (Sb, tin (Sn and mercury (Hg in 50 different beverage samples and evaluated the extent of violation of guideline values. Analysis of the beverage samples for the presence of Sb, Sn, and Hg was carried out using an atomic absorption spectrophotometer (AAS 929. The mean values detected for mercury, tin and antimony (±SE in fruit juices and soft drinks were 2.39±0.25, 3.66±0.22 and 0.49±0.048 μg/l; 2.93±0.34, 3.60±0.46 and 0.49±0.10 μg/l in dairy drinks and 0.94±0.02, 4.34±0.48 and 0.48±0.05 μg/l in bottled water samples respectively. While antimony detected in all products was below guideline values, mercury and tin were above the acceptable levels established by the World Health Organization, United States Environmental Protection Agency and European Union in most samples tested.

  9. Distribution, speciation and availability of antimony (Sb) in soils and terrestrial plants from an active Sb mining area

    International Nuclear Information System (INIS)

    Here, we present one of the first studies investigating the mobility, solubility and the speciation-dependent in-situ bioaccumulation of antimony (Sb) in an active Sb mining area (Xikuangshan, China). Total Sb concentrations in soils are high (527-11,798 mg kg-1), and all soils, including those taken from a paddy field and a vegetable garden, show a high bioavailable Sb fraction (6.3-748 mg kg-1), dominated by Sb(V). Elevated concentrations in native plant species (109-4029 mg kg-1) underpin this. Both chemical equilibrium studies and XANES data suggest the presence of Ca[Sb(OH)6]2, controlling Sb solubility. A very close relationship was found between the citric acid extractable Sb in plants and water or sulfate extractable Sb in soil, indicating that citric acid extractable Sb content in plants may be a better predictor for bioavailable Sb in soil than total acid digestible Sb plant content. - Highlights: → Antimony (Sb) in soils from an active Sb mining area is highly bioavailable. → Sb occurs mainly as Sb(V) in Sb mining impacted soils and plants. → Sb solubility in Sb mining impacted soils is governed by Ca[Sb(OH)6]2. → Citric acid extractable Sb in plants and bioavailable Sb in soils are strongly correlated. - Antimony (Sb) in soils from an active Sb mining area is highly bioavailable and controlled by the solubility of calcium antimonate.

  10. Distribution, speciation and availability of antimony (Sb) in soils and terrestrial plants from an active Sb mining area

    Energy Technology Data Exchange (ETDEWEB)

    Okkenhaug, Gudny, E-mail: go@ngi.no [Norwegian University of Life Sciences, Department of Plant and Environmental Sciences, P.O. Box 5003, N-1432 As (Norway); Norwegian Geotechnical Institute, P.O. Box 3930, Ullevaal Stadion, NO-0806 Oslo (Norway); Zhu Yongguan [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Luo Lei [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Lei Ming [College of Resource and Environment, Hunan Agricultural University, Changsha 410128 (China); Li Xi [Department of Soil Environmental Science, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); Mulder, Jan [Norwegian University of Life Sciences, Department of Plant and Environmental Sciences, P.O. Box 5003, N-1432 As (Norway)

    2011-10-15

    Here, we present one of the first studies investigating the mobility, solubility and the speciation-dependent in-situ bioaccumulation of antimony (Sb) in an active Sb mining area (Xikuangshan, China). Total Sb concentrations in soils are high (527-11,798 mg kg{sup -1}), and all soils, including those taken from a paddy field and a vegetable garden, show a high bioavailable Sb fraction (6.3-748 mg kg{sup -1}), dominated by Sb(V). Elevated concentrations in native plant species (109-4029 mg kg{sup -1}) underpin this. Both chemical equilibrium studies and XANES data suggest the presence of Ca[Sb(OH){sub 6}]{sub 2}, controlling Sb solubility. A very close relationship was found between the citric acid extractable Sb in plants and water or sulfate extractable Sb in soil, indicating that citric acid extractable Sb content in plants may be a better predictor for bioavailable Sb in soil than total acid digestible Sb plant content. - Highlights: > Antimony (Sb) in soils from an active Sb mining area is highly bioavailable. > Sb occurs mainly as Sb(V) in Sb mining impacted soils and plants. > Sb solubility in Sb mining impacted soils is governed by Ca[Sb(OH){sub 6}]{sub 2}. > Citric acid extractable Sb in plants and bioavailable Sb in soils are strongly correlated. - Antimony (Sb) in soils from an active Sb mining area is highly bioavailable and controlled by the solubility of calcium antimonate.

  11. Precipitation of antimony from the solution of sodium thioantimonite by air oxidation in the presence of catalytic agents

    Institute of Scientific and Technical Information of China (English)

    杨天足; 赖琼琳; 唐建军; 楚广

    2002-01-01

    The behavior of antimony oxidation in the solution of sodium thioantimonite was studied in the presence of catalytic agents. The catalytic effects of the respective addition of cupric sulfate, sodium tartrate, potassium permanganate, phenol, 1,2-dihydroxybenzene and their combination on the oxidation of sodium thioantimonite were investigated. A pilot test was carried out. The results show that the respective use of sodium tartrate, cupric sulfate, potassium permanganate, phenol and 1,2-dihydroxybenzene have little catalytic effect on the oxidation of sodium thioantimonite. However there exists obvious catalytic oxidation by the combination of 0.25 g/L 1,2-dihydroxybenzene, 0.5 g/L potassium permanganate and 1.0 g/L phenol. Moreover, high blast intensity, the increase of temperature and NaOH concentration favor the oxidation of antimony. The oxidation process of antimony has such advantages as quick reaction and low operation costs. The results of the pilot test are consistent with those of laboratory experiments.

  12. Preparation of antimony sulfide semiconductor nanoparticles by pulsed laser ablation in liquid

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Ren-De, E-mail: son003@sekisui.com [Research & Development Institute, High Performance Plastics Company, Sekisui Chemical Co., Ltd. 2-1 Hyakuyama, Shimamoto-Cho, Mishima-Gun, Osaka, 618-0021 (Japan); Tsuji, Takeshi [Interdisciplinary Graduate School of Science and Engineering, Shimane University, 1060 Nishikawatsu-Cho, Matsue, 690-8504 (Japan)

    2015-09-01

    Highlights: • Pulsed laser ablation in liquid (LAL) was applied to prepare antimony sulfide nanoparticles (Sb{sub 2}S{sub 3} NPs). • Sb{sub 2}S{sub 3} NPs with a stoichiometric composition were successfully prepared by LAL in water without using any surfactants or capping agents. • Thus-prepared Sb{sub 2}S{sub 3} NPs showed low-temperature crystallization and melting at a temperature low as 200 °C. • The NPs-coated Sb{sub 2}S{sub 3} thin film showed comparable semiconductor properties (carrier mobility and carrier density) to the vacuum deposited one. • Byproducts such as CS{sub 2}, CH{sub 4} and CO were detected by GC-MS analysis when LAL was performed in organic solvent. • The LAL-induced decomposition mechanism of Sb{sub 2}S{sub 3} and organic solvents was discussed based on the GC-MS results. - Abstract: In this paper, we report on the synthesis of antimony sulfide (Sb{sub 2}S{sub 3}) semiconductor nanoparticles by pulsed laser ablation in liquid without using any surfactants or capping agents. Different results were obtained in water and organic solvents. In the case of water, Sb{sub 2}S{sub 3} nanoparticles with chemical compositions of stoichiometry were successfully prepared when laser irradiation was performed under the condition with the dissolved oxygen removed by argon gas bubbling. It was shown that thus-obtained Sb{sub 2}S{sub 3} nanoparticles exhibit features of not only low-temperature crystallization but also low-temperature melting at a temperature as low as 200 °C. Nanoparticle-coated Sb{sub 2}S{sub 3} thin films were found to show good visible light absorption and satisfying semiconductor properties (i.e., carrier mobility and density), which are essential for photovoltaic application. On the other hand, in the case of organic solvents (e.g., acetone, ethanol), such unexpected byproducts as CS{sub 2}, CO and CH{sub 4} were detected from the reaction system by GC-MS analysis, which suggests that both Sb{sub 2}S{sub 3} and organic

  13. Efficient green and red fluorescence upconversion in erbium doped new low phonon antimony glasses

    Science.gov (United States)

    Som, Tirtha; Karmakar, Basudeb

    2009-02-01

    New K 2O-B 2O 3-Sb 2O 3 (KBS) glass system having low phonon energy (about 600 cm -1) doped with Er 3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K 2O-15B 2O 3-70Sb 2O 3 (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Er 2O 3. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 798 nm at room temperature. Three upconverted bands originating from the 2H 11/2 → 4I 15/2, 4S 3/2 → 4I 15/2 and 4F 9/2 → 4I 15/2 transitions are found to be centered at 522 (green, very weak), 536 (green, medium) and 645 (red, strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (down conversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross relaxation (CR) mechanisms involving population of the metastable (storage) energy levels ( 2H 11/2, 4S 3/2 and 4F 9/2) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their high intense low phonon energy (602 cm -1) which is very close to that of fluoride glasses (500-600 cm -1). We are the first to report the upconversion fluorescence of Er 3+ ions in KBS antimony glasses.

  14. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India)], E-mail: basudebk@cgcri.res.in

    2008-12-15

    A new antimony-based glass system (K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3}) having low phonon energy (about 600 cm{sup -1}) doped with Sm{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm{sub 2}O{sub 3}. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 5/2}, {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} and {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 9/2} transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 5/2}) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  15. 1-3-7 minute intravenous urography

    Energy Technology Data Exchange (ETDEWEB)

    Bahk, Yong Whee; Yoon, Sei Chul; Lee, Myung Hee [Catholic Medical College, Seoul (Korea, Republic of)

    1980-12-15

    Intravenous urography (IVU) as it is used widely today was probably started in early 1950's after the introduction of triiodobenzoic acid compounds as contrast media. This long cherished traditional method consists of taking radiograms at 5, 15 and 25 minutes after the injection of contrast medium. There are a few modifications of this standard urographic examination such as five minute IVU (Woodruff, 1959), minute-sequence pyelogram (Maxwell et al., 1964), drip infusion pyelography (Schencker, 1964) and nephrotomography (Evans et al., 1955). The present study has been undertaken to test if the conventional standard IVU can be more rapidly performed without losing essential informational contents of urograms. In this new clinical trial, urograms were taken at the end of 1, 3 and 7 minutes instead of 5, 15 and 25 minutes after the intravenous injection of contrast medium. We injected 40 ml of meglumine diatrizoate solution within 30 seconds using an 18G iv needle. (The amount of injected contrast medium has been reduced recently to ordinary single dose of 20 ml for subjects weighing less than 8 kg). Upon viewing the 7 minute film in front of an automatic processor, the examination was terminated after obtaining an upright view unless any further radiogram was indicated. As shown in Tables and Figures, our new 1-3-7 minute method has been proven to provide us with as much essential and useful information as conventional 5-15-25 minute urography. Thus, we were able to finish one examination within 10 minutes without losing any necessary diagnostic information. In some of patients with obstructive uropathy such as stone the examination was extended as long as it was desired. Side reactions were occasional nausea, flushing and rare mild vomiting which never prevented the examination.

  16. Study of positive parity bands in 137Pr

    International Nuclear Information System (INIS)

    In this paper the analysis and interpretation of the positive parity states in 137Pr have been reported. The detailed interpretation with configuration assignments and the calculations for the bands will be reported

  17. Patterns of cesium-137 distribution across two disparate floodplains

    International Nuclear Information System (INIS)

    Soil 137Cs concentration was studied across upstream and downstream floodplain sites of Lower Three Runs Creek, an Upper Coastal Plain stream draining a portion of the Savannah River Plant. Soil samples were collected laterally and vertically at each floodplain location and analyzed for several edaphic characteristics. The results showed that these floodplains were differentiable by their edaphic characteristics both between sites and between depths within a site. The surface distribution of 137Cs was related to microtopographic variation at each site, but predictive relationships for estimating surface-soil 137Cs content from edaphic parameters were not as well defined. A difference in upstream to downstream 137Cs cycling was explained on the basis of the change from direct to indirect nutrient cycling pathways in a downstream direction. This change was coincident with higher sedimentation, greater cation adsorptive capacity, and higher potassium concentrations found downstream

  18. Accumulation of 137Cs in puddle sediments within urban ecosystem

    International Nuclear Information System (INIS)

    The role of puddle sediments as a final depot of 137Cs horizontal migration within the urban landscape is studied using the example of Ekaterinburg city, Russia. Radioactive contamination in the city appeared due to fallout after atmospheric testing of nuclear weapons and nuclear accidents. Contamination density of 137Cs in the region was assessed from archive data to be about 5.1 kBq/m2, of which the maximum activity concentration (137Cs activity concentration in puddle sediments of 80 Bq/kg, with a maximum value of 540 Bq/kg. It is estimated that horizontal migration has led to about a fourfold concentration of 137Cs in puddle sediments.

  19. Long-term behaviour of 137Cs in Finnish lakes

    International Nuclear Information System (INIS)

    Deposition of 137Cs from Chernobyl accident was unevenly distributed in Finland. This caused large variation to contents of 137Cs in freshwater fish in Finnish lakes. In the course of time environmental processes like runoff, water flow, hydrological cycling, sedimentation and chemical parameters as e.g., K of lake water, topography of the catchment affect the transfer of 137Cs in water sheds. Most of the Finnish lakes are deficient in nutrients and hence the accumulation of 137Cs into fishes is high. High amount of humic substances is also typical of Finnish lakes. About 6000 freshwater fish samples from 350 Finnish lakes have been analysed for 137Cs in 1986-2003. Sampling was focused on the central parts of Finland with highest deposition of 137Cs, but samples from other areas were also analysed. Large lakes, most important for freshwater fishing in Finland, and small oligotrophic lakes, in which the highest contents of 137Cs were expected to be found, were included in the study. Variation range of 137Cs in fish was still in 2003 large, from 5 Bq/kg to 5000 Bq/kg (fresh weight). Water samples from about 30 lakes were taken in 1998 and 2002 and analysed for 137Cs. Contents of 137Cs in lake waters varied then from 4 to 330 Bq/m3. During the first years after the deposition in 1986, the amount of the deposited 137Cs in the lake was the dominant factor on the distribution of 137Cs in fish and surface water. Later study on regional behaviour of 137Cs in fish revealed differences in decrease rates in the large drainage areas [2]. Temporal changes of 137Cs in water and especially in fish in individual lakes of various types, even in those located close to each other, differ still much. Transfer coefficients of 137Cs from the deposition to water, TFw (Bq/m3 in water/kBq/m2 deposited) of the lakes included in this study varied from 0,40 to 8,7 in 1998. Transfer factors from the deposition to various species of fish from various lakes, TFf (Bq/kg in fish / Bq/m2), varied

  20. A study on low cost-high conducting fluorine and antimony-doped tin oxide thin films

    International Nuclear Information System (INIS)

    Thin films of undoped, fluorine- and antimony-doped tin oxide on glass at 400 deg. C was prepared by spray pyrolysis technique. Tin chloride (SnCl2), ammonium fluoride (NH4F), and antimony trichloride (SbCl3) were used as source for tin (Sn), fluorine (F), and antimony (Sb), respectively. To ensure the control of solution concentration on growth rate, fluorine-doped tin oxide (SnO2:F) thin films were first prepared with different amount of tin precursor, in the range of 5-12g, which has resulted in deposition of films with different thickness values. The optimum amount of tin precursor found from this study (11g) was fixed constant for preparing SnO2 films with different doping levels of F and Sb. From the X-ray diffraction analyses, it is understood that the preferred orientation of SnO2:F films is dependent on their thickness and the solution concentration. The variation in the solution concentration and orientation of the films was reflected in their morphology as examined by scanning electron microscopy (SEM) and atomic force microscopy (AFM). SEM studies showed that the variation in the solution concentration lead to different grain shapes for different orientations. The AFM study showed that the RMS roughness of undoped films reduced considerably from 86 to 24nm due to fluorine doping (15wt.%), whereas the antimony doping (2wt.%) has no significance effect on RMS roughness (93nm). The electrical properties of the films were examined by a Hall measurements setup in van der Pauw configuration. A minimum sheet resistance of 1.75 and 2.17Ω/ were obtained for F and Sb doped films, respectively. From the optical studies, it is found that the transmittance of undoped films increased from 42% to a maximum 85% on 30wt.% fluorine doping, whereas that has been decreased to a minimum of 12% on 4wt.% antimony doping (800nm). A discussion on the effect of type of dopants and their concentration on the structural, electrical and optical properties of the SnO2 film have

  1. Development of a MSFIA system for sequential determination of antimony, arsenic and selenium using hydride generation atomic fluorescence spectrometry.

    Science.gov (United States)

    de Santana, Fernanda A; Portugal, Lindomar A; Serra, Antonio M; Ferrer, Laura; Cerdà, Víctor; Ferreira, Sergio L C

    2016-08-15

    This paper proposed a multisyringe flow injection analysis (MSFIA) system for antimony, arsenic and selenium determination in peanut samples by hydride generation atomic fluorescence spectrometry (HG-AFS). The optimization step of the hydride generation was performed using a two-level full factorial design involving the parameters: hydrochloric acid, sodium tetrahydroborate and potassium iodide concentrations. So, using the chemical conditions optimized, this method allows the determination of these elements employing the external calibration technique using aqueous standards with limits of detection and quantification of 0.04 and 0.14µgL(-1) for antimony, 0.04 and 0.14µgL(-1) for arsenic and 0.14 and 0.37µgL(-1) for selenium, respectively. Additionally, the effect of vanadium, chromium, cobalt, nickel, zinc, copper, iron and molybdenum on the generation of chemical vapour was also studied. The precision expressed as relative standard deviation varied from 1.2 to 3.6% for antimony, 1.8-3.9% for arsenic and 1.8-2% for selenium. The accuracy for arsenic and selenium was confirmed using the certified peach leaves reference material SRM 1547 produced by National Institute of Standard and Technology. The proposed method showed 45 injection throughput (h(-1)) using 1.6mL sample volume for each element, 0.8mL NaBH4 0.5% (w/v) containing NaOH 0.05% (w/v), 0.8mL HCl 5M and 0.4mL KI 14% (w/v) containing L-ascorbic acid 2.5% (w/v). The method was applied to the determination of antimony, arsenic and selenium in peanut samples, which were firstly lyophilized and afterward digested using microwave assisted radiation. Six samples were analyzed and the contents of the elements found were: 28.7-41.3µgkg(-1) for arsenic, 86.4-480.1µgkg(-1) for selenium and 32.6-52.4µgkg(-1) for antimony. Addition/recovery tests were also performed to confirm the method accuracy for the three elements. PMID:27260431

  2. Obsah Cs-137 v houbách

    OpenAIRE

    Čadová, Michaela

    2015-01-01

    The aim of this work is to compare the presence of Cs-137 in different kinds of mushrooms in selected locations using semiconductor gamma-ray spectrometry. Research question was determined: Does Cs-137 content amount vary depending on the fungal species? The first part deals with basic knowledge of ionizing radiation, which is important for the complex understanding of thematic problems. This concerns basic radiobiological terms such as radioactivity, ionizing radiation, its biological effect...

