WorldWideScience

Sample records for antimony 123 target

  1. Antimony

    Science.gov (United States)

    Seal, Robert R.; Schulz, Klaus J.; DeYoung,, John H.; Sutphin, David M.; Drew, Lawrence J.; Carlin, James F.; Berger, Byron R.; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.

    2017-12-19

    Antimony is an important mineral commodity used widely in modern industrialized societies. The element imparts strength, hardness, and corrosion resistance to alloys that are used in many areas of industry, including in lead-acid storage batteries. Antimony’s leading use is as a fire retardant in safety equipment and in household goods, such as mattresses. The U.S. Government has considered antimony to be a critical mineral mainly because of its use in military applications. The great majority of the world’s antimony comes from China, and much of the remainder is shipped to China for smelting. Antimony resources are unevenly distributed around the world. China has the bulk of the world’s identified resources; other countries that have identified antimony resources include Bolivia, Canada, Mexico, Russia, South Africa, Tajikistan, and Turkey. Resources in the United States are located mainly in Alaska, Idaho, Montana, and Nevada. The most significant antimony mineral deposits occur in geologic environments with a thick sequence of siliciclastic sedimentary rocks in areas with significant fault and fracture systems. The most common antimony ore mineral is stibnite (Sb2 S3 ), but more than 100 other minerals also contain antimony. The presence of antimony in surface waters and groundwaters results primarily from rock weathering, soil runoff, and anthropogenic sources. Global emissions of antimony to the atmosphere average 6,100 metric tons per year. Empirical data suggest that the acid-generating potential of antimony mine waste is low.

  2. I sup(123) target transfer system

    International Nuclear Information System (INIS)

    Almeida, G.L. de; Rautenberg, F.A.

    1986-01-01

    The construction of target transfer system using a robot into hot cell of IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. The system operation is described, and the advantages are shown. (M.C.K.)

  3. Production and separation of no-carrier-added 123I produced by heavy ion irradiation of antimony oxides

    International Nuclear Information System (INIS)

    Maji, Samir; Lahiri, Susanta

    2006-01-01

    The radioisotope 123 I (T 1/2 = 13.2h) plays important roles in diagnostic nuclear medicine, especially in Single Photon Emission Tomography (SPET). The special affinity of 123 I for the thyroid makes it most useful for imaging and treatment of this gland. 123 I possesses distinct advantages over existing iodine isotopes, permitting high resolution imaging whilst delivering a low integrated radiation dose. There are several routes for the production of 123 I. However, up until now, no report has been found on production of radioiodine by heavy ion reactions. In the present paper we report 7 Li induced production of 123 I and its subsequent separation from Sb 2 O 3 target matrix

  4. Target holders and cooling system for I sup(123) production

    International Nuclear Information System (INIS)

    Almeida, G.L. de; Erbe, D.

    1986-01-01

    The constructions of target holder and cooling system for sup(123)I production in the IEN cyclotron (Brazilian-CNEN) is presented. The system was arranged, constructed and tested by Karlsruhe Dieter Erbe Nuclear Research Center. (author)

  5. Gas-target method for the production of iodine-123

    International Nuclear Information System (INIS)

    Robertson, R.; Stuart, D.C.

    1986-01-01

    The object of this invention is to provide a means of producing iodine-123 in high yield and purity via a small accelerator. The process uses protons of about 30 MeV incident upon a target of isotopically-enriched xenon-124 gas. The product obtained has a useful life after preparation of at least 85 hours

  6. Potent naphthoquinones against antimony-sensitive and -resistant Leishmania parasites: synthesis of novel α- and nor-α-lapachone-based 1,2,3-triazoles by copper-catalyzed azide-alkyne cycloaddition.