  3. /sup 137/Cs radioactive dating of Lake Ontario sediment cores

    Energy Technology Data Exchange (ETDEWEB)

    Ward, T.E.; Breeden, J.; Komisarcik, K.; Porter, R.; Czuczwa, J.; Kaminski, R.; McVeety, B.D.

    1987-12-01

    The distribution of /sup 137/Cs in sediment cores from Lake Ontario provides estimates of the sediment accumulation rates. Geochronology with /sup 210/Pb dating and distribution of Ambrosia (ragweed) pollen compare well with /sup 137/Cs dating. These methods can determine with precision, changes in sedimentation occurring over the past 100 years or so. Typical sedimentation rates of 0.18-0.36 cm/yr were measured. 16 refs., 3 figs., 2 tabs.

  4. 137Cs radioactive dating of Lake Ontario sediment cores

    International Nuclear Information System (INIS)

    The distribution of 137Cs in sediment cores from Lake Ontario provides estimates of the sediment accumulation rates. Geochronology with 210Pb dating and distribution of Ambrosia (ragweed) pollen compare well with 137Cs dating. These methods can determine with precision, changes in sedimentation occurring over the past 100 years or so. Typical sedimentation rates of 0.18-0.36 cm/yr were measured. 16 refs., 3 figs., 2 tabs

  5. Measurement of soil erosion from fallout of 137Cs

    International Nuclear Information System (INIS)

    The measurement of relative caesium-137 content in soil is a powerful tool for the estimation of contemporary erosion rates, especially on soils with consistent land use. Data from runoff plots gave the relationship Y = 0.419 Xsup(0.646), where Y is the diminution in caesium-137 content expressed as a percentage of local input and X is the average soil loss in kg ha-1 y-1

  6. Migratory capacity of 137Cs in water-containing rocks

    International Nuclear Information System (INIS)

    The effects of a number of physicochemical and hydrogeologic factors (sorption capacity of rocks, mechanisms of cesium absorption by these, chemical composition of underground waters) on 137 Cs migration in the case of radioactive contamination of underground water in areas of location of atomic power stations have been studied. Approximate equations of ion-exchange sorption may be applied for predicting 137 Cs migration in rocks within the aeration zone and in water-bearing horizons

  7. Dicty_cDB: CFG137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFG137 (Link to dictyBase) - - - Contig-U15057-1 CFG137E (Link to Original ... complete sequence. 38 0.70 3 AF489932 |AF489932.1 Dengue ... Virus Type 2 strain BR64022, complete genome. 46 1 ... .2 1 AF100466 |AF100466.2 Dengue ... virus type 2 strain Mara4 polyprotein gene, comple ...

  8. Strontium-90 and cesium-137 in tea (Japanese tea)

    International Nuclear Information System (INIS)

    Sr-90 and Cs-137 in Japanese tea were determined using radiochemical analysis. Five hundred grams of manufactured green tea was collected from six sampling locations in June 1984, carbonized and ashed in a stainless steel pan or a porcelain dish. The maximum value of Sr-90 was 88+-3.7 pCi/kg in tea collected from Kyoto; the maximum value of Cs-137 was 99.0+-3.60 pCi/kg collected from Kagoshima. (Namekawa, K.)

  9. Estimation of erosion rate using natural isotop 137Cs

    International Nuclear Information System (INIS)

    The investigation of erosion rate using natural isotope 137Cs had been done in hilliness area at GOULBURN-NWS-Australia. The presentation of 137Cs in natural was as a result of nuclear weapon testing in the middle of 1950's. Fallout of 137Cs input, when it reached the ground, it rapidly adsorbed at the soil. 137Cs bind very strong at the fine soil, so it can be used as tracer in the study of soil movement. Soil samples were taken using coring device (di=10 cm, h=20 cm), and were brought to laboratorium for short commun analysis. The preparation are drying, weighing, crushing and sieving. The 137Cs content of fine samples that pass the 1 mm sieve were analyzed using gamma-spectrometer. The total erosion rate was calculate by ploting the 137Cs values in the topography map of study area. The result showed that erosion was very low, and total erosion rate is 130 kg/ha.y. (authors)

  10. Transfer of 137Cs through the food chain to man

    International Nuclear Information System (INIS)

    Deposition, concentrations in diet, and body burdens of 137Cs have been measured since 1954 at various sites throughout the world. This report is a compilation and updating of various fallout 137Cs measurements and an interpretation of transfer properties of 137Cs from deposition to diet and from diet to man. An empirical model is used to correlate deposition and diet data. Direct foliar contamination, stored food supplies, and uptake from soil contribute to the dietary levels of 137Cs. The accumulation of 137Cs by man is described by a single exponential model. The inferred biological half-times, 200 to 400 days, are somewhat greater than the half-time of about 100 days obtained from shorter term studies. Differences in body burdens due to sex, age, and weight are discussed. During the period 1954 to 1974, the internal dose from fallout 137Cs, based on average body burdens, is estimated to be 4 to 5 percent of the 21 year radiation dose from 40K

  11. Transfer of cesium-137 from pasture to milk after Chernobyl

    International Nuclear Information System (INIS)

    During 1986, the year of the Chernobyl accident, the Cs-137 activity concentration in the milk and pasture of some dairy farms in the northern part of the county of Uppsala was studied. In 1987, the transfer of Cs-137 from fodder to milk was investigated on 11 dairy farms in the northern part of the county during the first month on pasture. These farms had been studied also during a previous period when the cows were kept in the stable. In 1988, the transfer of Cs-137 from fodder to milk was followed intensively on 5 dairy farms in the same area during the first month on pasture. The Cs-137 activity concentration was measured continuously in feeds and milk during the study periods in 1987 and 1988. All feedstuffs fed in the stable were weighed twice a week, and the amount of forage grazed was calculated from the cows requirements of nutrients. Samples of all feed were taken for Cs-137 determination and chemical analyses. The transfer coefficient for 10 of the 11 dairy farms during the first month on pasture in 1987 was, on average, 0.005 d kg-1. The Cs-137 activity concentration was significantly lower in the milk of the farms studied during the first month on pasture in 1988 than during the same period in 1987. The mean transfer coefficient for 4 of the 5 dairy farms studied during the first month on pasture in 1988 was 0.007 d kg-1. (au) (27 refs.)

  12. Determination of erosion and accretion rates using caesium-137

    International Nuclear Information System (INIS)

    Within drainage basins, soil erosion status may be indicated by levels of absorbed 137Cs within the soil. Further refinements of the relationship between soil loss and 137Cs loss for various soil types, geographic locations for soils experiencing severe erosion will enable more accurate predictions of net soil loss rates to be made. For a long time quantification of sediment sources within catchments has been a difficulty for hydrogeomorphologists interpreting sediment outputs, and the 137Cs technique holds much promise for its resolution. Storage, another major component of the sediment budget, may also be quantified by 137Cs, provided careful sampling and interpretation are practised. Caesium-137 as a dating-tool is less useful at sites with low rates of sediment accumulation, ostensibly those unaffected by human activity in the catchment. The tracer 137Cs has become a well-established tool in sediment research in several countries. The provision of adequate detector facilities will ensure the further development of the technique in Australia, thus helping hydrogeomorphologists achieve the goal of predicting sediment delivery ratios and drainage basin sediment budgets with some certainty

  13. Cs-137 and Sr-90 level in diary products

    Science.gov (United States)

    Petukhov, V. L.; Gorb, T. S.; Petukhov, I. V.; Dukhanov, Yu. A.; Sevryuk, I. Z.; Patrashkov, S. A.; Korotkevich, O. S.

    2003-05-01

    About 70% of radioactive substances fell on the territory of the Byelorussia Republic after the Chernobyl Atom Power Station Disaster. Cs-137 and Sr-90 accumulation dynamics was studied in milk of the cows from the highest polluted Braginsky area. 408 milk samples of Black and White cows were investigated. In 1995 average Cs-137 and Sr-90 levels were 61.00 and 3.73 Bk/dm^3 respectively. Cs-137 and Sr-90 levels exceeded Byelorussia Republic upperlimits RDU 96 in 10 and 50% of milk samples respectively. After 5 years (by 2000) Cs-137 and Sr-90 levels had become almost 3 and 2 times less (21.70 Bk/dm^3 and 1.72 Bk/dm^3 respectively). Cs-137 and Sr-90 levels exceeded RDU 96 in 1.5 and 5.5% of milk samples respectively. In the same periods Cs-137 and Sr-90 levels were 7 and 2 times higher than the similar indexes in the relatively clean Novosibirsk area. Thus, radioactive element levels in milk of Black and White cows of the Byelorussia Republic decreased significantly for the past years.

  14. Specific activity 137Cs at fishes of Ukraine current state

    International Nuclear Information System (INIS)

    Specific activity of 137Cs at fishes of reservoirs of 30 kilometers ChNPP zone (Pripyat river and its bays, lakes, cool-ing-pond of ChNPP, etc.), water basins of Dneprovsky cascade, Shatsky lakes and Black sea near town Sudak is investigated during 2010 - 2012. Levels of specific activity of 137Cs at fishes in many respects are defined by flowage of the reservoir. Normally, the flowage of the reservoir is more, the levels of specific activity of 137Cs at fishes are less. The greatest specific activity of 137Cs at fishes was registered in the north of Ukraine in closed and half-closed reservoirs of 30 kilometers ChNPP zone - to 32000 Bqk/kg. In the southern direction activity of 137Cs at fishes decreases from 4,8 to 78,5 Bq/kg in Kyiv water basin to 1 - 6 Bq/kg, in the Kahovsky water basin and to 0,6 - 1,9 Bq/kg in the Black sea. In large reservoirs the greatest specific activity of 137Cs, as a rule, is registered in fishes of the higher trophic levels

  15. Preventing or reducing the Cs-137 burden in children

    International Nuclear Information System (INIS)

    Full text: The Helsinki Agreements impose intervention when a diagnosed disease can be cured or prevented. Since 1998 members of IPPNW Switzerland study health related problems due to the Chernobyl Fallout in the Ukraine and Belarus. The organisation furthermore finances diagnostic and radiometric activities, as measuring the Cs-137 burden in the organism. Also preventive measures are supported in cooperation with the french NGO 'Children of Chernobyl Belarus'. The Clinical Research Institute of Radiation Medicine and Endocrinology and the Gomel' State Med. Institute found correlations between chronic excess of Cs-137 and genetic, congenital, endocrine, immunological, cardiovascular, gastrointestinal, ophthalmologic anomalies and cancer. For etiological assessment the correlation between pathology and internal irradiation requires repeated measuring of Cs-137 burden. Anthropo-Gammametry measures of the mean Cs-137 load of the organism, which can be done in a few minutes. These values, however, cannot be used to directly calculate the dose to a given organ, as cesium concentrations may vary from 1 to 100 in the same child. Very low values of Cs-137 are found in skin and fatty tissue; in small children the highest concentrations are found in endocrine glands, pancreas, thymus and heart. Cs-137 is a gamma and beta emitting isotope. Whereas in the environment gamma emissions are important, once ingested beta emissions within millimeter distance are more damaging for cellular structures than gamma rays. Neurons of given brain structures localized in the left hemisphere (in right handed persons) also seem to be susceptible to ionizing radiations. There appear to be correlations with certain mental diseases and disorders, including schizophrenia and chronic fatigue syndrome. As regards to practical radiation protection, unfortunately families in rural areas rely on their own foodstuffs and milk and poor families frequently consume highly contaminated natural products. In

  16. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    International Nuclear Information System (INIS)

    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with ∼0.45 and 0.021 mmol L-1 total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb2O3. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  17. Suppression of the vapor-liquid-solid growth of silicon nanowires by antimony addition.

    Science.gov (United States)

    Nimmatoori, Pramod; Zhang, Qi; Dickey, Elizabeth C; Redwing, Joan M

    2009-01-14

    The effect of Sb addition on the growth rate and structural properties of Si nanowires synthesized by vapor-liquid-solid growth was investigated. The nanowire growth rate was reduced by an order of magnitude following the addition of a low concentration pulse of trimethylantimony (TMSb) to the gas phase during growth. Transmission electron microscopy analysis revealed that the wires had a thick amorphous coating ( approximately 8 nm) around the catalyst particle and a distorted catalyst shape. Energy-dispersive x-ray spectroscopy showed the presence of trace amounts of Sb in the amorphous coating around the catalyst and at the catalyst-wire interface. Antimony was also found to be incorporated in the Si nanowires with a peak in the Sb concentration measured at the initial point where the TMSb pulse was added to the gas stream. The significant reduction in wire growth rate was attributed to Sb segregation at the vapor-liquid and liquid-solid interfaces which results in a change in interfacial energies and a reduction in the rate of Si incorporation at these interfaces. PMID:19417276

  18. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells.

    Science.gov (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya

    2015-08-17

    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells. PMID:26237216

  19. Assessment and distribution of antimony in soils around three coal mines, Anhui, China

    Science.gov (United States)

    Qi, C.; Liu, Gaisheng; Kang, Y.; Lam, P.K.S.; Chou, C.

    2011-01-01

    Thirty-three soil samples were collected from the Luling, Liuer, and Zhangji coal mines in the Huaibei and Huainan areas of Anhui Province, China. The samples were analyzed for antimony (Sb) by inductively coupled plasmaoptical emission spectrometry (ICP-OES) method. The average Sb content in the 33 samples was 4 mg kg-1, which is lower than in coals from this region (6.2 mg kg-1). More than 75% of the soils sampled showed a significant degree of Sb pollution (enrichment factors [EFs] 5-20). The soils collected near the gob pile and coal preparation plant were higher in Sb content than those collected from residential areas near the mines. The gob pile and tailings from the preparation plant were high in mineral matter content and high in Sb. They are the sources of Sb pollution in surface soils in the vicinity of coal mines. The spatial dispersion of Sb in surface soil in the mine region shows that Sb pollution could reach out as far as 350 m into the local environment conditions. Crops in rice paddies may adsorb some Sb and reduce the Sb content in soils from paddyfields. Vertical distribution of Sb in two soil profiles indicates that Sb is normally relatively immobile in soils. ?? 2011 Air & Waste Management Association.

  20. Antimony nanoparticles anchored in three-dimensional carbon network as promising sodium-ion battery anode

    Science.gov (United States)

    Luo, Wen; Zhang, Pengfei; Wang, Xuanpeng; Li, Qidong; Dong, Yifan; Hua, Jingchen; Zhou, Liang; Mai, Liqiang

    2016-02-01

    A novel composite with antimony (Sb) nanoparticles anchored in three-dimensional carbon network (denoted as SbNPs@3D-C) is successfully synthesized via a NaCl template-assisted self-assembly strategy, followed by freeze-drying and one-step in-situ carbonization. The three-dimensional interconnected macroporous carbon framework can not only stabilize the architecture and buffer the volume expansion for Sb nanoparticles, but also provide high electrical conductivity for the whole electrode. Consequently, as a sodium-ion battery anode, the SbNPs@3D-C delivers a high reversible capacity (456 mAh g-1 at 100 mA g-1), stable cycling performance (94.3% capacity retention after 500 cycles at 100 mA g-1) as well as superior rate capability (270 mAh g-1 at 2000 mA g-1). When compared with commercial Sb particles, the SbNPs@3D-C exhibits dramatically enhanced electrochemical performance. Free from expensive template sources and complex manipulation, this work might shed some light on the synthesis of low-cost and high-performance materials for the next "beyond lithium" battery generation.

  1. Antimony uptake, translocation and speciation in rice plants exposed to antimonite and antimonate.

    Science.gov (United States)

    Ren, Jing-Hua; Ma, Lena Q; Sun, Hong-Jie; Cai, Fei; Luo, Jun

    2014-03-15

    Antimony (Sb) accumulation in rice is a potential threat to human health, but its uptake mechanisms are unclear. A hydroponic experiment was conducted to investigate uptake, translocation, speciation and subcellular distribution of Sb in rice plants exposed to antimonite (SbIII) and antimonate (SbV) at 0.2, 1.0 or 5.0 mg/L for 4h. More Sb was accumulated in iron plaque than in the plant, with both the roots (~10-12 times) and Fe plaque (~28-54 times) sequestering more SbIII than SbV. The presence of iron plaque decreased uptake of both SbV and SbIII. SbIII uptake kinetics fitted better to the Michaelis-Menten function than SbV. Antimonate (56 to 98%) was the predominant form in rice plant with little methylated species being detected using HPLC-ICP-MS. Cell walls accumulated more Sb than organelles and cytosol, which were considered as the first barrier against Sb entering into cells. Sb transformation and subcellular distribution can help to understand the metabolic mechanisms of Sb in rice. PMID:24419289

  2. A new method for antimony speciation in plant biomass and nutrient media using anion exchange cartridge.

    Science.gov (United States)

    Tisarum, Rujira; Ren, Jing-Hua; Dong, Xiaoling; Chen, Hao; Lessl, Jason T; Ma, Lena Q

    2015-11-01

    A selective separation method based on anion exchange cartridge was developed to determine antimony (Sb) speciation in biological matrices by graphite furnace atomic absorption spectrophotometry (GFAAS). The selectivity of the cartridge towards antimonite [Sb(III)] and antimonate [Sb(V)] reversed in the presence of deionized (DI) water and 2mM citric acid. While Sb(V) was retained by the cartridge in DI water, Sb(III) was retained in citric acid media. At pH 6, Sb(III) and Sb(V) formed Sb(III)- and Sb(V)-citrate complexes, but the cartridge had higher affinity towards the Sb(III)-citrate complex. Separation of Sb(III) was tested at various concentrations in fresh and spent growth media and plant tissues. Our results showed that cartridge-based Sb speciation was successful in plant tissues, which was confirmed by HPLC-ICP-MS. The cartridge retained Sb(III) and showed 92-104% Sb(V) recovery from arsenic hyperaccumulator Pteris vittata roots treated with Sb(III) and Sb(V). The cartridge procedure is an effective alternative for Sb speciation, offering low cost, reproducible results, and simple Sb analysis using GFAAS. PMID:26452943

  3. Antimony release from contaminated mine soils and its migration in four typical soils using lysimeter experiments.

    Science.gov (United States)

    Shangguan, Yu-Xian; Zhao, Long; Qin, Yusheng; Hou, Hong; Zhang, Naiming

    2016-11-01

    Antimony (Sb) can pose great risks to the environment in mining and smelting areas. The migration of Sb in contaminated mine soil was studied using lysimeter experiments. The exchangeable concentration of soil Sb decreased with artificial leaching. The concentrations of Sb retained in the subsoil layers (5-25cm deep) were the highest for Isohumosol and Ferrosol and the lowest for Sandy soil. The Sb concentrations in soil solutions decreased with soil depth, and were adequately simulated using a logarithmic function. The Sb migration pattern in Sandy soil was markedly different from the patterns in the other soils which suggested that Sb may be transported in soil colloids. Environmental factors such as water content, soil temperature, and oxidation-reduction potential of the soil had different effects on Sb migration in Sandy soil and Primosol. The high Fe and Mn contents in Ferrosol and Isohumosol significantly decreased the mobility of Sb in these soils. The Na and Sb concentrations in soils used in the experiments positively correlated with each other (PPrimosol>Isohumosol>Ferrosol, and we concluded that the Sb mobility in the soils also decreased in that order. PMID:27395817

  4. Enhanced hematite water electrolysis using a 3D antimony-doped tin oxide electrode.

    Science.gov (United States)

    Moir, Jonathon; Soheilnia, Navid; O'Brien, Paul; Jelle, Abdinoor; Grozea, Claudia M; Faulkner, Daniel; Helander, Michael G; Ozin, Geoffrey A

    2013-05-28

    We present herein an example of nanocrystalline antimony-doped tin oxide (nc-ATO) disordered macroporous "inverse opal" 3D electrodes as efficient charge-collecting support structures for the electrolysis of water using a hematite surface catalyst. The 3D macroporous structures were created via templating of polystyrene spheres, followed by infiltration of the desired precursor solution and annealing at high temperature. Using cyclic voltammetry and electrochemical impedance spectroscopy, it was determined that the use of this 3D transparent conducting oxide with a hematite surface catalyst allowed for a 7-fold increase in active surface area for water splitting with respect to its 2D planar counterpart. This ratio of surface areas was evaluated based on the presence of oxidized trap states on the hematite surface, as determined from the equivalent circuit analysis of the Nyquist plots. Furthermore, the presence of nc-ATO 2D and 3D "underlayer" structures with hematite deposited on top resulted in decreased charge transfer resistances and an increase in the number of available active surface sites at the semiconductor-liquid junction when compared to hematite films lacking any nc-ATO substructures. Finally, absorption, transmission, and reflectance spectra of all of the tested films were measured, suggesting the feasibility of using 3D disordered structures in photoelectrochemical reactions, due to the high absorption of photons by the surface catalyst material and trapping of light within the structure. PMID:23581965

  5. Spark Plasma Sintering and Densification Mechanisms of Antimony-Doped Tin Oxide Nanoceramics

    Directory of Open Access Journals (Sweden)

    Junyan Wu

    2013-01-01

    Full Text Available Densification of antimony-doped tin oxide (ATO ceramics without sintering aids is very difficult, due to the volatilization of SnO2, formation of deleterious phases above 1000°C, and poor sintering ability of ATO particles. In this paper, monodispersed ATO nanoparticles were synthesized via sol-gel method, and then ATO nanoceramics with high density were prepared by spark plasma sintering (SPS technology using the as-synthesized ATO nanoparticles without the addition of sintering aids. The effect of Sb doping content on the densification was investigated, and the densification mechanisms were explored. The results suggest that ATO nanoparticles derived from sol-gel method show good crystallinity with a crystal size of 5–20 nm and Sb is incorporated into the SnO2 crystal structure. When the SPS sintering temperature is 1000°C and the Sb doping content is 5 at.%, the density of ATO nanoceramics reaches a maximum value of 99.2%. Densification mechanisms are explored in detail.

  6. Leaching of Antimony (Sb)from Municipal Solid Waste Incineration (MSWI) Residues

    Energy Technology Data Exchange (ETDEWEB)

    Herrmann, Inga

    2004-07-01

    The mobility of antimony (Sb) in municipal solid waste incineration (MSWI) residues often exceeds the limit values stipulated by the European Union. As an ash treatment by washing is conceivable, this work investigated the Sb release from Swedish bottom ash and fly ash when mixed with water. The leaching experiments revealed the factors significantly (a = 0.05) affecting Sb release from the ashes. The following factors were investigated: Liquid to solid ratio (L/S), time, pH, carbonation (treatment with CO{sub 2}), ultrasonics and temperature. The data were evaluated using multiple linear regression (MLR). The impact of the factors could be quantified. The maximum Sb release calculated was 13 mg/kg DM for bottom ash and 51 mg/kg DM for fly ash. The derived models explained the observed data well. Nevertheless, the calculated values were subject to a high uncertainty. For bottom ash, a lowering of the Sb total content of approximately 22% could be achieved. If this also involves a sufficient lowering of the Sb mobility to meet EU limit values could not yet be assessed. Chemical equilibrium calculations were performed to explain the empirical results. However, no solid phases controlling Sb release from the ashes could be identified.

  7. Controlled n-doping in chemical vapour deposition grown graphene by antimony

    International Nuclear Information System (INIS)

    We have studied the effects of antimony (Sb) doping on graphene grown by chemical vapour deposition without any significant change in its electrical properties. By increasing the metal thickness from 1 to 5 nm, we found a shift in the wave numbers of Raman G and two-dimensional (2D) peaks consistent with n-doping and a change in the Fermi level of the graphene into the conduction band. The relative intensity of the D peak to the G peak did not show a significant change and that of the 2D peak to the G peak remained at a large enough number as a function of metal thickness, implying little degradation by the metal dopants. Transport measurements also confirm the n-doping of graphene through a shift of Dirac point in the transfer characteristics and the quality preservation with little changes in mobility. We also report on the formation of a p–n junction by metal doping on selected areas of the graphene and their electrical properties with transfer characteristics and Hall measurements. (paper)

  8. Evaluation of atmospheric inputs as possible sources of antimony in pregnant women from urban areas.

    Science.gov (United States)

    Fort, Marta; Grimalt, Joan O; Querol, Xavier; Casas, Maribel; Sunyer, Jordi

    2016-02-15

    Antimony and copper are common components of brake linings. The occurrence of these two metals in urban atmospheric aerosols has been related to vehicular use. Urine samples (n=466) taken during the 32nd week of pregnancy were analyzed for Sb and Cu in pregnant women from an urban area (Sabadell, Catalonia, Spain). The geometric mean levels were 0.28 and 13 μg/g creatinine, respectively. Positive significant associations between urine concentrations of Sb and seasonality, intensity of physical exercise, working activities and traffic intensity at their home streets were observed. Cu showed the same trends but without statistical significance. In both cases, the estimated dietary ingestion of these two metals was larger than the inhalation inputs but the difference was much higher for Cu than for Sb. While Sb has no dietary role, Cu is an essential element which is also incorporated into humans through diet. The results suggest that inhalation of atmospheric particles may also constitute a source of Sb in pregnant women and general population of urban areas. PMID:26657384

  9. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, J.T. [Department of Geological Sciences, The University of Texas, Austin, TX 78759 (United States); Bennett, P.C., E-mail: pbennett@mail.utexas.edu [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States); Engel, A.S. [Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803 (United States); Alsina, M.A.; Pasten, P.A. [Departamento de Ingenieria Hidraulica y Ambiental, Pontificia Universidad Catolica de Chile, Santiago (Chile); Milliken, K. [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States)

    2009-04-15

    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with {approx}0.45 and 0.021 mmol L{sup -1} total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb{sub 2}O{sub 3}. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  10. Comparison of arsenic and antimony biogeochemical behavior in water, soil and tailings from Xikuangshan, China.

    Science.gov (United States)

    Fu, Zhiyou; Wu, Fengchang; Mo, Changli; Deng, Qiujing; Meng, Wei; Giesy, John P

    2016-01-01

    Although similar geochemical behaviors of arsenic (As) and antimony (Sb) in the environment has been assumed and widely reported, growing evidence suggests the two elements cannot, under some conditions, be assumed to behave similarly. In this four-year study (samples collected in each year), comparative investigation of the biogeochemistry of As and Sb in water/fish, soil/vegetable, tailings/plant samples were carried out at the world's largest active Sb mine area (Xikuangshan, China). Depending on duration the tailings had been stacked, significant differences in spatial distributions between As and Sb were found, and these were associated with change in pH over time. Bio-accumulation factors (BAFs) of As were approximately 10-fold greater than those of Sb in fish/water, plant/tailing, and vegetable/soil systems. Sb had higher BAF in non-fatty tissues such as gills of fishes and shells of crabs. BAFs of Sb in vegetable/soil exhibited insignificantly, but different from As, positive correlation with pH in soil. PMID:26356182

  11. DFT Study on the Carrier Concentration and Temperature-Dependent Thermoelectric Properties of Antimony Selenide

    Directory of Open Access Journals (Sweden)

    Aditya Jayaraman

    2016-01-01

    Full Text Available We present the thermoelectric properties of Antimony Selenide (Sb2Se3 obtained using first principles calculations. We investigated the electronic band structure using the FP-LAPW method within the sphere of the density functional theory. Thermoelectric properties were calculated using BoltzTrap code using the constant relaxation time (τ approximation at three different temperatures 300 K, 600 K, and 800 K. Seebeck coefficient (S was found to decrease with increasing temperature, electrical conductivity (σ/τ was almost constant in the entire temperature range, and electronic thermal conductivity (κ/τ increased with increasing temperature. With increase in temperature S decreased from 1870 μV/K (at 300 K to 719 μV/K (at 800 K, electronic thermal conductivity increased from 1.56 × 1015 W/m K s (at 300 K to 3.92 × 1015 W/m K s (at 800 K, and electrical conductivity decreased from 22 × 1019/Ω m s (at 300 K to 20 × 1019/Ω m s (at 800 K. The thermoelectric properties were also calculated for different hole concentrations and the optimum concentration for a good thermoelectric performance over a large range of temperatures (from 300 K to 1000 K was found for hole concentration around 1019 cm−3.

  12. Validation of methodology and uncertainty assessment of antimony determination in environmental materials using Neutron Activation Analysis

    International Nuclear Information System (INIS)

    Antimony is an element found in low concentrations in the environment. However, its determination has attracted great interest because of the knowledge of its toxicity and increasing application. Neutron activation analysis (NAA) is a suitable method for the determination of several elements in different types, but in case of Sb, the analysis presents some difficulties due to spectral interferences. The objective of this research was to validate the method of NAA and uncertainty assessment for Sb determination in environmental samples. The experimental procedure consisted of irradiating twelve certified reference samples of different kind of matrices. The samples were irradiated in the nuclear research reactor IEA R1 IPEN/CNEN/SP followed by measurement of induced radioactivity, using a hyperpure germanium detector coupled to a gamma ray spectrometry. The radioisotopes 122Sb and 124Sb were measured and the Sb concentrations with their respective uncertainties were obtained by the comparative method. Relative errors and values of Z scores were calculated to evaluate the accuracy of the results for Sb determination in certified reference materials. The evaluation of the components that contribute to uncertainty measurement of the Sb concentration, showed that the major uncertainty contribution is due to statistical counting. The results also indicated that the uncertainty value of the combined standard uncertainty depends on the radioisotope measured and the decay time used for counting. (author)

  13. Antimony-Doped Tin Oxide Thin Films Grown by Home Made Spray Pyrolysis Technique

    Science.gov (United States)

    Yusuf, Gbadebo; Babatola, Babatunde Keji; Ishola, Abdulahi Dimeji; Awodugba, Ayodeji O.; Solar cell Collaboration

    2016-03-01

    Transparent conducting antimony-doped tin oxide (ATO) films have been deposited on glass substrates by home made spray pyrolysis technique. The structural, electrical and optical properties of the ATO films have been investigated as a function of Sb-doping level and annealing temperature. The optimum target composition for high conductivity and low resistivity was found to be 20 wt. % SnSb2 + 90 wt. ATO. Under optimized deposition conditions of 450oC annealing temperature, electrical resistivity of 5.2×10-4 Ω -cm, sheet resistance of 16.4 Ω/sq, average optical transmittance of 86% in the visible range, and average optical band-gap of 3.34eV were obtained. The film deposited at lower annealing temperature shows a relatively rough, loosely bound slightly porous surface morphology while the film deposited at higher annealing temperature shows uniformly distributed grains of greater size. Keywords: Annealing, Doping, Homemade spray pyrolysis, Tin oxide, Resistivity

  14. MIR137HG risk variant rs1625579 genotype is related to corpus callosum volume in schizophrenia

    NARCIS (Netherlands)

    Patel, V.S.; Kelly, S.; Wright, C.; Gupta, C.N.; Arias Vasquez, A.; Perrone-Bizzozero, N.; Ehrlich, S.; Wang, L.; Bustillo, J.R.; Morris, D.; Corvin, A.; Cannon, D.M.; McDonald, C.; Donohoe, G.; Calhoun, V.D.; Turner, J.A.

    2015-01-01

    Genome-wide association studies implicate the MIR137HG risk variant rs1625579 (MIR137HGrv) within the host gene for microRNA-137 as a potential regulator of schizophrenia susceptibility. We examined the influence of MIR137HGrv genotype on 17 subcortical and callosal volumes in a large sample of indi

  15. Gold and Antimony Mixed Flotation on a Micrite Gold Antimony ore in Guizhou%贵州某泥晶灰岩型含锑金矿金锑混浮试验

    Institute of Scientific and Technical Information of China (English)

    石贵明; 周意超

    2015-01-01

    贵州某泥晶灰岩型含锑金矿石为块状构造,金属矿物主要为黄铁矿、针铁矿,含量小于1%,非金属矿物以方解石为主,另有少量石英、有机质等;金含量为6.04 g/t,显微镜下未见自然金粒,74.34%的金赋存在硫化矿中,游离金仅占总金的7.14%;硅酸盐、碳酸盐包裹金分别占11.96%和6.56%;锑主要以辉锑矿的形式存在。为高效、低成本回收矿石中的金、锑,对混合浮选工艺进行了试验研究。结果表明,在一段磨矿细度为-0.074 mm占71%的情况下1粗2扫混浮、尾矿再磨细度为-0.074 mm占92.7%的情况下再1粗2扫混浮、两粗精矿合并后3次精选、中矿顺序返回流程处理,最终获得了金品位为47.60 g/t、锑品位为9.81%、金回收率为76.68%、锑回收率为85.22%的金锑混合精矿,金锑混浮效果较理想。尾矿中金的回收及金锑分离工艺研究将另文介绍。%The micrite type antimony-containing gold ore in Guizhou is in blocky construction. Its metallic minerals are mainly pyrite and goethite,with content of less than 1%. Non-metallic minerals are calcite,and few of quartz,organic matter, etc. It contains gold of 6. 04 g/t,and natural gold grains were not seen in microscope,74. 34% of the gold occurred in sulfide ore,free gold accounted for only 7. 14%,wrapped gold in silicate and carbonate accounted for 11. 96% and 6. 56% respective-ly. Antimony mainly existed in the form of stibnite. Bulk flotation process was studied to make high efficient recovery of gold and antimony at low costs. The results indicated that,at the grinding fineness of 71% passing 0. 074 mm,through one roughing and two scavenging bulk flotation,one roughing and two scavenging bulk flotation after regrinding the tailings to 92. 7% passing 0. 074 mm,three cleaning flotation for the two mixed rough concentrate,and then middles back to the flow-sheet in turn,rough gold-antimony concentrate with gold grade of 47. 60 g

  16. Metabolism of 137cesium, 137barium in the rat. Therapeutics of the contamination

    International Nuclear Information System (INIS)

    The authors carry out research into the distribution kinetics, the metabolism and the excretion of 137Cs - 137Ba in the rat. They show that these phenomena are independent of the method of applying a single dose. The distribution tends to adopt in all cases a typical shape which remains the same depending on the body burden. Biological analysis of the state of the cesium in the biological media shows that it is transported in the free and ionised form. Considering the problem of the method of penetration of the cesium ion in the intracellular medium, and in particular by the in vivo and in vitro kinetic study of the plasma - red cell system, the authors make the assumption that an active transport of cesium occurs by the cell membrane. They thus arrive at an overall picture of the cesium distribution in the organism which is essentially characterized by a dynamic distribution equilibrium between two compartments: 99 per cent of the cesium accumulates in the intracellular pool, 1 per cent in the extracellular liquids. This latter compartment is open to the emunctories. Because, of the active transport by the cell membranes, the intracellular pool is filled rapidly but discharge is slow. This phenomenon is the limiting factor in the decrease of the body burden. From this representation, the authors deduce the reasons for the relative failure of the various therapeutic methods examined up till now by themselves or by other authors. The stimulation of the natural emunctories in the case of diuretics for example, can only improve the purification of the extracellular compartment. Now this latter contains only 1 per cent of the body burden and recharging is slow. Furthermore the methods designed to counteract or inhibit the active transport of cesium by the cell membrane are still at the present time incompatible with the survival of the cell. (authors)

  17. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    DEFF Research Database (Denmark)

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt;

    2011-01-01

    low chromatographic recoveries. A combination of HPLC-ICP-MS, AFFF-ICP-MS and spinfiltration was applied for analysis of model compounds and biological samples. Quantitative chromatographic Sb redox speciation analysis was possible by acidic hydrolysis of the antimony polymers prior to analysis......In solution antimony exists either in the pentavalent or trivalent oxidation state. As Sb(III) is more toxic than Sb(V), it is important to be able to perform a quantitative speciation analysis of Sb’s oxidation state. The most commonly applied chromatographic methods used for this redox speciation...... analysis do, however, often show a low chromatographic Sb recovery when samples of environmental or biological origin are analysed. In this study we explored basal chemistry of antimony and found that formation of macromolecules, presumably oligomeric and polymeric Sb(V) species, is the primary cause of...

  18. Changes induced by gamma radiation in nanocomposites based on copper II and antimony sulfides in commercial poly(methyl methacrylate) matrix

    International Nuclear Information System (INIS)

    Poly (methyl methacrylate) (PMMA) is a polymer with wide application in the manufacture of medical devices that is exposed to gamma irradiation. Currently the use of composite materials has been disseminated and PMMA is an excellent polymer matrix to package various materials. This study aimed to analyze the changes induced by gamma irradiation (25 kGy) on the properties of PMMA nanocomposites with nanoparticles of copper II sulfide (250nm-900nm) and antimony sulfite (300-500 nm). The nanoparticles were added to the polymer in different concentrations and synthesized by ultrasonic irradiation from the corresponding chlorides with thioacetamide. Viscometric results showed a good radioprotective effect of nanoparticles of copper and antimony. It was found a good protection of nanoparticles on PMMA matrix in the concentration of 0.3% wt. The protections of 75% and 50% were calculated for nanoparticles of antimony and copper II, respectively. (author)

  19. Speciation of Cs-137 in fertilizers amended soils

    International Nuclear Information System (INIS)

    One of the most used agricultural countermeasures to reduce the uptake of radionuclides from soil into plants is the chemical treatment of the soil with fertilizers. The distribution of a radionuclide between different physico chemical forms is essential to characterize its behaviour and the biological impact on the environment. To assess a radionuclide bioavailability to the soil-plant transfer, the chemical forms that are most relevant are the water soluble and exchangeable ones. Laboratory experiments were conducted to determine the potential modifications in time of the Cs-137 distribution in the two soil fractions, induced by the treatment with different K-based fertilizers. The two types of soil were selected taking into account their importance for the agricultural use in Romania. By the sequential extraction method the distribution of 137 Cs has been determined in the water soluble and exchangeable fractions separated from the soils after 1 day, 1 week, 1 month and 4 months, respectively. For the reference untreated soils, experimental data revealed that less than 1 percent of Cs-137 is associated to the water soluble fraction for both types of soil. Around 4 percents of the total amount of Cs-137 in the brown-reddish soil and 13 percents in the alluvial one were associated to the exchangeable fraction. The differences between the Cs-137 distribution are correlated to the higher content of dust and clay in the brown reddish soil, which are strong binders for Cs ions. The application of the two fertilizers releasing fast the K ions (KCl and potassium salt), determined from at the first moment after the contamination a reduction of the Cs-137 concentration in both fraction. The effect was most pronounced for the soluble fraction in the brown -reddish soil: with a factor of 8 in case of KCl treatment and 5 in case of potassium salt. For the others experimental cases the concentration of Cs-137 in both fractions was slightly reduced, with factors between (1

  20. A Study of the r-Process Path Nuclides,$^{137,138,139}$Sb using the Enhanced Selectivity of Resonance Ionization Laser Ionization

    CERN Multimedia

    Walters, W

    2002-01-01

    The particular features of the r-process abundances with 100 < A < 150 have demonstrated the close connection between knowledge of nuclear structure and decay along the r-process path and the astrophysical environement in which these elements are produced. Key to this connection has been the measurement of data for nuclides (mostly even-N nuclides) that lie in the actual r-process path. Such data are of direct use in r-process calculations and they also serve to refine and test the predictive power of nuclear models where little or no data now exist. In this experiment we seek to use the newly developed ionization scheme for the Resonance Ionization Laser Ion Source (RILIS) to achieve selective ionization of neutron-rich antimony isotopes in order to measure the decay properties of r-process path nuclides $^{137,138,139}$Sb. These properties include the half-lives, delayed neutron branches, and daughter $\\gamma$-rays. The new nuclear structure data for the daughter Te nuclides is also of considerable in...