    Science.gov (United States)

    Guimarães, Tiago T; Pinto, Maria do Carmo F R; Lanza, Juliane S; Melo, Maria N; do Monte-Neto, Rubens L; de Melo, Isadora M M; Diogo, Emilay B T; Ferreira, Vitor F; Camara, Celso A; Valença, Wagner O; de Oliveira, Ronaldo N; Frézard, Frédéric; da Silva, Eufrânio N

    2013-05-01

    Continuing our screening program for novel anti-parasite compounds, we synthesized seven 1,4-naphthoquinones coupled to 1,2,3-triazoles, five nor-β-lapachone-based 1,2,3-triazoles and ten α-lapachone-based 1,2,3-triazoles. These and other naphthoquinonoid compounds were evaluated for their activity against promastigote forms of antimony-sensitive and -resistant strains of Leishmania infantum (syn. Leishmania chagasi) and Leishmania amazonensis. The toxicity of these compounds to mammalian cells was also examined. The substances were more potent than an antimonial drug, with IC50 values ranging from 1.0 to 50.7 μM. Nor-α-lapachone derivatives showed the highest antileishmanial activity, with selectivity indices in the range of 10-15. These compounds emerged as important leads for further investigation as antileishmanial agents. Additionally, one of these compounds exhibited cross-resistance in Sb-resistant Leishmania and could provide a molecular tool for investigating the multidrug resistance mechanisms in Leishmania parasites. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  7. Simulation for separation of radioisotopes I-123 from tellurium target using tracer I-131

    International Nuclear Information System (INIS)

    Sarwono, Daya Agung; Amiruddin, Cahyana; Abidin; Lubis, Hotman

    2013-01-01

    Radioisotope Iodine-123 ( 123 I) can be used as material for the preparation of radiopharmaceutical imaging with SPECT tool. This is caused to 123 I emits gamma rays with energies 159 keV and a half-life 13.2 h. 123 I radioisotope was made from the target material in the form of a thin layer of solid tellurium targets with the reaction 123 Te (p, n) 123 I in energy protons 8-15 MeV or 124 Te (p, 2n) 123 I in the 20-26 MeV proton energy using the cyclotron. The use of I-131 tracer to simulate the separation of I-123 radioisotope from the tellurium target because BATAN Cyclotron CS-30 have not produce current yet so it can not generate a radioisotope I-123. Simulation of I-123 radioisotope separation from the tellurium target using tracer I-131 can be performed by irradiating solid tellurium targets in the reactor. Separation is conducted by dissolving Te targets in the target puck into the dissolution vessel with CrO 3 and H 2 SO 4 then insert to the distillation flask. Furthermore, tellurium irradiated in the reactor as a tracer was added to the distillation flask to be dissolved along with tellurium the results of electroplating. Before distilled done first iodate is reduced with oxalic acid to produce iodine. Iodine was formed, then carried distillation and distillate containing I accommodated with an alkaline solution containing sulfite Based on the results of separation experiments three times the yield were obtained with respectively 12.85%, 13.9% and 5.2% with 1-131 radio nuclide purity of 100%. (author)

  8. Antimony: a flame fighter

    Science.gov (United States)

    Wintzer, Niki E.; Guberman, David E.

    2015-01-01

    Antimony is a brittle, silvery-white semimetal that conducts heat poorly. The chemical compound antimony trioxide (Sb2O3) is widely used in plastics, rubbers, paints, and textiles, including industrial safety suits and some children’s clothing, to make them resistant to the spread of flames. Also, sodium antimonate (NaSbO3) is used during manufacturing of high-quality glass, which is found in cellular phones.

  9. Feeding and purge systems of coolant primary circuit and coolant secondary circuit control of the I sup(123) target

    International Nuclear Information System (INIS)

    Almeida, G.L. de.

    1986-01-01

    The Radiation Protection Service of IEN (Brazilian-CNEN) detected three faults in sup(123)I target cooling system during operation process for producing sup(123)I: a) non hermetic vessel containing contaminated water from primary coolant circuit; possibility of increasing radioactivity in the vessel due to accumulation of contaminators in cooling water and; situation in region used for personnels to arrange and adjust equipments in nuclear physics area, to carried out maintenance of cyclotron and target coupling in irradiation room. The primary circuit was changed by secondary circuit for target coolant circulating through coil of tank, which receive weater from secondary circuit. This solution solved the three problems simultaneously. (M.C.K.)