  1. Modelling turnover of Cs-137 in two subarctic salmonid ecosystems

    International Nuclear Information System (INIS)

    The turnover of cesium-137 was simulated in two categories of subarctic, alpine lake ecosystems - a natural lake with Gammarus lacustris as major fish prey and a lake reservoir with introduced Mysis relicta as a new fish-food organism. The resulting concentrations of Cs-137 in two salmonid species - Arctic char (Salvelinus alpinus) and brown trout (Salmo trutta) - were calculated using a multi-compartment model. Observed data were taken from a major case study evaluating the distribution, pathways and major transport mechanisms of Chernobyl cesium through northern lake ecosystems in 1986-90. The aim of this study was to design a specific conceptual model for calculation of the levels of Cs-137 in fish from simple lake ecosystems, which could be adopted for other more complex types of lakes. A multi-compartment model of the ecosystem was designed and the equations were solved with the BIOPATH-code. The uncertainty of the results due to the uncertainty of input values was examined using the PRISM-system. The model gave good correlations to measured data for Cs-137 in water, zooplankton, macro invertebrates and fish in both lakes. The predicted levels in sediments were, however, considerably lower than the observed values. The inflow of Cs-137 from the drainage area to the two lakes was identified as the main contributor to the uncertainty of the long-term prognoses. 33 refs, 6 figs, 3 tabs

  2. Determination of Corrections in the Absolute Measurement of 137Cs

    International Nuclear Information System (INIS)

    A method, of determining corrections in absolute measurements of 137Cs by 4π proportional counter is described. The correction for self-absorption of 137Cs beta particles from sources formed by vacuum deposition of CsCl on standard carrier films was determined. These samples, which had negligible self-absorption, were measured by 4π counter. The radioactive substance on the film was then dissolved, and by the addition of carrier was converted to a form similar to that of sources usually used for absolute measurement. The correction determined for self-absorption was higher than the value expected from comparison with other radionuclides having near Eβmax. The correction for internal conversion coefficient and gamma efficiency of the beta detector was determined with 137mBa samples. Barium was separated as BaSO4 precipitate and deposited on a standard carrier film used for absolute measurement with a layer thickness of about 1 mg/cm2. These samples were simultaneously measured by means of a 4π beta proportional counter and a Nal(Tl) scintillation counter. From corresponding counting rates in both counters, and from both known efficiencies, the value for a correction appropriate to one disintegration of 137mBa was calculated. The values measured were used further for computation of the internal conversion coefficient and the half-life of 137'mBa, which was ascertained to be 155 ± 3 s. (author)

  3. Distribution of fallout cesium-137 in the Chesapeake Bay

    International Nuclear Information System (INIS)

    A technique was developed for simple analysis of 137Cs concentrations in water, sediments, and biota in the fractional picocurie per liter range. These measurements are important, since fallout 137Cs will be present in estuarine environments for a generation. The concentration of 137Cs in water is important to studies of distribution coefficients, or concentration factors between water and sediment or organisms. Fallout 137Cs is also a natural tracer, making possible experiments on a span of space and time that is impossible with intentionally added tracers. Thus, one can determine an approximate residence time for a body of brackish water with a few 137Cs concentration measurements, given the average depth and typical fallout deposition rate. This estimate is good enough for first estimates as to the capacity of the body of water for various pollutants. Measurements at several sites, and at all seasonal conditions, can be used to solve the mass and concentration balance equations that more rigorously describe the hydrography of the estuary. (U.S.)

  4. Sorption of 137Cs from Aqueous Waste Solutions using Pottery

    International Nuclear Information System (INIS)

    A simple and inexpensive method for sorption of 137Cs from aqueous solutions using a highly available vase shape pottery material has been investigated. Porosity of the used pottery allowed for the penetration of the radioactive solution through its permeable body. Two routes had been investigated for cesium removal from the radioactive solutions. In the first one, pottery bodies were immersed into the radioactive solutions. In the second method; the radioactive solutions were filled the inner volumes of the pottery bodies. Vase shape pottery showed higher sorption capability for 137Cs much more than its powder forms, especially in the alkaline medium. Pottery bodies showed high potential for 137Cs removal. Adsorption isotherms revealed good lit to the Freundlich and Langumir isotherms. During sorption processes outside and inside the pottery body, 137Cs was well captured inside the amorphous microstructure of the pottery body. In this respect, micro filtration of cesium radionuclides through the used pottery could be postulated. Desorption experiments indicated higher immobilization affinity for radiocesium into pottery bodies, which indicates a high containment for 137Cs with an irreversible fixation mechanism

  5. Plant remediation of soil contaminated with 137Cs

    International Nuclear Information System (INIS)

    A pot experiment was conducted to evaluate the bio-remediation of soils contaminated with 137Cs. The selected plants are Cucurbita moschata Duchesne, Brassica chinensis L, Chloris virgata, Beta oulgaris L. Hongye, Beta oulgaris L. Dongshengye and Beta oulgaris L. The soils samples were taken from the paddy field, 2 km from the Dayawan nuclear power plant and Qinshan nuclear power plant, respectively, and cinnamon soil from the cultivated land in Beijing. The results show that all the employed species of plant have a higher accumulation to 137Cs with the increased grade of the radioactivity of 137Cs. A good correlation exist with the coefficient (r2) of 0.9989. When the contaminated radioactivity of 137Cs is in the same level the uptake of Cucurbita moschata Duchesne, Brassica chinensis L. and Chloris virgata increased with the decrease of pH value ranged 5.22-7.69. The ability of bioremediation in the orders were Chloris virgata, Brassica chinensis L., Beta oulgaris L. Hongye, Cucurbita moschata Duchesne, Beta oulgaris L. and Beta oulgaris L. Dongshengye, according to the comprehensive evaluation of transfer factor, specific activity of plant in dry weight of biomass and total absorption of 137Cs by the individual plant in the same area. (authors)

  6. Cobalt doped antimony oxide nano-particles based chemical sensor and photo-catalyst for environmental pollutants

    International Nuclear Information System (INIS)

    Graphical abstract: A dichloromethane chemical sensor using cobalt antimony oxides has been fabricated. This sensor showed high sensitivity and will be a useful candidate for environmental and health monitoring. Also it showed high photo-catalytic activity and can be a good candidate as a photo-catalyst for organic hazardous materials. Highlights: ► Reusable chemical sensor. ► Green environmental and eco-friendly chemi-sensor. ► High sensitivity. ► Good candidate for environmental and health monitoring. - Abstract: Cobalt doped antimony oxide nano-particles (NPs) have been synthesized by hydrothermal process and structurally characterized by utilizing X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM) and Fourier transforms infrared spectrophotometer (FT-IR) which revealed that the synthesized cobalt antimony oxides (CoSb2O6) are well crystalline nano-particles with an average particles size of 26 ± 10 nm. UV–visible absorption spectra (∼286 nm) were used to investigate the optical properties of CoSb2O6. The chemical sensing of CoSb2O6 NPs have been primarily investigated by I–V technique, where dichloromethane is used as a model compound. The analytical performance of dichloromethane chemical sensor exhibits high sensitivity (1.2432 μA cm−2 mM−1) and a large linear dynamic range (1.0 μM–0.01 M) in short response time (10 s). The photo catalytic activity of the synthesized CoSb2O6 nano-particles was evaluated by degradation of acridine orange (AO), which degraded 58.37% in 200 min. These results indicate that CoSb2O6 nano-particles can play an excellent research impact in the environmental field.

  7. Cobalt doped antimony oxide nano-particles based chemical sensor and photo-catalyst for environmental pollutants

    Energy Technology Data Exchange (ETDEWEB)

    Jamal, Aslam [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Rahman, Mohammed M. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Khan, Sher Bahadar, E-mail: drkhanmarwat@gmail.com [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Faisal, Mohd. [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Akhtar, Kalsoom [Division of Nano Sciences and Department of Chemistry, Ewha Womans University, Seoul 120-750 (Korea, Republic of); Rub, Malik Abdul; Asiri, Abdullah M.; Al-Youbi, Abdulrahman O. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia)

    2012-11-15

    Graphical abstract: A dichloromethane chemical sensor using cobalt antimony oxides has been fabricated. This sensor showed high sensitivity and will be a useful candidate for environmental and health monitoring. Also it showed high photo-catalytic activity and can be a good candidate as a photo-catalyst for organic hazardous materials. Highlights: Black-Right-Pointing-Pointer Reusable chemical sensor. Black-Right-Pointing-Pointer Green environmental and eco-friendly chemi-sensor. Black-Right-Pointing-Pointer High sensitivity. Black-Right-Pointing-Pointer Good candidate for environmental and health monitoring. - Abstract: Cobalt doped antimony oxide nano-particles (NPs) have been synthesized by hydrothermal process and structurally characterized by utilizing X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM) and Fourier transforms infrared spectrophotometer (FT-IR) which revealed that the synthesized cobalt antimony oxides (CoSb{sub 2}O{sub 6}) are well crystalline nano-particles with an average particles size of 26 {+-} 10 nm. UV-visible absorption spectra ({approx}286 nm) were used to investigate the optical properties of CoSb{sub 2}O{sub 6}. The chemical sensing of CoSb{sub 2}O{sub 6} NPs have been primarily investigated by I-V technique, where dichloromethane is used as a model compound. The analytical performance of dichloromethane chemical sensor exhibits high sensitivity (1.2432 {mu}A cm{sup -2} mM{sup -1}) and a large linear dynamic range (1.0 {mu}M-0.01 M) in short response time (10 s). The photo catalytic activity of the synthesized CoSb{sub 2}O{sub 6} nano-particles was evaluated by degradation of acridine orange (AO), which degraded 58.37% in 200 min. These results indicate that CoSb{sub 2}O{sub 6} nano-particles can play an excellent research impact in the environmental field.

  8. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate

    Science.gov (United States)

    Robayo, Marta L.; Lopez, Myriam C.; Daza, Carlos D.; Bedoya, Angela; Mariño, Maria L.; Saavedra, Carlos H.

    2016-01-01

    Background American cutaneous leishmaniasis (ACL) is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate) under systemic administration. According to different authors, pentavalent antimonial derivatives as treatment for ACL show a healing rate of about 75% and reasons for treatment failure are not well known. Methods In order to characterise the clinical and parasitological features of patients with ACL that did not respond to Glucantime, a cross-sectional observational study was carried out in a cohort of 43 patients recruited in three of the Colombian Army National reference centers for complicated ACL. Clinical and paraclinical examination, and epidemiological and geographic information were recorded for each patient. Parasitological, histopathological and PCR infection confirmation were performed. Glucantime IC50 and in vitro infectivity for the isolated parasites were estimated. Results Predominant infecting Leishmania species corresponds to L. braziliensis (95.4%) and 35% of the parasites isolated showed a significant decrease in in vitro Glucanatime susceptibility associated with previous administration of the medicament. Lesion size and in vitro infectivity of the parasite are negatively correlated with decline in Glucantime susceptibility (Spearman: r = (-)0,548 and r = (-)0,726; respectively). Conclusion A negative correlation between lesion size and parasite resistance is documented. L. braziliensis was found as the main parasite species associated to lesion of patients that underwent treatment failure or relapse. The indication of a second round of treatment in therapeutic failure of ACL, produced by L. braziliensis, with pentavalent antimonial

  9. Characterization of circulating lymphocyte subpopulations in canine leishmaniasis throughout treatment with antimonials and allopurinol.

    Science.gov (United States)

    Miranda, Sonia; Martorell, Susanna; Costa, Manuela; Ferrer, Lluis; Ramis, Antonio

    2007-03-31

    Canine leishmaniasis (CL) is a systemic parasitic disease with a wide variability of response to specific therapy: the majority of patients apparently improve with treatment, some of them respond but later relapse, and few of them do not respond at all. It has been demonstrated that the immune response plays a key role in the development and outcome of Leishmania infection in the dog and in the response to the treatment, although this response is not well understood. Some authors have suggested that ill dogs show a reduction in the percentage of circulating CD4+ lymphocytes and in the CD4+/CD8+ ratio, both of which normalize after treatment and clinical recovery. The present paper discusses the variation of the different lymphocyte subpopulations (CD3, CD4, CD8, CD21) of peripheral blood mononuclear cells (PBMC) in 28 dogs diagnosed with CL and submitted to conventional treatment with meglumine antimoniate (Glucantime) for 1 month and with allopurinol (Zyloric) for 1 year, in order to evaluate the usefulness of these parameters as indicators of the immunological condition of the ill animals and of the prognosis of their evolution during the treatment. It is concluded that circulating lymphocyte subpopulations are similar in dogs with leishmaniasis and in healthy dogs and that there is no correlation between the clinical status or response to therapy and the values of the counts of the different lymphocyte subpopulations. Therefore, the percentage of different lymphocyte subpopulations cannot be used as a parameter to predict the evolution of an individual patient in a clinical context. PMID:17110042

  10. Radiation-induced reactions of antimony and tellurium compounds in sulfuric acid solutions

    International Nuclear Information System (INIS)

    In deaerated 0.4 M H2SO4 solutions containing both Sb(III) and Sb(V), Sb(III) was oxidized to Sb(V) and Sb(V) was reduced to Sb(III) by γ rays. The initial yield of reduction G/sub i/(Sb(V) → Sb(III)) increased linearly with the ratio [Sb(V)]0/[Sb(III)]0, that of oxidation G/sub i/(Sb(III) → Sb(V)) increased with increasing G/sub i/(Sb(V) → Sb(III)), and the overall yield of oxidation G/sub i/(Sb(V)) = G/sub i/(Sb(III) → Sb(V)) - G/sub i/(Sb(V) → Sb(III)) was constant and equivalent to the primary yield of hydrogen g/sub H2/ = 1/2(g/sub OH/ - g/sub H/) + g/sub H2O2/. A possible mechanism of γ-ray-induced reactions in deaerated solutions was proposed in which Sb(III) was reduced by H and oxidized by OH, Sb(II) was oxidized by H2O2, and Sb(IV), and the disproportionation of Sb(IV) to Sb(III) and Sb(V) followed. In the presence of Sb(V), reduction of Sb(V) by H gives the same stoichiometry. The results on Te(IV) and Te(VI) in 0.02 M H2SO4 solutions support a similar sequence to that of the antimony system, in which the unstable valence states Te(III) and Te(V) play an important part

  11. Semimetal-semiconductor transitions in bismuth-antimony films and nanowires induced by size quantization

    International Nuclear Information System (INIS)

    In this paper we present the experimental results of an investigation of the electrical transport, thermoelectrical properties, the Shubnikov de Haas oscillations of Bi1-xSbx films (0 < x < 0.04) grown by the vacuum thermal evaporation and nanowires prepared by a modified Ulitovsky - Teilor technique. The results of the X-ray diffraction indicate that the trigonal axes were perpendicular to the film plane and the single Bi-2at%Sb nanowires with the diameter 100-1000 nm were represented by single crystals in a glass capillary with (1011) orientation along the wire axis. The investigations of the Shubnikov de Haas oscillations on Bi-2at%Sb wires with d > 600 nm show that overlapping of L and T bands was twice smaller than that in pure Bi. The temperature dependences of thin semimetallic Bi-3at%Sb films and Bi-2at%Sb wires show a semiconducting behavior. The semimetal semiconductor transition induced by the quantum confinement effect is observed in semimetal Bi1-xSbx films and nanowires at the diameters up to five times greater than those in the pure Bi. That experimental fact, on the one hand, will allow observing the display quantum confinement effect at higher temperatures on nanowires of the same diameters, and, on the other hand, will allows separating effects connected with the surface state and the quantum size effects. In addition, the thermoelectric properties and thermoelectric efficiency of bismuth-antimony wires are considered and a possibility to use them in thermoelectric converters of energy is discussed. (authors)

  12. Contamination of bottled waters with antimony leaching from polyethylene terephthalate (PET) increases upon storage.

    Science.gov (United States)

    Shotyk, William; Krachler, Michael

    2007-03-01

    Antimony concentrations were determined in 132 brands of bottled water from 28 countries. Two of the brands were at or above the maximum allowable Sb concentration for drinking water in Japan (2 microg/L). Elevated concentrations of Sb in bottled waters are due mainly to the Sb2O3 used as the catalyst in the manufacture of polyethylene terephthalate (PET(E)). The leaching of Sb from PET(E) bottles shows variable reactivity. In 14 brands of bottled water from Canada, Sb concentrations increased on average 19% during 6 months storage at room temperature, but 48 brands of water from 11 European countries increased on average 90% under identical conditions. A mineral water from France in PET(E), purchased in Germany, yielded 725 ng/L when first tested, but 1510 ng/L when it was stored for 6 months at room temperature; the same brand of water, purchased in Hong Kong, yielded 1990 ng/L Sb. Pristine groundwater containing 1.7+/-0.4 ng/L Sb (n = 6) yielded 26.6+/-2.3 ng/L Sb (n = 3) after storage in PET(E) bottles from Canada for 6 months versus 281+/-38 ng/L Sb (n = 3) in PET(E) bottles from Germany. Tap water bottled commercially in PET(E) in December 2005 contained 450+/-56 ng/L Sb (n = 3) versus 70.3+/-0.3 ng/L Sb (n = 3) when sampled from a household faucet in the same village (Bammental, Germany), and 25.7+/-1.5 ng/L Sb (n = 3) from a local artesian flow. PMID:17396641

  13. EPR, optical absorption and luminescence studies of Cr3+-doped antimony phosphate glasses

    Science.gov (United States)

    De Vicente, F. S.; Santos, F. A.; Simões, B. S.; Dias, S. T.; Siu Li, M.

    2014-12-01

    Antimony phosphate glasses (SbPO) doped with 3 and 6 mol% of Cr3+ were studied by Electron Paramagnetic Resonance (EPR), UV-VIS optical absorption and luminescence spectroscopy. The EPR spectra of Cr3+-doped glasses showed two principal resonance signals with effective g values at g = 5.11 and g = 1.97. UV-VIS optical absorption spectra of SbPO:Cr3+ presented four characteristics bands at 457, 641, 675, and 705 nm related to the transitions from 4A2(F) to 4T1(F), 4T2(F), 2T1(G), and 2E(G), respectively, of Cr3+ ions in octahedral symmetry. Optical absorption spectra of SbPO:Cr3+ allowed evaluating the crystalline field Dq, Racah parameters (B and C) and Dq/B. The calculated value of Dq/B = 2.48 indicates that Cr3+ ions in SbPO glasses are in strong ligand field sites. The optical band gap for SbPO and SbPO:Cr3+ were evaluated from the UV optical absorption edges. Luminescence measurements of pure and Cr3+-doped glasses excited with 350 nm revealed weak emission bands from 400 to 600 nm due to the 3P1 → 1S0 electronic transition from Sb3+ ions. Cr3+-doped glasses excited with 415 nm presented Cr3+ characteristic luminescence spectra composed by two broad bands, one band centered at 645 nm (2E → 4A2) and another intense band from 700 to 850 nm (4T2 → 4A2).

  14. Metagenomic approach reveals variation of microbes with arsenic and antimony metabolism genes from highly contaminated soil.

    Directory of Open Access Journals (Sweden)

    Jinming Luo

    Full Text Available Microbes have great potential for arsenic (As and antimony (Sb bioremediation in heavily contaminated soil because they have the ability to biotransform As and Sb to species that have less toxicity or are more easily removed. In this study, we integrated a metagenomic method with physicochemical characterization to elucidate the composition of microbial community and functional genes (related to As and Sb in a high As (range from 34.11 to 821.23 mg kg-1 and Sb (range from 226.67 to 3923.07 mg kg-1 contaminated mine field. Metagenomic analysis revealed that microbes from 18 phyla were present in the 5 samples of soil contaminated with high As and Sb. Moreover, redundancy analysis (RDA of the relationship between the 18 phyla and the concentration of As and Sb demonstrated that 5 phyla of microbes, i.e. Actinobacteria, Firmicutes, Nitrospirae, Tenericutes and Gemmatimonadetes were positively correlated with As and Sb concentration. The distribution, diversity and abundance of functional genes (including arsC, arrA, aioA, arsB and ACR3 were much higher for the samples containing higher As and Sb concentrations. Based on correlation analysis, the results showed a positive relationship between arsC-like (R2 = 0.871 and aioA-like (R2 = 0.675 gene abundance and As concentration, and indicated that intracellular As(V reduction and As(III oxidation could be the dominant As detoxification mechanism enabling the microbes to survive in the environment. This study provides a direct and reliable reference on the diversity of microbial community and functional genes in an extremely high concentration As- and Sb-contaminated environment.

  15. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    International Nuclear Information System (INIS)

    A new K2O-B2O3-Sb2O3 (KBS) glass system having low phonon energy (about 600 cm-1) doped with Nd3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd2O3. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the 4G7/2 → 4I9/2 and 4G7/2 → 4I13/2 transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G7/2) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1).

  16. Effect of external energy on atomic, crystalline and powder characteristics of antimony and bismuth powders

    Indian Academy of Sciences (India)

    Vikram V Dabhade; Rama Mohan R Tallapragada; Mahendra Kumar Trivedi

    2009-10-01

    Next to atoms and molecules the powders are the smallest state of matter available in high purities and large quantities. The effect of any external energy on the shape, morphology and structure can thus be studied with relative ease. The present investigation deals with the effect of a non-contact external energy on the powders of antimony and bismuth. The characteristics of powders treated by external energy are compared with the as received powders (control). The average particle sizes, 50 and 99, the sizes below which 99% of the particles are present showed significant increase and decrease indicating that the energy had caused deformation and fracture as if the powders have been subjected to high energy milling. To be able to understand the reasons for these changes the powders are characterized by techniques such as X-ray diffraction (XRD), surface area determination (BET), thermal analytical techniques such as DTA–DTG, DSC–TGA and SDTA and scanning electron microscopy (SEM). The treated powder samples exhibited remarkable changes in the powder characteristics at all structural levels starting from polycrystalline particles, through single crystal to atoms. The external energy had changed the lattice parameters of the unit cell which in turn changed the crystallite size and density. The lattice parameters are then used to compute the weight and effective nuclear charge of the atom which showed significant variation. It is speculated that the external energy is acting on the nucleus through some reversible weak interaction of larger cross section causing changes in the proton to neutron ratios. Thus the effect is felt by all the atoms, and hence the unit cell, single crystal grain and grain boundaries. The stresses generated in turn may have caused deformation or fracture of the weak interfaces such as the crystallite and grain boundaries.

  17. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony

    Directory of Open Access Journals (Sweden)

    D. Medlen

    2012-01-01

    Full Text Available The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eutectic phase particle shape and improve the mechanical properties of the final cast products and Al-Si alloys cast properties.

  18. Flow analysis-hydride generation-gas phase derivative molecular absorption spectrophotometric determination of antimony in antileishmanial drugs

    Directory of Open Access Journals (Sweden)

    Máximo Gallignani

    2009-01-01

    Full Text Available In the present work, the development of a method based on the coupling of flow analysis (FA, hydride generation (HG, and derivative molecular absorption spectrophotometry (D-EAM in gas phase (GP, is described in order to determine total antimony in antileishmanial products. Second derivative order (D²224nm of the absorption spectrum (190 - 300 nm is utilized as measurement criterion. Each one of the parameters involved in the development of the proposed method was examined and optimized. The utilization of the EAM in GP as detection system in a continuous mode instead of atomic absorption spectrometry represents the great potential of the analytic proposal.

  19. Influence of antimony on the mechanical properties and gas content of alloy AlSi6Cu4

    OpenAIRE

    D. Medlen; D. Bolibruchova

    2011-01-01

    Aluminium alloys based on Al-Si are used in automotive and aerospace industries. AlSi6Cu4 alloy is used the complicated castings, whichmust comply high strength requirements. Strength characteristics can also be affected by the modifiers: Na, Sr, Sb. In the li terature ismentioned, that AlSi6Cu4 modified by sodium and strontium has negative effect - increases of the gas absorption. Modification of AlSi6Cu4 alloy by antimony, is still not mentioned in the literature. The article gives the effe...

  20. First-principle study of antimony doping effects on the iron-based superconductor CaFe(Sb$_{x}$As$_{1-x}$)$_{2}$

    OpenAIRE

    Nagai, Yuki; Nakamura, Hiroki; Machida, Masahiko; Kuroki, Kazuhiko

    2015-01-01

    We study antimony doping effects in the iron-based superconductor CaFe(Sb$_{x}$As$_{1-x}$)$_{2}$ by using the first-principle calculation. The calculations reveal that the substitution of the doped antimony atom into As of the chainlike As layers is more stable than that in FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers existing only in novel 112 system is responsible for rising up the critical tempe...

  1. Household methods to reduce 137Cs contents of mushrooms

    International Nuclear Information System (INIS)

    High radiocaesium contents in different species of mushrooms have been observed in areas contaminated by radiocaesium deposition after the Chernobyl accident in 1986. There has been no significant reduction in the 137Cs contents of mushrooms during the past ten years, besides via radioactive decay. The internal radiation dose received via mushrooms can be reduced by processing mushrooms before consumption. Various household methods were studied to find out their efficiency to reduce 137Cs contents of mushrooms. The methods tested were the same as normally used in cooking. The tests were made for the species of edible mushrooms widely consumed. The retention factors for the treatments tested were in most cases 0.2-0.3. The efficiency of treatments in reducing the 137Cs contents increased with larger water volumes and prolonged treatment times

  2. Cesium-137 concentration of soils in Pest County, Hungary

    International Nuclear Information System (INIS)

    This paper presents the results of measurements of 137Cs in soils in Pest County, Hungary. We investigated forty five soil monoliths from monitoring locations of a countrywide Soil Information and Monitoring System (SIMS) at depths of 0–30, 30–60, 60–90, 90–120 and 120–150 cm. The 137Cs concentrations were determined by gamma spectroscopy. We found that only the upper layer of soil (0–30 cm) contained 137Cs above the detection limit (0.5 Bq kg−1). The 137Cs concentration values ranged from the detection limit to 61.1 Bq kg−1 ± 2.2 Bq kg−1 and were lognormally distributed. The concentrations had a geometric mean 6.4 Bq kg−1 and a geometric standard deviation 2.3 (an arithmetic mean 9.5 Bq kg−1, an arithmetic standard deviation 11.3 Bq kg−1). We constructed a 137Cs map for Pest County this is the first detailed 137Cs map in Hungary. Concentrations were systematically higher (10.0–61.1 Bq kg−1) than average in the Pilis and Buda Mountains and the Northern part of the Gödöllő Hills. In contrast, low concentrations (0.0–10.0 Bq kg−1) characterized the southern part of the Gödöllő Hills, the Pest Plane and the Börzsöny Mountains. Two highest values were 46.9 Bq kg−1 and 61.1 Bq kg−1: one of these localities, a loamy brown forest soil was chosen to study relationship between 137Cs migration and clay materials of the soil. According to differential thermal analysis (DTA) and x-ray diffraction (XRD) analyses, illite and kaolinite were dominant in the soil. The amount of clay was closely proportional to 137Cs concentration (R = 0.89). At the locality having the highest surface concentration, 78% of the total detected 137Cs concentration was measured in the top 3 cm layer of soil profile and there was no detectable concentration below 20 cm. This result indicates that penetration of 137Cs into the soil is a very slow process in this case. Analysis of this depth profile showed lower 137Cs migration parameter values (effective

  3. The forecast of agricultural crop production contamination by Cs 137

    International Nuclear Information System (INIS)

    The saved up experimental data on the influence of various factors on radionuclides transition in plants allows predicting their contents in production of agricultural crops. It is established, that receipt radionuclides in plants depends on a kind and a grade of cultivated cultures, types of ground, granulometric structure, parameters of soil fertility, humidifying grounds, levels of application of mineral fertilizers and other factors. The determining factor on Cs 137 receipt in plants is presented in ground exchange potassium. The forecast of Cs 137 transition from ground in plants is widely used in an agricultural production at planning and realization of a complex of protective actions. According to predicted levels of Cs 137 accumulation in production the directions of its use are determined. (authors)

  4. Environmental application of cesium-137 irradiation technology: Sludges and foods

    Science.gov (United States)

    Sivinski, Jacek S.

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation.

  5. Radiochemical determination of {sup 137}Cs in foods

    Energy Technology Data Exchange (ETDEWEB)

    Kastner, Geraldo F.; Ferreira, Andrea Vidal; Monteiro, Roberto P.G., E-mail: gfk@cdtn.br, E-mail: avf@cdtn.br, E-mail: rpgm@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2013-07-01

    A determination of radionuclides in food samples is important in commodities in order to attend to regulatory requirements for international trade. As a long-lived radioisotope of cesium, {sup 137}Cs is produced as a result of human nuclear activities and than its contamination level evaluation among others radionuclides in foods is necessary. A methodology for the determination of {sup 137}Cs in foods, pork and fish, is described. The procedures covered homogenization and freeze-drying of the samples. The {sup 137}Cs was measured by gamma spectrometry using Canberra 50% HPGe detector. The counting was carried out with Monte Carlo software for detection conditions optimization including geometry and chemical data information. A certified sample, SRM IAEA-375, was analyzed in order to evaluate the reliability of the method, and the results showed good agreement between the measured and certified values. (author)

  6. Environmental application of cesium-137 irradiation technology: sludges and foods

    International Nuclear Information System (INIS)

    Several activities have been undertaken to investigate and implement the use of the military byproduct cesium-137 in ways which benefit mankind. Gamma radiation from cesium-137 has been shown to be effective in reducing pathogens in sewage sludge to levels where reuse of the material in public areas meets current regulatory criteria for protection of public health. Food irradiation at doses of 10 kGy or less have been found by international expert committees to be wholesome and safe for human consumption. Cesium-137 can be used as a means of enhancing particular properties of various food commodities by means of sterilization, insect disinfestation, delayed senescence and ripening, and sprout inhibition. This paper discusses the U.S. Department of Energy Beneficial Uses Program research and engineering history, as well as current activities and future plans, relating to both sewage sludge and food irradiation. (author)

  7. Dating of mine waste in lacustrine sediments using cesium-137

    Science.gov (United States)

    Rember, W. C.; Erdman, T. W.; Hoffmann, M. L.; Chamberlain, V. E.; Sprenke, K. F.

    1993-11-01

    For over a century Medicine Lake in northern Idaho has received heavy-metal-laden tailings from the Coeur d'Alene mining district. Establishing the depositional chronology of the lake bottom sediments provides information on the source and rate of deposition of the tailings. Cesium-137, an isotope produced in the atmosphere by nuclear bomb tests, was virtually absent in the environment prior to 1951, but reached its apex in 1964. Our analysis of cesium-137 in the sediments of Medicine Lake revealed that 14 cm of fine-grained tailings were deposited in the lake from 1951 to 1964 and tailing deposition downstream was greatly reduced by the installation of tailings dams in the district in 1968. Cesium-137 analysis is accomplished by a fairly simple gamma-ray counting technique and should be a valuable tool for analyzing sedimentation in any lacustrine environment that was active during the 1950s and 1960s.

  8. Using Cs-137 to assess sheet erosion in Western Australia

    International Nuclear Information System (INIS)

    The Cs-137 technique represents the only feasible method whereby sheet erosion is likely to be measured in Western Australia given the expense of building, equipping and monitoring stream gauging stations and the difficulties in detecting small but significant changes in soil levels on sites subject to wind erosion. A pilot study in 1987 used a stratified sampling technique to assess sheet erosion on representative hillslopes. There are possible problems in using the Cs-137 technique in Western Australia due to poor labelling of non-wetting soils, due to poor retention by very sandy soils, due to the selective removal of dust particles and due to wind erosion adding Cs-137 to input sites. Lateritic gravel stones may also need to be crushed and added to the samples for analysis. Some of these problems may be better understood when the results of the pilot survey have been analysed

  9. Study of slips of hillside by means of Cs 137

    International Nuclear Information System (INIS)

    The mass movements, such as slides, are the most important erosion processes and natural hazards in mountains and highlands areas. In this work, the evolution of landslides in the north of Spain were studied with a modification of the Cs-137 method for erosion. Samples are taken in a lot of landslide points at several deeps and measured with gamma spectrometry. The obtained deep profiles of Cs-137 were interpreted by the obtained with a numerical computer programme. The programme simulates the deposition of Cs-137 in the land surface, the redistribution in the soil and the soil losses by landslide. The finding results were useful for to characterise the deposition areas and for to put a date on the landslide

  10. Cesium 137 in oils and plants from Guatemala

    International Nuclear Information System (INIS)

    Since 1990 the project of radioactive and environmental contamination started in Guatemala. Studies about the radioactive contamination levels are made within the framework of this project. Cesium-137 has been an interest radionuclide, because it is a fission product released to the environment by the use of nuclear weapons and nuclear power plants accidents. The sampling consisted in collection of soil and grass in 20 provinces of Guatemala, one point by province, and it was made in 1990. The cesium-137 concentration in the samples, was determined by gamma spectrometry, using an hyper pure germanium detector. The results show the presence of radioactive contamination in soil and grass due to cesium-137, at levels that might be considered as normal. The levels found are not harmful for human health, and its importance is the fact that can be used as reference levels for the environmental radioactivity monitoring in Guatemala

  11. 137Cs transfer coefficients from fodder to cow milk

    International Nuclear Information System (INIS)

    The transfer of 137Cs from the components of cows' diets to milk was followed in detail on 10 farms in the north-eastern region of Italy (Friuli-Venezia Giulia) from June to July 1988. Samples of milk, grass and other components of the cows' diet were collected regularly and analysed for radiocaesium content. The transfer factors, calculated for 137Cs after a four-week feeding period with contaminated silage, were higher (0.0064) than those calculated in 1987 in the same area (0.0030). This may be attributable to the fact that the 137Cs associated to the forage administrated to cows in 1988 was completely incorporated in the plant and thus more assimilable to the cattle. (Author)

  12. Household methods to reduce {sup 137}Cs contents of mushrooms

    Energy Technology Data Exchange (ETDEWEB)

    Kostiainen, E. [Radiation and Nuclear Safety Authority - STUK, Helsinki (Finland)

    2005-09-15

    High radiocaesium contents in different species of mushrooms have been observed in areas contaminated by radiocaesium deposition after the Chernobyl accident in 1986. There has been no significant reduction in the {sup 137}Cs contents of mushrooms during the past ten years, besides via radioactive decay. The internal radiation dose received via mushrooms can be reduced by processing mushrooms before consumption. Various household methods were studied to find out their efficiency to reduce {sup 137}Cs contents of mushrooms. The methods tested were the same as normally used in cooking. The tests were made for the species of edible mushrooms widely consumed. The retention factors for the treatments tested were in most cases 0.2-0.3. The efficiency of treatments in reducing the {sup 137}Cs contents increased with larger water volumes and prolonged treatment times.

  13. Transfer of 137Cs into fish in small forest lakes

    International Nuclear Information System (INIS)

    The transfer of 137Cs into fish in seepage and drainage lakes from 1988 to 1992 was analysed using linear regression. Empirical results for 137Cs in lake water and fish were used to calculate concentration factors (CFs). In the drainage lakes the CF decreased during the study period by 9% per year whereas in the seepage lakes the CF increased significantly by 4.3% per year. The transfer of 137Cs into pike was significantly (1.6 times) higher than that into perch. The CF increased on average by 3.4% for each 1-cm increase in the median size of perch. The relationship between the water chemistry and the CF differed between clear-water seepage and brown-water drainage lakes.