  10. Excitation functions for alpha-particle-induced reactions with natural antimony

    Energy Technology Data Exchange (ETDEWEB)

    Singh, N. L.; Shah, D. J.; Mukherjee, S.; Chintalapudi, S. N. [Vadodara, M. S. Univ. of Baroda (India). Fac. of Science. Dept. of Physics

    1997-07-01

    Stacked-foil activation technique and {gamma} - rays spectroscopy were used for the determination of the excitation functions of the {sup 121}Sb [({alpha}, n); ({alpha}, 2n); ({alpha},4 n); ({alpha}, p3n); ({alpha}, {alpha}n)]; and Sb [({alpha}, 3n); ({alpha}, 4n); ({alpha}, {alpha}3n)] reactions. The excitation functions for the production of {sup 124}I, {sup 123}I, {sup 121}I, {sup 121}Te and {sup 120}Sb were reported up to 50 MeV. The reactions {sup 121} Sb ({alpha}, {alpha}n) + {sup 123} Sb ({alpha}, {alpha}3n) are measured for the first time. Since natural antimony used as the target has two odd mass stable isotopes of abundances 57.3 % ({sup 121}Sb), their activation in some cases gives the same product nucleus through different reaction channels but with very different Q-values. In such cases, the individual reaction cross-sections are separated with the help of theoretical cross-sections. The experimental cross-sections were compared with the predictions based on hybrid model of Blann. The high-energy part of the excitation functions are dominated by the pre-equilibrium reaction mechanism and the initial exciton number n{sub 0} = 4 (4 p 0 h) gives fairly good agreement with presently measured results.

  11. Biotin-targeted Pluronic(®) P123/F127 mixed micelles delivering niclosamide: A repositioning strategy to treat drug-resistant lung cancer cells.

    Science.gov (United States)

    Russo, Annapina; Pellosi, Diogo Silva; Pagliara, Valentina; Milone, Maria Rita; Pucci, Biagio; Caetano, Wilker; Hioka, Noboru; Budillon, Alfredo; Ungaro, Francesca; Russo, Giulia; Quaglia, Fabiana

    2016-09-10

    With the aim to develop alternative therapeutic tools for the treatment of resistant cancers, here we propose targeted Pluronic(®) P123/F127 mixed micelles (PMM) delivering niclosamide (NCL) as a repositioning strategy to treat multidrug resistant non-small lung cancer cell lines. To build multifunctional PMM for targeting and imaging, Pluronic(®) F127 was conjugated with biotin, while Pluronic(®) P123 was fluorescently tagged with rhodamine B, in both cases at one of the two hydroxyl end groups. This design intended to avoid any interference of rhodamine B on biotin exposition on PMM surface, which is a key fundamental for cell trafficking studies. Biotin-decorated PMM were internalized more efficiently than non-targeted PMM in A549 lung cancer cells, while very low internalization was found in NHI3T3 normal fibroblasts. Biotin-decorated PMM entrapped NCL with good efficiency, displayed sustained drug release in protein-rich media and improved cytotoxicity in A549 cells as compared to free NCL (Pbiotin-decorated PMM carrying NCL at low doses demonstrated a significantly higher cytotoxicity than free NCL in CPr-A549. These results point at NCL-based regimen with targeted PMM as a possible second-line chemotherapy for lung cancer showing cisplatin or multidrug resistance. Copyright © 2016 Elsevier B.V. All rights reserved.

  12. Excitation functions of 3He- and α-particle induced nuclear reactions on natSb for production of medically relevant 123I and 124I radioisotopes

    International Nuclear Information System (INIS)

    Tarkanyi, F.; Takacs, S.; Kiraly, B.; Szelecsenyi, F.; Ando, L.; Bergman, J.; Heselius, S.-J.; Solin, O.; Hermanne, A.; Shubin, Yu.N.; Ignatyuk, A.V.

    2009-01-01

    Excitation functions were measured using the stacked foil irradiation technique from threshold energies to 28 MeV for 3 He- and to 21 MeV for α-particle induced nuclear reactions on natural antimony leading to the formation of 121,123,124 I radioisotopes. The measured excitation functions were compared with the contradicting results of the earlier investigations found in the literature and with the curves predicted by the ALICE-IPPE and EMPIRE-II codes. Integral yields were also calculated and compared with the experimental thick target yields reported in the literature.

  13. Mineral resource of the month: antimony

    Science.gov (United States)

    ,

    2008-01-01

    The article describes the characteristics and industrial uses of antimony. Antimony, which is produced as a byproduct of mining other metals such as gold, lead or silver, is used in everything from flame retardants, batteries, ceramics and glass. It is also used in glass for television picture tubes, computer monitors, pigments and catalysts.

  14. Heteronuclear compounds of arsenic and antimony

    Science.gov (United States)

    Mauser, James E.