  14. Cesium-137 in soil texture fractions and its impact on Cesium-137 soil-to-plant transfer

    International Nuclear Information System (INIS)

    Field studies at two sites contaminated by the Chernobyl fallout showed 137Cesium (Cs) soil-to-plant transfer factors in wheat, rye and potato. Transfer values ranged from 0.0017 (potato tuber) to 0.07 (wheat straw). Generally transfer coefficients in cereal grains and potato tubers were significantly below the values of the shoots. A comparison of the two sites led to the conclusion that for all plants investigated 137Cs transfer factors were higher in Lower Austria (Calcic Chernozem) than in Upper Austria (Eutric Cambisol). The specific activities of the texture fractions of the two soil types increased from sand to silt and clay. In the Calcic Chernozem the ratio of the 137Cs activity in the silt fraction to the total activity in the soil was considerably higher than in the Eutric Cambisol. At the same time extractability of 137Cs from the silt fraction of the latter soil was clearly lower. Both results mainly were attributed to the differences between the soils according to the organic matter content of the silt fractions, the Calcic Chernozem being seven times higher. Therefore, the differences in the 137Cs-soil-to-plant transfer can be attributed partly to these soil characteristics. (authors)

  15. Non-destructive burnup determination of PWR spent fuel using Cs-134/Cs-137 and Eu-154/Cs-137

    International Nuclear Information System (INIS)

    Burnups for 36 points of five rods in the G23 assembly of Kori unit 1 have been determined on the basis of gamma-ray spectrometric measurement of two isotopic ratios, Cs-134/Cs-137 and Eu-154/Cs-137 in combination with the results calculated by the SCALE4.4 SAS2H module. Benchmarking of the SAS2H module has been done for the existing experimental data of Cs-13134, Cs-137 and Eu-154 isotopic compositions in PWR spent fuel. The gamma ray counts of two isotopic ratios have been corrected with their branching ratios, decay rates and energy dependent counting efficiencies in order to get true ratios. The energy dependent counting efficiencies have been determined as a quadratic equation based on the gamma ray counts for Cs-134 and Eu-154 at fourth energy points. Finally, burnups have been determined by putting true ratios of two isotopic ratios to their burnup-to-ratio fitting functions, respectively. Then the measured burnups have been compared with the declared burnup by the nuclear power plant. It is revealed that burnups determined from Cs-134/Cs-137 are agreeable with the declared burnups in most cases within about 12% error except a measuring point of C13, one of G23 fuel rods. In the case of Eu-154/Cs-137, the measured burnup is much lower than the declared burnup, which seems to be derived from system errors. (author)

  16. Uptake and transfer factors of 137Cs by mushrooms

    International Nuclear Information System (INIS)

    The 137Cs content of 118 species (668 samples) of higher fungi collected in the period from August 1984 to October 1989 at three different locations in Styria, Austria, was determined by gamma-spectrometry. The Cs-content of most mushrooms has been increasing since September 1986. In order to find out which factors determine the 137Cs-contamination of mushrooms and the transfer-value soil to mushroom, the concentration of total and plant-available radiocesium in soils as well as the pH-value, the content of humus, clay, silt, sand, exchangeable cations, the composition of the clay minerals, and the particle size distribution of the soils of two different locations were examined. The higher the 137Cs contamination of the soil, the thicker the layer of humus and the higher the content of humus, the lower the pH-value, and the lower the amount of essential cations, especially of K+, the higher the amount of 137Cs plant-available will be. Therefore, the contamination of the mushrooms in the coniferous forest of Koralpenblick (1000 m) is higher than in the mixed forest at the Rosenberg around Graz at approx. 500 m height. Of 26 different species of mushrooms measured at both sites, only 61% show the highest TF-values soil to mushrooms also at the Koralpenblick. In the spruce forest at Koralpenblick there are many species of mushrooms with high 137Cs-contamination which were not found at the Rosenberg. However, the properties of the species to which a mushroom belongs are more important than environmental conditions and soil properties. The transfer values of 40K stay within narrow bounds, whereas those of 137Cs differ widely. (orig.)

  17. Surface activity of 137Cs, sheet 35 - Trnava

    International Nuclear Information System (INIS)

    In the predominantly geomorphologically mountainous terrain the map of surface activity of 137Cs was compiled from the results of exploration activities on scale 1:200 000 and in the Danube upland (between Povazsky Inovec and Little Carpathians) on scale 1:50 000. Surface activities of 137Cs are significantly unevenly distributed. The most widespread surface activity of 137Cs in the interval from 1000 to 2000 Bq · m-2 was mapped on mostly continuous area in the central part of map sheet and represents 68.4% of its area. The exception is only a small increase (10,225 Bq · m-2) in Banovska upland south-east from the village Zlatniky. Higher surface activities of 137Cs were registered in the north part of the map sheet. There from neighbouring map sheet (34 - Znojmo) reaches an area of increased values (3000 to 5000 Bq · m-2, max. 6550 Bq · m-2), geomorphologically falling into the western part of the White Carpathians. Relatively high surface activities of 137Cs were found in the south-east part of the map sheet in the Tribec mountains near Skycov (max. 7426 Bq.m-2), in Zitavska flood-plain south of the Zlate Moravce (max. 13962 Bq · m-2), but mainly in Vtacnik and Stiavnicke Hills, where in Nova Bana was measured the maximal surface activity 16497 Bq · m-2. Considering sizeable areal expansion of lower levels of surface activity of 137Cs, the geometric mean (1338 Bq.m-2) on this map sheet corresponds to the national average. (authors)

  18. Changes in 137Cs transfer to agricultural products

    International Nuclear Information System (INIS)

    The food production and food harvesting systems common in the areas contaminated by the Chernobyl accident in Republic of Belarus can be grouped into three major categories: collective farm produce, private farming produce and natural foods collected from natural ecosystems. The collective farm system provided the smallest contribution (8-12 %) to the intake of 137Cs. Natural food was the major contributor to the intake at one study site (73 %), and private produce was the major contributor (60 %) at the other study site. Assessment of the situation just after the accident (one year) shows that collective farming was still a minor contributor to 137CS intake (10 %) whilst private fanning would have been the major contributor wherever private milk production and consumption continued. The extent to which inhabitants consume natural foods from forests has a considerable effect on their 137CS intake. The comparative importance of food products from natural ecosystems increases with time due to the long effective ecological half lives of 137Cs in unimproved pastures and forests. Estimation of the contribution to the fluxes of 137Cs from the different production and harvesting systems showed that the contribution from private farming and food harvesting from natural ecosystems may also be significant, contributing 14-30 % to the total fluxes of 137Cs from an area even if the quantity of food produced in these systems is small. However, the major contributor to the flux exported from an area was the collective farming system, accounting for about 70-86 % of the total. Refs. 12 (author)

  19. The behaviour of 137Cs in the aquatic environment

    International Nuclear Information System (INIS)

    Through 137Cs concentration profiles in sediments from Rochedo Reservoir, it was possible to estimate the amount of this radionuclide (94 TBq) which has reached the Meia Ponte River system, as a consequence of the Goiania Radiological accident in 1987. Based on in-situ measurements as well as on laboratory studies, the influence of NH4+ concentration on the Kd value was also investigated. The results have shown that for high NH4d+ concentrations there is a clear correlation between both parameters. It was also observed the influence on the ageing effect on the 137Cs release from the sediment, as well as of the illite content on it. (author)

  20. Determination of Cs-134 and Cs-137 rain water samples

    International Nuclear Information System (INIS)

    In order to setting an environmental monitoring program at IPEN, was developed a fast and simple methodology for concentration of Cs-134 and Cs-137 in rain water. This procedure consists in the precipitation of cesium and others cathions of its family (NH4+, K+ and Rb+) by ammonium molybdophosphate. The measures of the desintegration rates of Cs-134 and Cs-137 was done by gamma spectrometry in a Ge(Li) detector. After setting up the ideal experimental conditions, the procedure was used to analyze four samples of rain water. (author)

  1. Transfer factor values of 137 Cs from latosoils to vegetables

    International Nuclear Information System (INIS)

    Transfer Factor values for black beams, radish and carrot were obtained for soils artificially and accidentally contaminated in Goiania during 1987. Differences of 137 Cs-soil-to-plant transfer were discussed in the light of pedology and crop type. These values were about one order of magnitude higher than mean values reported by IUR for temperature climate for the same crops. These results advertising for the peculiar dynamics of 137 Cs in tropical soils and for needs to obtain regional data to be used in assessment dose models. (author)

  2. The utilization of caesium 137 in studying soil degradation

    International Nuclear Information System (INIS)

    The caesium 137 isotope is distributed in the atmosphere during nuclear explosions, and is absorbed in the upper horizons of the soil on reaching the ground. When it is incorporated in the fine fraction of the soil, caesium 137 measurement allows movements affecting cultivated lands (mass movements, runoff effects, wind action) and rate of soil degradation over half a century to be evaluated. Vegetal cover and techniques of soil utilization must be considered; this method has been tested on a watershed in the Parisian Basin. 5 figs., 26 refs

  3. Dicty_cDB: AFL137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL137 (Link to dictyBase) - G21597 DDB0231234 Contig-U02953-1 AFL137F (Lin ... rachyantha genomic clone OB__Ba0079C16 5', genomic survey ... sequence. 42 4e-04 2 CL540114 |CL540114.1 OB__Ba00 ... rachyantha genomic clone OB__Ba0061I04 5', genomic survey ... sequence. 42 4e-04 2 CL590268 |CL590268.1 OB__Ba00 ...

  4. Declassification of 137Cs liquid wastes by reverse osmosis

    International Nuclear Information System (INIS)

    In June 1998, a 137Cs source was accidentally melted in one of the furnaces of a stainless steel production company located in Spain. As a result of this incident, the furnace and its cooling circuit were radioactively contaminated. LAINSA (Logistica y Acondicionamientos Industriales S.A.) company took charge of the plant decontamination process, in which 40 m3, approximately, of 137Cs contaminated water with a mean activity of 300 kBq/L were generated. This company contacted the Chemical and Nuclear Engineering Department of the Polytechnic University of Valencia (UPV) to develop a project for radioactive liquid wastes treatment

  5. Transport processes of Cs-137 in lake environments

    International Nuclear Information System (INIS)

    Radiocesium levels in the waters of the Lake District dropped after the initial deposition following the Chernobyl reactor accident. However they continued to be measurable several years after the event. Caesium 137 concentrations were measured in the sediments of Esthwaite water and Windermere to determine the input of caesium 137 from the catchment area to the lakes. Experiments were conducted to ascertain the chemical conditions such as pH value, adsorption, competing ions which might contribute to maintaining caesium levels in the lakes. (U.K.)

  6. Mathematical model of 137Cs dynamics in the deciduous forest

    International Nuclear Information System (INIS)

    A mathematical model of 137Cs behaviour in the forest ecosystem is presented. The behaviour of this radionuclide is assumed to obey the same regularities as the behaviour of its stable chemical analogue, potassium. Radionuclide dynamics are considered in parallel with the dynamics of the phytomass. Radionuclides contained in the vegetation are pooled into two basic compartments: external and internal contamination, with separate analysis of each. The model was verified using the data obtained in the 30-km zone of the Chernobyl NPP in 1986-1994. The algorithm described was found to be the most efficient in terms of 137Cs behaviour in the forest environments

  7. Dosimetry of a Cesium 137 source; Dosimetria de una fuente de Cesio 137

    Energy Technology Data Exchange (ETDEWEB)

    Torres R, J.G.; Manzanares A, E.; Vega C, H.R. [Unidades Academicas de Estudios Nucleares, Universidad de Zacatecas (Mexico)

    2005-07-01

    It was carried out a dosimetric study of a source of Cesium 137 used in investigations of Radiobiology. This radionuclide has a half life of 30.07 years and it emits photons of 661.657 keV with a probability of 85.2%. The source has been used in a series of experiments trending to observe the cellular response before the gamma rays, as well as for the calibration of equipment of radiological protection. For such reason it is important to determine the dosimetric properties. In this work it was determined the absorbed dose that this source takes when being placed in the center from a methylmethacrylate badge to three distances, 5, 10 and 15 cm. The dose was measured with thermoluminescent dosemeters and it was calculated by means of Monte Carlo method, also was derived an expression that allows to determine the dose starting from the information of the activity of the source and of the distance regarding the same one. (Author)

  8. The distribution and cycling of Cs 137 in forest ecosystem

    International Nuclear Information System (INIS)

    Full text: The leading radioecological criterion for contaminated forests is the ability to radionuclide accumulation by different layers of forest ecosystem. The researches were carried out in summer of 2004 within Chernobyl Exclusion Zone at a distance about 15 km from damage reactor. Three experimental plots are represented different types of pine woods: Cladonio-Pinetum Jurassek 1927 in the poorest conditions of height dry sandy dunes, Dicrano-Pinetum Mat. (1973) 1981, and Molinio-Pinetum Mat. (1973) 1981. The latter two belongs to the same floristic taxon. The density of Cs 137 ground deposition is between 600 and 650 kBq per square meter (16-17 Ci·km-2). The age of the studied cenoses is 48-50 years. Each experimental plot had the area of 1.0 ha. The vertical distribution of Cs 137 in the soil profile has been studied. For the Cladonio-Pinetum the specific activity of Cs 137 in soil is exponentially decreases along the profile. The soil type under Dicrano-Pinetum pine forest is the same, but Cs 137 distribution is irregular: specific activity is practically stable up to 12 cm and exponentially decreases below. The contamination of soil profile of Molinio-Pinetum ecosystem is characterized with two maximums: the superficial soil level and on the depth 6-12 cm. The soil has substantially greater degree of podsolic process. The highest property for caesium accumulation shows such species as Calluna vulgaris and Arctostaphylos uva-ursi. Rest species are substantially low accumulating this radionuclide. Fungi are an indicator of heavy metal accumulation: they have a great mycelium that provides the radionuclide transition to fruitbody from the great area. The 'forest gifts', especially edible mushrooms, are the critical diet components of local population and can cause significant increasing of internal exposure dose, mainly as a result of consumption of mushrooms. Specific contamination of fungi is more than one order of magnitude higher in comparison with other

  9. Determination of Antimony (III in Real Samples by Anodic Stripping Voltammetry Using a Mercury Film Screen-Printed Electrode

    Directory of Open Access Journals (Sweden)

    Olga Domínguez-Renedo

    2009-01-01

    Full Text Available This paper describes a procedure for the determination of antimony (III by differential pulse anodic stripping voltammetry using a mercury film screen-printed electrode as the working electrode. The procedure has been optimized using experimental design methodology. Under these conditions, in terms of Residual Standard Deviation (RSD, the repeatability (3.81 % and the reproducibility (5.07 % of the constructed electrodes were both analyzed. The detection limit for Sb (III was calculated at a value of 1.27×10–8 M. The linear range obtained was between 0.99 × 10–8 – 8.26 × 10–8 M. An analysis of possible effects due to the presence of foreign ions in the solution was performed and the procedure was successfully applied to the determination of antimony levels in pharmaceutical preparations and sea water samples.

  10. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment

    Directory of Open Access Journals (Sweden)

    Miguel Guzman-Rivero

    2014-11-01

    Full Text Available Background: The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. Objective: To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Design: Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. Results: The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. Conclusions: It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  11. Treatment of air pollution control residues with iron rich waste sulfuric acid: does it work for antimony (Sb)?

    Science.gov (United States)

    Okkenhaug, Gudny; Breedveld, Gijs D; Kirkeng, Terje; Lægreid, Marit; Mæhlum, Trond; Mulder, Jan

    2013-03-15

    Antimony (Sb) in air pollution control (APC) residues from municipal solid waste incineration has gained increased focus due to strict Sb leaching limits set by the EU landfill directive. Here we study the chemical speciation and solubility of Sb at the APC treatment facility NOAH Langøya (Norway), where iron (Fe)-rich sulfuric acid (∼3.6M, 2.3% Fe(II)), a waste product from the industrial extraction of ilmenite, is used for neutralization. Antimony in water extracts of untreated APC residues occurred exclusively as pentavalent antimonate, even at low pH and Eh values. The Sb solubility increased substantially at pHettringite (at alkaline pH) or calcium (Ca)-antimonate. Treated APC residues, stored anoxically in the laboratory, simulating the conditions at the NOAH Langøya landfill, gave rise to decreasing concentrations of Sb in porewater, occurring exclusively as Sb(V). Concentrations of Sb decreased from 87-918μgL(-1) (day 3) to 18-69μgL(-1) (day 600). We hypothesize that an initial sorption of Sb to Fe(II)-Fe(III) hydroxides (green rust) and eventually precipitation of Ca- and Fe-antimonates (tripuhyite; FeSbO4) occurred. We conclude that Fe-rich, sulfuric acid waste is efficient to immobilize Sb in APC residues from waste incineration. PMID:23465722

  12. Complement activation-related pseudoallergy in dogs following intravenous administration of a liposomal formulation of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro

    2013-08-01

    Full Text Available The increasing use of nanotechnologies in advanced therapies has allowed the observation of specific adverse reactions related to nanostructures. The toxicity of a novel liposome formulation of meglumine antimoniate in dogs with visceral leishmaniasis after single dose has been investigated. Groups of 12 animals received by the intravenous route a single dose of liposomal meglumine antimoniate (group I [GI], 6.5 mg Sb/kg, empty liposomes (GII or isotonic saline (GIII. Evaluation of hematological and biochemical parameters showed no significant changes 4 days after administration. No undesired effects were registered in the GIII. However, adverse reactions were observed in 67.7% of dogs from both groups that received liposomal formulations. The side effects began moments after bolus administration and disappeared during the first 15 minutes after treatment. Prostation, sialorrhea and defecation were the most frequent clinical signs, registered in 33.3% and 41.6 % of animals from the groups GI and GII, respectively. Tachypnea, mydriasis, miosis, vomiting and cyanosis were also registered in both groups. The adverse reactions observed in this study were attributed to the activation of the complement system by lipid vesicles in a phenomenon known as Complement Activation-Related Pseudoallergy (CARPA. The influence of the physical-chemical characteristics of liposomal formulation in the triggering of CARPA is discussed.

  13. Detection of pathogenic bacteria in skin lesions of patients with chiclero's ulcer: reluctant response to antimonial treatment

    Directory of Open Access Journals (Sweden)

    Isaac-Márquez Angélica Patricia

    2003-01-01

    Full Text Available We investigated the bacterial flora present in skin lesions of patients with chiclero's ulcer from the Yucatan peninsula of Mexico using conventional culture methods (11 patients, and an immunocolorimetric detection of pathogenic Streptococcus pyogenes (15 patients. Prevalence of bacteria isolated by culture methods was 90.9% (10/11. We cultured, from chiclero's ulcers (60%, pathogenic bacterial such as Staphylococcus aureus (20%, S. pyogenes (1.6%, Pseudomonas aeruginosa (1.6%, Morganella morganii (1.6%, and opportunist pathogenic bacteria such as Klebsiella spp. (20.0%, Enterobacter spp. (20%, and Enterococcus spp. (20%. We also cultured coagulase-negative staphylococci in 40% (4/10 of the remaining patients. Micrococcus spp. and coagulase-negative staphylococci constituted the bacterial genuses more frequently isolated in the normal skin of patients with chiclero's ulcer and healthy individuals used as controls. We also undertook another study to find out the presence of S. pyogenes by an immunocolorimetric assay. This study indicated that 60% (9/15 of the ulcerated lesions, but not normal controls, were contaminated with S. pyogenes. Importantly, individuals with purulent secretion and holding concomitant infections with S. pyogenes, S. aureus, P. aeruginosa, M. morganii, and E. durans took longer to heal Leishmania (L. mexicana infections treated with antimonial drugs. Our results suggest the need to eliminate bacterial purulent infections, by antibiotic treatment, before starting antimonial administration to patients with chiclero's ulcer.

  14. Effect of germanium pre-amorphization on solid-phase epitaxial regrowth of antimony and arsenic ion-implanted silicon

    International Nuclear Information System (INIS)

    Shallow, low-resistive n+/p junction was investigated for sub 100-nm metal-oxide-semiconductor field-effect transistors (MOSFETs) using antimony and arsenic ion-implantation and low-temperature rapid thermal annealing-increased gate leakage current due to high-permittivity gate dielectric crystallization during high-temperature source and drain dopant activation imposes low temperature annealing for next generation devices. In contrast to arsenic implanted junctions, Sb-doped specimens showed shallower junction depth, lower sheet resistance and leakage current at low temperature processing (600 deg. C). In addition, Ge pre-amorphization prior to As-implant was used to fully amorphize Si for ideal solid-phase epitaxial regrowth. Pre-amorphized As-doped samples did not result in highly activated junctions at low temperature. Pre-amorphized Sb-doped junctions did not regrow in acceptable annealing time. The results indicated the superiority of antimony to arsenic as a dopant for ultra-shallow and low-resistive source and drain extensions. Arsenic will not be a proper candidate because of higher sheet resistance as a consequence of presence of inactive As-vacancy clusters and higher leakage current for devices that should be fabricated at low temperature with implementing of high-κ dielectric metal-electrode gate stack in next generation MOSFETs

  15. Sorption of Cs-137 and Co-60 in Natural Zeolites

    International Nuclear Information System (INIS)

    The sorption of Cs-137 and Co-60 in natural zeolites under different conditions was studied. The behaviour of samples of mineral and rock from different deposit of the country was obtained and the decontamination of radioactive waters containing both radionuclides was performed; as part of the research to determine its application in the treatment of radioactive wastes in the country

  16. A method for reducing the cesium-137 content in meat

    International Nuclear Information System (INIS)

    Reports a study of a method for reducing the amount of cesium-137 in meat from wild animals. The method is intended for use in the kitchen and is based on a combined leaching and mechanical process. (K.A.E.)

  17. Measurement of soil erosion from fallout of 137Cs

    International Nuclear Information System (INIS)

    Caesium-137, whose presence in the environment is almost totally attributable to atmospheric nuclear explosions, is strongly and stably adsorbed by soil colloids. Its depletion in eroded soils by comparison with accumulation in stable soils provides a means of estimating erosion rates over broad and various areas and lengthy periods of time. A calibration relationship for southeastern Australia is presented

  18. 46 CFR 56.97-1 - General (replaces 137).

    Science.gov (United States)

    2010-10-01

    ... to pressure tests of piping in lieu of 137 of ASME B31.1 (incorporated by reference; see 46 CFR 56.01... leak test prior to initial operations. Where a hydrostatic test is not practicable, a pneumatic test.... (1) At no time during the hydrostatic test may any part of the piping system be subjected to a...

  19. Model of Cs-137 redistribution by Lira objects territory

    International Nuclear Information System (INIS)

    In this work the approach of Cs-137 redistribution model on the Lira objects territory is proposed.The peculiarity of this approach is testing of results by the way of comparison with measured values of Lira objects territory contamination, assessment of integral radionuclide stocks in soil, and, lastly, radionuclides migration mechanisms both by a soil surface and a soil depth ward

  20. Elements of reflection on pathologies possibly induced by caesium 137

    International Nuclear Information System (INIS)

    The author discusses the content of few known publications on the possible pathological effects of caesium 137: a Belarus study on the consequences of Chernobyl, results of few autopsies performed on babies and adults, a study performed on rats, and a study performed on a set of 94 children in a sanatorium

  1. Cesium-137 Levels Detected in Otters from Austria

    Directory of Open Access Journals (Sweden)

    Gutleb A.C.

    1991-02-01

    Full Text Available Pollution seems to be one of the most important causes for the decline of the European otter (Lutra lutra. The accident in the Chernobyl nuclear power plant added another aspect to environmental pollution. Few data on cesium-137 contents in otters are available, so levels were measured in 3 otters from Austria. All levels found were very low.

  2. Cs-137 in soil erosion and siltation assessment in Romania

    International Nuclear Information System (INIS)

    The investigation was carried out in the frame of CRP 8819/RO contract between IAEA-Vienna and IFIN-HH. The investigated areas are located in the southern part of Romanian Moldavian Table Land. The areas are known as being the most eroded in Romania and soil preservation and erosion countermeasures were applied in this region. Antohesti reservoir from Berheci watershed is placed in an area with high relief energy. The lowest altitude, in front of the dam is 210 m and the highest altitude with 561 m is the top of Dorsan Hill. The specific activity of Cs-137 in two core samples of sediment from Antohesti reservoir were measured. In this area there are several discontinuous gullies in which the erosion of soil and subsequent sedimentation processes are very intense. The profile distribution of Cs-137 in sediment is presented. Several gully head agraded soil samples were taken and analyzed. The profile distribution of Cs-137 in aggraded soil of the gully heads, the presence of Cs-137 up to 200-250 cm due to fallout deposition from nuclear tests and the maxima corresponding to the years 1959, 1963 and 1986 are clearly highlighted. The mean aggradation rate is about 6 cm/year. (author)

  3. Cs-137 measurements for the people living near Chernobyl area

    International Nuclear Information System (INIS)

    In 1991, 5 years after the Chernobyl accident, Sasagawa memorial foundation began to support Japanese medical cooperation for 5 hospitals in 5 cities in Belarus and Ukraine Republics and Russian Federation. The medical support involved the thyroid check-up, hematological examination, Cs-137 measurement in the body and epidemiological and statistical analyses for above. This report concerns the third. Subjects were 0-5 years old children at the time of the accident and >150,000 subjects received the measurement. The apparatus for measurement was Aloka WBC 101 whole body counter of chair type equipped with NaI(Tl) (7.6 x 7.6 cm) scintillation detector. The spectrum was subjected to pulse height analysis to compute the Cs-137 quantity. Measurement was done on the abdominal region. The median value was found mostly less than 50 Bq/kg while that of Japanese is only several Bq/kg. However, the internal exposure dose estimated from the body content of Cs-137 in the people near Chernobyl area (0.97 mSv/life time for man even if whose Cs-137 content=1,000 Bq/kg) was concluded to be far smaller than the dose (2 mSv/y) due to natural radiation.(K.H.)

  4. Strontium-90 and cesium-137 in fresh water

    International Nuclear Information System (INIS)

    Japan Chemical Analysis Center has analysed the strontium-90 and Cesium-137 contents in fresh water from 7 prefectures in Japan by the commission of Science and Technology Agency of Japanese Government. The method described in ''Radioactivity Survey Data in Japan No. 43 (NIRS-RSD-43, 1977) was applied to the analysis of these two radionuclides in samples. (author)

  5. 137Cs in the fungal compartment of Swedish forest soils

    International Nuclear Information System (INIS)

    The 137Cs activities in soil profiles and in the mycelia of four ectomycorrhizal fungi were studied in a Swedish forest in an attempt to understand the mechanisms governing the transfer and retention of 137Cs in forest soil. The biomass of four species of fungi was determined and estimated to be 16 g m-2 in a peat soil and 47-189 g m-2 in non-peat soil to the depth of 10 cm. The vertical distribution was rather homogeneous for two species (Tylospora spp. and Piloderma fallax) and very superficial for Hydnellum peckii. Most of the 137Cs activity in mycelium of non-peat soils was found in the upper 5 cm. Transfer factors were quite high even for those species producing resupinate sporocarps. In the peat soil only approximately 0.3% of the total 137Cs inventory in soil was found in the fungal mycelium. The corresponding values for non-peat soil were 1.3, 1.8 and 1.9%

  6. Cesium-137 Levels Detected in Otters from Austria

    OpenAIRE

    Gutleb A.C.; Mraz, G.

    1991-01-01

    Pollution seems to be one of the most important causes for the decline of the European otter (Lutra lutra). The accident in the Chernobyl nuclear power plant added another aspect to environmental pollution. Few data on cesium-137 contents in otters are available, so levels were measured in 3 otters from Austria. All levels found were very low.

  7. The presence and leachability of antimony in different wastes and waste handling facilities in Norway.

    Science.gov (United States)

    Okkenhaug, G; Almås, Å R; Morin, N; Hale, S E; Arp, H P H

    2015-11-01

    The environmental behaviour of antimony (Sb) is gathering attention due to its increasingly extensive use in various products, particularly in plastics. Because of this it may be expected that plastic waste is an emission source for Sb in the environment. This study presents a comprehensive field investigation of Sb concentrations in diverse types of waste from waste handling facilities in Norway. The wastes included waste electrical and electronic equipment (WEEE), glass, vehicle fluff, combustibles, bottom ash, fly ash and digested sludge. The highest solid Sb concentrations were found in WEEE and vehicle plastic (from 1238 to 1715 mg kg(-1)) and vehicle fluff (from 34 to 4565 mg kg(-1)). The type of acid used to digest the diverse solid waste materials was also tested. It was found that HNO3:HCl extraction gave substantially lower, non-quantitative yields compared to HNO3:HF. The highest water-leachable concentration for wastes when mixed with water at a 1 : 10 ratio were observed for plastic (from 0.6 to 2.0 mg kg(-1)) and bottom ash (from 0.4 to 0.8 mg kg(-1)). For all of the considered waste fractions, Sb(v) was the dominant species in the leachates, even though Sb(iii) as Sb2O3 is mainly used in plastics and other products, indicating rapid oxidation in water. This study also presents for the first time a comparison of Sb concentrations in leachate at waste handling facilities using both active grab samples and DGT passive samples. Grab samples target the total suspended Sb, whereas DGT targets the sum of free- and other chemically labile species. The grab sample concentrations (from 0.5 to 50 μg L(-1)) were lower than the predicted no-effect concentration (PNEC) of 113 μg L(-1). The DGT concentrations were substantially lower (from 0.05 to 9.93 μg L(-1)) than the grab samples, indicating much of the Sb is present in a non-available colloidal form. In addition, air samples were taken from the chimney and areas within combustible waste incinerators, as

  8. Correlation models between environmental factors and bacterial resistance to antimony and copper.

    Directory of Open Access Journals (Sweden)

    Zunji Shi

    Full Text Available Antimony (Sb and copper (Cu are toxic heavy metals that are associated with a wide variety of minerals. Sb(III-oxidizing bacteria that convert the toxic Sb(III to the less toxic Sb(V are potentially useful for environmental Sb bioremediation. A total of 125 culturable Sb(III/Cu(II-resistant bacteria from 11 different types of mining soils were isolated. Four strains identified as Arthrobacter, Acinetobacter and Janibacter exhibited notably high minimum inhibitory concentrations (MICs for Sb(III (>10 mM,making them the most highly Sb(III-resistant bacteria to date. Thirty-six strains were able to oxidize Sb(III, including Pseudomonas-, Comamonas-, Acinetobacter-, Sphingopyxis-, Paracoccus- Aminobacter-, Arthrobacter-, Bacillus-, Janibacter- and Variovorax-like isolates. Canonical correspondence analysis (CCA revealed that the soil concentrations of Sb and Cu were the most obvious environmental factors affecting the culturable bacterial population structures. Stepwise linear regression was used to create two predictive models for the correlation between soil characteristics and the bacterial Sb(III or Cu(II resistance. The concentrations of Sb and Cu in the soil was the significant factors affecting the bacterial Sb(III resistance, whereas the concentrations of S and P in the soil greatly affected the bacterial Cu(II resistance. The two stepwise linear regression models that we derived are as follows: MIC(Sb(III=606.605+0.14533 x C(Sb+0.4128 x C(Cu and MIC((Cu(II=58.3844+0.02119 x C(S+0.00199 x CP [where the MIC(Sb(III and MIC(Cu(II represent the average bacterial MIC for the metal of each soil (μM, and the C(Sb, C(Cu, C(S and C(P represent concentrations for Sb, Cu, S and P (mg/kg in soil, respectively, p<0.01]. The stepwise linear regression models we developed suggest that metals as well as other soil physicochemical parameters can contribute to bacterial resistance to metals.

  9. Growth, photosynthesis, and defense mechanism of antimony (Sb)-contaminated Boehmeria nivea L.

    Science.gov (United States)

    Chai, Li-Yuan; Mubarak, Hussani; Yang, Zhi-Hui; Yong, Wang; Tang, Chong-Jian; Mirza, Nosheen

    2016-04-01

    Ramie (Boehmeria nivea L.) is the oldest cash fiber crop in China and is widely grown in antimony (Sb) mining areas. To evaluate the extent of Sb resistance and tolerance, the growth, tolerance index (TI), Sb content in plant parts and in Hoagland solution, bioaccumulation factor (BF), photosynthesis, and physiological changes in Sb-contaminated B. nivea (20, 40, 80, and 200 mg L(-1) Sb) grown hydroponically were investigated. The Sb tolerance and resistance of ramie were clearly revealed by growth inhibition, a TI between 13 and 99 %, non-significant changes in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (photosystem II (PSII)) and single-photon avalanche diode (SPAD) value, a significant increase in Sb in plant parts, BF >1, and an increase in catalase (CAT) and malondialdehyde (MDA) at 200 mg L(-1) Sb. Under increasing Sb stress, nearly the same non-significant decline in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (PSII), relative quantum yield of photosystem II (φPSII), and photochemical quenching (qP), except for F v /F m at 20 mg L(-1) Sb, were recorded. SPAD values for chlorophyll under Sb stress showed an increasing trend, except for a slight decrease, i.e., continuous increase in MDA, superoxide dismutase (SOD), peroxidase (POD), and CAT activities were suppressed under Sb addition up to 40 mg L(-1) Sb and the addition of Sb enhanced enzyme production at 80 and 200 mg L(-1) Sb. A continuous decrease in SOD, POD, and CAT up to 40 mg L(-1) Sb and enhancements at ≥80 mg L(-1), along with the continuous enhancement of MDA activity and inhibited biomass production, clearly reveal the roles of these enzymes in detoxifying Sb stress and the defense mechanism of ramie at 80 mg L(-1) Sb. Thus, B. nivea constitutes a promising candidate for Sb phytoremediation at mining sites. PMID:26711292

  10. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India)], E-mail: basudebk@cgcri.res.in

    2009-05-12

    A new K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3} (KBS) glass system having low phonon energy (about 600 cm{sup -1}) doped with Nd{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd{sub 2}O{sub 3}. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 9/2} and {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 13/2} transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 7/2}) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  11. Novel organo-colloidal synthesis, optical properties, and structural analysis of antimony sesquioxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Validzic, Ivana Lj., E-mail: validzic@vinca.rs; Abazovic, Nadica D.; Mitric, Miodrag [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Lalic, Milan V. [Universidade Federal de Sergipe, Departamento de Fisica (Brazil); Popovic, Zoran S. [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Vukajlovic, Filip R. [' Vinca' Institute of Nuclear Sciences (Serbia)

    2013-01-15

    We report the novel colloidal syntheses in organic media of antimony sesquioxide ( Sb{sub 2}O{sub 3} ) spherical nanoparticles (30-250 nm) and octahedron micro- and nanocrystals (100nm - 4{mu}) depending on the synthetic method conditions. It is observed that small differences in the synthetic procedure cause large differences in the very changeable morphology. The structure of Sb{sub 2}O{sub 3} powders was refined down to the R-factors of 9.57, 7.44, 9.19, 9.78, and 8.30 %. The refinement showed that Sb{sub 2}O{sub 3} powder belongs to the cubic crystal type with space group Fd 3-bar m (No. 227). The values of estimated standard deviations, as well as reliability factors, confirmed that the structure of Sb{sub 2}O{sub 3} was well refined. Ultraviolet and visible (UV-Vis) absorption spectroscopy and diffuse reflectance measurements (DRS) reveal that the optical band gap energies found for the Sb{sub 2}O{sub 3} octahedrons and nanoparticles, micro- and nanocrystals, respectively, are quite independent of the synthetic method conditions and synthesized morphology and is found to be between 4.1-4.4 eV. No peaks in both photoluminescence (PL) emission and excitation spectra have been observed for a broad spectral range, typical for this material. In order to discriminate between conflicting experimental results concerning the band gap energy of this compound, we investigated theoretically the electronic structure and optical properties of one of the cubic sesquioxide Sb{sub 2}O{sub 3} samples synthesized here. This has been done on the basis of density functional theory (DFT) with the generalized gradient approximation (GGA) and improved version of exchange potential suggested recently by Tran and Blaha (TB-mBJ). The main characteristic of the calculated TB-mBJ electronic structure is the significant improvement of the band gap value, which is in perfect agreement with our experimental measurements. The real and imaginary parts of the dielectric tensor are also

  12. Transport of 137Cs to the Southern Hemisphere in an ocean general circulation model

    Science.gov (United States)

    Tsumune, Daisuke; Aoyama, Michio; Hirose, Katsumi; Bryan, Frank O.; Lindsay, Keith; Danabasoglu, Gokhan

    2011-04-01

    137Cs originating from global fallout is transported into the ocean interior by advection and diffusion, and the 137Cs concentration is reduced by radioactive decay. 137Cs concentrations in the global ocean can be simulated by global integration of the coarse-resolution Parallel Ocean Program to understand the mechanism of material transport in the ocean. We investigated the transport mechanism of 137Cs to the Southern Hemisphere using an ocean general circulation model (OGCM) and compared the simulated results with observations of 137Cs concentrations in the Southern Hemisphere. 137Cs was deposited on the ocean surface mainly as global fallout originating from atmospheric nuclear weapons testing since 1945, and the global distribution of cumulative 137Cs deposition has been reconstructed from global measurements of 137Cs in rain, seawater, and soil. We estimated the global distribution of 137Cs deposition from 1945 to 2003 using these distribution data, 137Cs deposition data observed at the Meteorological Research Institute, Tsukuba, Japan, from 1958 to 2003, and 137Cs deposition data for 1945-1957 estimated from ice-core data. We compared the simulated results with 137Cs sections from the South Pacific, Indian, and South Atlantic Oceans obtained during the BEAGLE2003 cruise in 2003. The simulated 137Cs sections were in good agreement with the observations, except for the effects of mesoscale eddies, which not be simulated by the model because of its coarse resolution. OGCMs can simulate the general pattern of 137Cs distribution in the world’s oceans and improve our understanding of the transport mechanism leading to those 137Cs distributions on a time scale of several decades. The model simulation results suggest that the 137Cs deposited in the North Pacific advected to the South Pacific and Indian Ocean, and then to the South Atlantic over about four decades. The North Pacific is thus an important source area of 137Cs to the Southern Hemisphere.

  13. Real-world emission factors for antimony and other brake wear related trace elements: size-segregated values for light and heavy duty vehicles.