    1982-09-01

    Volatilization of secondary metals such as arsenic, antimony, and bismuth, during the smelting of copper ores, is important because of environmental and resource considerations. The Bureau of Mines, United States Department of the Interior, has been studying copper concentrate roasting in conjunction with the volatility of these minor constituents. Some unusual vaporization behavior initiated this supplemental paper which shows that when the mixed sulfides of arsenic and antimony are heated, the volatilization of arsenic is retarded and the volatilization of antimony increased. Mixed oxides of arsenic and antimony also exhibit exceptional volatilization behavior. These anomalous vaporization behaviors are attributed to the formation of heteronuclear compounds of arsenic and antimony, but the colligative properties of solutions may also be a factor.

  15. Surface complexation of antimony on kaolinite.

    Science.gov (United States)

    Rakshit, Sudipta; Sarkar, Dibyendu; Datta, Rupali

    2015-01-01

    Geochemical fate of antimony (Sb) - a similar oxyanion as arsenic (As) - in a variety of environment is largely unexplored. Kaolinite is an important, naturally occurring clay mineral in soils and aquifers and is known to control the fate of several contaminants via a multitude of geochemical processes, primarily adsorption. Here we report adsorption of antimony on kaolinite as a function of solution chemistry: initial antimony concentration, pH, ionic strength, and a competing anion. A surface complexation modeling (SCM) approach was undertaken to understand the potential mechanistic implications of sorption envelope data. In the SCM, a multicomponent additive approach, in which kaolinite is assumed to be a (1:1) mixture of quartz (≡SiOH) and gibbsite (≡AlOH), was tested. Results indicated that ionic strength has a minimal effect on antimony adsorption. For the lower initial antimony concentration (4.11 μM), the additive model with binuclear surface complexes on quartz and gibbsite showed a better fit at pH3.5. However, the additive model with binuclear surface complex on quartz and mononuclear surface complex on gibbsite showed an excellent fit of the data. Phosphate greatly influenced antimony adsorption on kaolinite at both low and high antimony loadings, indicating competition for available surface sites. Copyright © 2014 Elsevier Ltd. All rights reserved.

  16. Investigation into the reduction of antimony

    International Nuclear Information System (INIS)

    Hornibrook, C.

    1996-01-01

    This paper describes a program being implemented to decrease the antimony being released in waste water from the processing of liquid low-level radioactive wastes. The process being studied is the use of a crossflow membrane filter to remove antimony, and possibly cobalt 58. The process will evaluate the efficiency gains available from changing the oxidation states of the antimony with respect to the removal efficiency. Ion absorbers and ion exchange media will also be evaluated. The equipment is to be first tested on waste water from the November outage of Oconee, and then to use it on other radwaste processing studies

  17. FIRST REPORT ON OTOTOXICITY OF MEGLUMINE ANTIMONIATE

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Valete-Rosalino

    2014-09-01

    Full Text Available Introduction: Pentavalent antimonials are the first drug of choice in the treatment of tegumentary leishmaniasis. Data on ototoxicity related with such drugs is scarcely available in literature, leading us to develop a study on cochleovestibular functions. Case Report: A case of a tegumentary leishmaniasis patient, a 78-year-old man who presented a substantial increase in auditory threshold with tinnitus and severe rotatory dizziness during the treatment with meglumine antimoniate, is reported. These symptoms worsened in two weeks after treatment was interrupted. Conclusion: Dizziness and tinnitus had already been related to meglumine antimoniate. However, this is the first well documented case of cochlear-vestibular toxicity related to meglumine antimoniate.

  18. Sorption of antimony on human teeth

    International Nuclear Information System (INIS)

    Nofal, M.; Amin, H.; Alian, G.

    1997-01-01

    The study of the uptake of toxic elements on human teeth represents an interesting research area, as the fate of these elements when present in the human food is of health significance. Since antimony is one of the common toxic elements and since, the chemical behaviour of antimony is similar to that of arsenic, one of the most important toxic elements commonly encountered in cases of food poisoning, it has been decided to investigate its uptake on human teeth and on other restoration materials. The radioactive tracer technique was used to evaluate the concentration of antimony sorbed on teeth. This tracer was obtained by irradiation of antimony metal in the reactor, subsequent dissolution in concentrated sulphuric acid, evaporation to dryness and making the solution 6 M in Hydrochloric acid (1). Antimony prepared in this way is in the trivalent state (Sb III). Sorption was studied in water, tea, coffee, red tea and chicken soup. The highest sorption was achieved from water and chicken soup and least sorption was noticed in case of coffee. The results are presented in the form of the depletion of the radioactivity (A) of antimony with time in presence of a tooth in water and other drinks

  19. Redirecting Specificity of T cells Using the Sleeping Beauty System to Express Chimeric Antigen Receptors by Mix-and-Matching of VL and VH Domains Targeting CD123+ Tumors.