    Science.gov (United States)

    Bukowiecki, Nicolas; Lienemann, Peter; Hill, Matthias; Figi, Renato; Richard, Agnes; Furger, Markus; Rickers, Karen; Falkenberg, Gerald; Zhao, Yongjing; Cliff, Steven S; Prevot, Andre S H; Baltensperger, Urs; Buchmann, Brigitte; Gehrig, Robert

    2009-11-01

    Hourly trace element measurements were performed in an urban street canyon and next to an interurban freeway in Switzerland during more than one month each, deploying a rotating drum impactor (RDI) and subsequent sample analysis by synchrotron radiation X-ray fluorescence spectrometry (SR-XRF). Antimony and other brake wear associated elements were detected in three particle size ranges (2.5-10, 1-2.5, and 0.1-1 microm). The hourly measurements revealed that the effect of resuspended road dust has to be taken into account for the calculation of vehicle emission factors. Individual values for light and heavy duty vehicles were obtained for stop-and-go traffic in the urban street canyon. Mass based brake wear emissions were predominantly found in the coarse particle fraction. For antimony, determined emission factors were 11 +/- 7 and 86 +/- 42 microg km(-1) vehicle(-1) for light and heavy duty vehicles, respectively. Antimony emissions along the interurban freeway with free-flowing traffic were significantly lower. Relative patterns for brake wear related elements were very similar for both considered locations. Beside vehicle type specific brake wear emissions, road dust resuspension was found to be a dominant contributor of antimony in the street canyon. PMID:19924925

  14. 137Cs and 210Pb distribution in Manila Bay sediment

    International Nuclear Information System (INIS)

    Two radionuclides were measured in surface sediment samples taken from geographically distributed sections of Manila Bay, namely cesium-137 (137Cs) and lead-210 (210Pb). Results indicated a noticeable change in the radioactivity concentration levels in sediments collected in 2005 and 2010, with a median concentration of 1.0 and 2.64 Bq kg-1, respectively. Higher levels of 137Cs radioactivity were measured in the northern and inner portion of the bay adjacent to major river systems, agricultural and highly industrialized urban areas. 137Cs isotope increased in activity in most of the samples especially in the northwestern areas of Bataan and Pampanga with five times more than the activity from the first sampling measurements. Nevertheless, radioactivity concentrations observed in surface sediments along the bay are within the range of radioactivity in several areas monitored in the Northern Hemisphere. The country has been frequented by tropical cyclones and storms that have caused erosion, which may have introduced elevated material input in the bay. In addition, wind-driven circulation especially in the shallower areas of the bay is a possibility for the substantial sediment movement and accumulation along this coast. Conversely, areas with higher 137Cs have lower values of 210Pb. In an undisturbed environment, 210Pb deposition values are assumed nearly constant. Hence, changes in the radioactivity concentration levels of these radionuclides can be an indicator of pollution input from land-based sources, sediment movement and reworking in the coastal areas. At present, there is very limited information on the radioactivity level of various radioisotopes in Manila Bay.The data obtained are benchmark values against which changes that will be occurring in the bay can be assessed. (author)

  15. Contribution of Asian dust to atmospheric deposition of radioactive cesium (137Cs)

    International Nuclear Information System (INIS)

    Both Asian dust (kosa) transported from the East Asian continent and locally suspended dust near monitoring sites contribute to the observed atmospheric deposition of 137Cs in Japan. To estimate the relative contribution of these dust phenomena to the total 137Cs deposition, we monitored weekly deposition of mineral particles and 137Cs in spring. Deposition of 137Cs from a single Asian dust event was 62.3 mBq m-2 and accounted for 67% of the total 137Cs deposition during the entire monitoring period. Furthermore, we found high 137Cs specific activity in the Asian dust deposition sample. Although local dust events contributed to 137Cs deposition, their contribution was considerably smaller than that of Asian dust. We conclude that the primary source of atmospheric 137Cs in Japan is dust transported from the East Asian continent

  16. Distribution of 137Cs radionuclide in industrial wastes effluents of Gresik, East Java, Indonesia

    International Nuclear Information System (INIS)

    The distribution of anthropogenic radionuclides 137Cs was measured from industrial waste effluent of Gresik to Gresik Sea in east Java, Indonesia. The activity of 37Cs detected at all stations was much lower than in northeast Japan both before and after NPP Fukushima accident. This indicated that in Gresik industrials waste did not consist of 137Cs. The lowest activity 137Cs occurred at the station nearest to the industrial waste effluent that contained some particle ions that were able to scavenge 137Cs and then precipate this radionuclide. Furthermore, the greatest 137Cs occurred at the station that has high current speeds that stirred up sediment to release 137Cs in seawater as a secondary source. The lowest salinity did not effect on the activity of 137Cs even though the lowest salinity and activity 137Cs occurred at the same station. (author)

  17. Distribution of 137Cs Radionuclide in Industrial Wastes Effluents of Gresik, East Java, Indonesia

    Directory of Open Access Journals (Sweden)

    Muslim

    2015-04-01

    Full Text Available The distribution of anthropogenic radionuclides 137Cs was measured from industrial waste effluent of Gresik to Gresik Sea in east Java, Indonesia. The activity of 37Cs detected at all stations was much lower than in northeast Japan both before and after NPP Fukushima accident. This indicated that in Gresik industrials waste did not consist of 137Cs. The lowest activity 137Cs occurred at the station nearest to the industrial waste effluent that contained some particle ions that were able to scavenge 137Cs and then precipate this radionuclide. Furthermore, the greatest 137Cs occured at the station that has high current speeds that stirred up sediment to release 137Cs in seawater as a secondary source. The lowest salinity did not effect on the activity of 137Cs even though the lowest salinity and activity 137Cs occured at the same station

  18. Note on Two Types of Contamination of Human Beings by Caesium-137

    International Nuclear Information System (INIS)

    The authors present an elimination curve for a case of occupational contamination by caesium-137. They also show how the caesium-137 body burden varied during 1963 in a group of persons who did not undergo occupational exposure. (author)

  19. Synthesis and Properties of Light-tolerant Organic Antimony%耐光型有机锑的合成及其性能研究

    Institute of Scientific and Technical Information of China (English)

    高勇; 韩永和; 李建丰; 袁余斌; 王爱红

    2014-01-01

    硫醇锑稳定剂由于其耐紫外光性能很差,在存储、运输和使用方面受到很大的限制。为解决这一问题,试探性以三氯化锑和巯基酯为原料,引入抗紫外线活性基团TBP-1(2,4-二羟基二苯甲酮),合成了“晒不黑”的有机锑热稳定剂。用红外光谱对产品结构进行了确认,光敏性实验表明其7周内不变色;静态热稳定性实验结果表明其与硫醇锑热稳定剂相当。%Because of its poor ultraviolet resistance , the storage , transportation and use of antimony mercaptide stabilizer was greatly limited.In order to solve this problem , a kind of synthesized organic antimony thermal stabilizer was prepared, which was light -tolerant with antimony trichloride , isooctyl thioglycollat as raw materials and TBP -1(2,4-dihydroxybenzophenone ) , with an anti-ultraviolet agent added in.The light-tolerant performance and thermal stability of product tested showed that the color of organic antimony as -synthesized was unchangeable when under the impact of direct sunlight for 7 weeks by infrared spectroscopy spectrum that was confirmed for structure of product , and the static experimental results showed that the thermal stability was nearly equivalent to antimony mercaptide.

  20. Behaviour of 137Cs in the Boreal forest ecosystem of central Sweden

    International Nuclear Information System (INIS)

    Behaviour of Chernobyl fallout 137Cs in a coniferous forest ecosystem in central Sweden was investigated between 1990 and 1994. Results demonstrated that forest soil belongs to nutrient deficient type, and deposited fallout 137Cs from Chernobyl nuclear accident (CNA) was retained (85%) in the upper 5 cm of humic forest soil layer, with a venial migration deeper into soil profile. No correlation between forest soil exchangeable and total potassium (K+) and 137Cs transfer parameters was observed. However, addition of K+, found to efficiently reduce 137Cs uptake by sheep's fescue and the addition of stable caesium (133Cs+) enhanced it. The addition of ammonium (NH4+) was slightly stimulating the uptake of 137Cs by sheep's fescue in the first cut only. Field plants showed a considerably reduction in their 137Cs activity concentrations. Relative to their 137Cs levels of 1986-89, a little reduction in heather (16%) occurred eight years after CNA. In contrast the reductions in lingonberry and bilberry were 87% and 68%, respectively. Three fractions of forest soil bound 137Cs were observed due to sequential extraction procedure (SEP). The first, is easily extractable 137Cs fraction (F1+F2), it comprises 22% of total forest soil 137Cs inventory in the upper 5 cm layer. The second, is soil organically and biologically bound 137Cs (F3+F4) comprises about 30% of soil bound 137Cs. This fraction might be accounted for long-term soil available 137Cs for plant uptake after bio-degradation processes by soil microorganisms. The third, is the residual fraction (F5), it comprises more than 35% of total forest soil 137Cs inventory, and may be associated with soil components which are probably of organic nature. Sorption of 137Cs by zeolite (Mordenite) revealed that soil bound 137Cs is to some extent more mobile in forest soils with high OM% and low pH than those with low OM%. 99 refs

  1. Season flows of Cs-137 in sphagnous-peat cover of swamps: main reasons and consequences

    International Nuclear Information System (INIS)

    The vertical distribution of 137Cs specific activity in sphagnous-peat cover was analysed. It was shown that dependence of 137Cs specific activity with the depth approximated by exponential close connection (r 0,99). Analysis of seasonal 137Cs streams in sphagnous-peat cover showed that during the vegetative period ascending stream of 137Cs in sphagnous-peat thickness was observed in spite of descending stream of it during cold period of the year

  2. Geographic zones with increased migration of 137Cs from environment into food stuffs

    International Nuclear Information System (INIS)

    Increased 137Cs migration from the environment into the human organism through the biological lichen-deer-man chain in the arctic region is considered. Levels of 137Cs content in lichen and deer meat are presented. The degree of 137Cs migration in the wooded district on food stuffs of local production (milk, mushrooms, meat) is presented. The increased 137Cs content is found in food stuffs of animal and vegetable origin in the wooded district due to peculiarities of natural conditions

  3. 33 CFR 137.50 - Reviews of historical sources of information.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Reviews of historical sources of information. 137.50 Section 137.50 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Practices § 137.50 Reviews of historical sources of information. (a) Historical documents and records...

  4. Fractionation of caesium (137Cs) in coniferous forest soil in central Sweden

    International Nuclear Information System (INIS)

    Sequential extraction procedure (SEP) was applied for fractionation of Chernobyl fallout 137Cs bound onto soils of a coniferous forest ecosystem located in central Sweden. Results of sequentially extracted 137Cs fractions demonstrated that 8% (mean value) of the total deposited 137Cs was water soluble (F1) and 13% was NH4OAc extractable (F2). Oxidation of F2 residuals by H2O2 led to a release of 15% of soil-bound 137Cs (F3). Acid digestion of F3 residuals showed a possibility of releasing an extra amount of soil-bound 137Cs, 22% of the total soil 137Cs inventory (F4). These two fractions (F3 and F4) include strongly bound 137Cs that seems to require longer biodegradation processes by soil microflora and microfauna before becoming available for uptake by plants and fungi. More than 37% of the total soil 137Cs inventory was bound onto soil residuals in a non-extractable form that includes slowly degradable organic matter and other soil residual compartments. The distribution coefficient (Kd) was rather low and shows an inverse relation with the increase of percentage of soil organic matter, which indicates a week binding of 137Cs onto forest soil. In contrast, chemical fractionation of soil bound 137Cs showed a substantial fraction of 137Cs was strongly bound onto soil as organically bound 137Cs. Apparently, the binding processes of radiocaesium onto forest soil seems to be time dependent

  5. 46 CFR 108.137 - Bulkhead and deck separations of accommodation spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Bulkhead and deck separations of accommodation spaces. 108.137 Section 108.137 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Structural Fire Protection § 108.137 Bulkhead and deck separations...

  6. 42 CFR 137.206 - Why does the IHS need this information?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Why does the IHS need this information? 137.206 Section 137.206 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH... Status Reports § 137.206 Why does the IHS need this information? This information will be used to...

  7. 42 CFR 137.32 - Is a compact required to participate in self-governance?

    Science.gov (United States)

    2010-10-01

    ...-governance? 137.32 Section 137.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Self-Governance compact § 137.32 Is a compact required to participate in self-governance? Yes, Tribes must have...

  8. 46 CFR 180.137 - Stowage of life floats and buoyant apparatus.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Stowage of life floats and buoyant apparatus. 180.137 Section 180.137 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) LIFESAVING EQUIPMENT AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 180.137 Stowage of life floats...

  9. Regularity of the Cs 137 absorption by hydrolyzed lignin from water solution

    International Nuclear Information System (INIS)

    The kinetics and equilibrium of the Cs 137 sorption by hydrolyzed lignin have been studied. The optimal conditions of the hydrolyzed lignin using as a sorbent for the Cs 137 sorption have been defined. It has been shown that K-monoform of hydrolyzed lignin is a promising sorbent for Cs 137. (authors)

  10. 42 CFR 137.337 - What funding must the Secretary provide in a construction project agreement?

    Science.gov (United States)

    2010-10-01

    ... construction project agreement? 137.337 Section 137.337 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF...-GOVERNANCE Construction Project Assumption Process § 137.337 What funding must the Secretary provide in a construction project agreement? The Secretary must provide funding for a construction project agreement...

  11. 42 CFR 137.327 - May multiple projects be included in a single construction project agreement?

    Science.gov (United States)

    2010-10-01

    ... construction project agreement? 137.327 Section 137.327 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF...-GOVERNANCE Construction Project Assumption Process § 137.327 May multiple projects be included in a single construction project agreement? Yes, a Self-Governance Tribe may include multiple projects in a...

  12. 42 CFR 137.329 - What environmental considerations must be included in the construction project agreement?

    Science.gov (United States)

    2010-10-01

    ... in the construction project agreement? 137.329 Section 137.329 Public Health PUBLIC HEALTH SERVICE... SELF-GOVERNANCE Construction Project Assumption Process § 137.329 What environmental considerations must be included in the construction project agreement? The construction project agreement must...

  13. 42 CFR 137.42 - What Tribal shares may be included in a funding agreement?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What Tribal shares may be included in a funding agreement? 137.42 Section 137.42 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN... Agreements § 137.42 What Tribal shares may be included in a funding agreement? All Tribal shares...

  14. Development of cesium 137 plant uptake predicting model using geographical information systems

    International Nuclear Information System (INIS)

    Soil-plant system is a critical component of food chain in processes of Cs 137 migration. In this component it is possible to decrease greatly Cs 137 uptake in food chain. Development of Cs 137 migration model in soil-plant system enable to determine amount of Cs 137 in plant uptake and evaluate agricultural produce accordance with modern ecological requirements. Also this model can help with management of agricultural production. Geographical information systems (GIS) have a wide propagation in radioecology at present time. Models using GIS have several advantages: relative simplicity of evaluation, visualization of evaluated results etc. As a result, plots with possible Cs 137 uptake increasing could be easily discovered. Physical decay, Cs 137 sorption and fixation by soil, Cs 137 vertical migration in soil profile and plant uptake are the main components of the Cs 137 migration model in soil-plant system. Content of biologically available Cs 137 calculated taking into account all of these components. Using GIS with Cs 137 migration model in soil-plant system lets efficiently discover those factors that have major influence on Cs 137 plant uptake increasing. This model improves agricultural production on territories, which polluted by Cs 137

  15. Caesium 137 in humus horizons of middle mountain depressions soils (Central Altai)

    International Nuclear Information System (INIS)

    Soils of Kansk, Abay and Uymon depressions in Altai were studied. It was found that the level of cesium 137 specific activity in humus horizons of depression soils considerably varies. The maximal values of cesium 137 activity are characteristic for top humus horizons. The levels of soil contamination by cesium 137 in mid depressions are harmless for stable functioning of living organisms

  16. 46 CFR 201.137 - Rights of parties as to presentation of evidence.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Rights of parties as to presentation of evidence. 201.137 Section 201.137 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Evidence (Rule 14) § 201.137 Rights of parties as...

  17. Long-term distribution of Cs-137 in freshwater ecosystem and the effect of bioturbation on leakage of Cs-137 from the sediments

    International Nuclear Information System (INIS)

    The first aim of the project was to make a literature compilation regarding Cs-137 in freshwater systems. Secondly, in order to follow up the long-term behaviour of Cs-137 in Lake Hillesjoen, sediment and water was sampled with respect to Cs-137. Finally, an experiment was done with chironomids, with the aim to assess the impact of bioturbation on the leakage of Cs-137 from the sediment, since this is one of the factors contributing to the uncertainties in radioecological models. Some aspects of long-term distribution of Cs-137 in freshwater lakes is discussed. In lake Hillesjoen the pool of Cs-137 in sediments (225 kBq/m2, 1993) has gradually increased since the Chernobyl accident, and now exceeds the initial deposition (100 kBq/m2). The effect of bioturbation on the leakage from the sediment to the water could not be clarified in this experiment, but is discussed. 40 refs

  18. Bioremoval of Am-241 and Cs-137 from liquid radioactive wasters by bacterial consortiums; Biorremocao de Am-241 e Cs-137 de rejeitos radioativos liquidos por consorcios bacterianos

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Rafael Vicente de Padua; Lima, Josenilson B. de; Gomes, Mirella C.; Borba, Tania R.; Bellini, Maria Helena; Marumo, Julio Takehiro; Sakata, Solange Kazumi, E-mail: rpadua@ipen.b, E-mail: sksakata@ipen.b, E-mail: jblima@ipen.b, E-mail: mbmarumo@ipen.b, E-mail: jtmarumo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-10-26

    This paper evaluates the capacity of two bacterial consortiums of impacted areas in removing the Am-241 and Cs-137 from liquid radioactive wastes.The experiments indicated that the two study consortiums were able to remove 100% of the Cs-137 and Am-241 presents in the waste from 4 days of contact. These results suggest that the bio removal with the selected consortiums, can be a viable technique for the treatment of radioactive wastes containing Am-241 and Cs-137

  19. Strontium-90 and cesium-137 in raw milk

    International Nuclear Information System (INIS)

    Under the commission of Science and Technology Agency, prefectural public health laboratories and institutes and Japan Chemical Analysis Center have measured the levels of 90Sr and 137Cs in milk samples. Sampling was done as follows: 4 times of raw milk samples a year in 10 prefectures for the report to WHO, 2 times of raw milk samples a year in 4 prefectures; and 2 times of city milk samples a year in 29 prefectures. Three litters of fresh milk were collected and carbonated in the prefectural public health laboratories and institutes of each prefecture, and the carbonated samples were collected at Japan Chemical Analysis Center. At Japan Chemical Analysis Center, these collected samples were radiochemically analysed for 90Sr and 137Cs using the method applied for the analysis of the radionuclides contents in total diet materials. (author)

  20. Bioaccumulation of Cs-137 and Co-57 by marine phytoplankton

    Energy Technology Data Exchange (ETDEWEB)

    Heldal, H.E. [Inst. of Marine Research, Bergen (Norway); Stupakoff, I.; Fisher, N.S. [State Univ. of New York, Marine Sciences Research Center, Stone Brook, NY (United States)

    1999-11-01

    Under controlled laboratory conditions we have examined the bioaccumulation of Cs-137 and Co-57 in three prymnesiophytes, the coccolithophorid Emiliania huxleyi and the non-calcareous species Isochrysis galbana and Phaeocystis globosa, and two diatoms Skeletonema costatum and Thalassiosira pseudonana. We measured uptake in growing and non-growing cells, and determined concentration factors on both volume and dry weight basis. For Co-57 uptake in non-growing cells, volume concentration factors (VCF) at equilibrium ranged from 0.2{sup *}10{sup 3} for Emiliana huxleyi to 4{sup *}10{sup 3} for the diatom Thalassiosira pseudonana. For Cs-137 uptake in non-growing cells the VCFs were close to zero. The results suggest that, in contrast to Co, the cycling and bioaccumulation in animals of Cs in marine systems is unlikely to be affected by primary producers. (au)