    Directory of Open Access Journals (Sweden)

    Radhika Thokala

    Full Text Available Adoptive immunotherapy infusing T cells with engineered specificity for CD19 expressed on B- cell malignancies is generating enthusiasm to extend this approach to other hematological malignancies, such as acute myelogenous leukemia (AML. CD123, or interleukin 3 receptor alpha, is overexpressed on most AML and some lymphoid malignancies, such as acute lymphocytic leukemia (ALL, and has been an effective target for T cells expressing chimeric antigen receptors (CARs. The prototypical CAR encodes a VH and VL from one monoclonal antibody (mAb, coupled to a transmembrane domain and one or more cytoplasmic signaling domains. Previous studies showed that treatment of an experimental AML model with CD123-specific CAR T cells was therapeutic, but at the cost of impaired myelopoiesis, highlighting the need for systems to define the antigen threshold for CAR recognition. Here, we show that CARs can be engineered using VH and VL chains derived from different CD123-specific mAbs to generate a panel of CAR+ T cells. While all CARs exhibited specificity to CD123, one VH and VL combination had reduced lysis of normal hematopoietic stem cells. This CAR's in vivo anti-tumor activity was similar whether signaling occurred via chimeric CD28 or CD137, prolonging survival in both AML and ALL models. Co-expression of inducible caspase 9 eliminated CAR+ T cells. These data help support the use of CD123-specific CARs for treatment of CD123+ hematologic malignancies.

  20. Transition from Target to Gaze Coding in Primate Frontal Eye Field during Memory Delay and Memory–Motor Transformation123

    Science.gov (United States)

    Sajad, Amirsaman; Sadeh, Morteza; Yan, Xiaogang; Wang, Hongying

    2016-01-01

    Abstract The frontal eye fields (FEFs) participate in both working memory and sensorimotor transformations for saccades, but their role in integrating these functions through time remains unclear. Here, we tracked FEF spatial codes through time using a novel analytic method applied to the classic memory-delay saccade task. Three-dimensional recordings of head-unrestrained gaze shifts were made in two monkeys trained to make gaze shifts toward briefly flashed targets after a variable delay (450-1500 ms). A preliminary analysis of visual and motor response fields in 74 FEF neurons eliminated most potential models for spatial coding at the neuron population level, as in our previous study (Sajad et al., 2015). We then focused on the spatiotemporal transition from an eye-centered target code (T; preferred in the visual response) to an eye-centered intended gaze position code (G; preferred in the movement response) during the memory delay interval. We treated neural population codes as a continuous spatiotemporal variable by dividing the space spanning T and G into intermediate T–G models and dividing the task into discrete steps through time. We found that FEF delay activity, especially in visuomovement cells, progressively transitions from T through intermediate T–G codes that approach, but do not reach, G. This was followed by a final discrete transition from these intermediate T–G delay codes to a “pure” G code in movement cells without delay activity. These results demonstrate that FEF activity undergoes a series of sensory–memory–motor transformations, including a dynamically evolving spatial memory signal and an imperfect memory-to-motor transformation. PMID:27092335

  1. Chlorination of antimony and its volatilization treatment of waste antimony-uranium composite oxide catalyst

    International Nuclear Information System (INIS)

    Sawada, K.; Enokida, Y.

    2011-01-01

    For the waste antimony-uranium composite oxide catalyst, the chlorination of antimony and its volatilization treatment were proposed, and evaluated using hydrogen chloride gas at 873-1173 K. During the treatment, the weight loss of the composite oxide sample, which resulted from the volatilization of antimony, was confirmed. An X-ray diffraction analysis showed that uranium oxide, U 3 O 8 , was formed during the reaction. After the treatment at 1173 K for 1 h, almost all the uranium contained in the waste catalyst was dissolved by a 3 M nitric acid solution at 353 K within 10 min, although that of the non-treated catalyst was less than 0.1%. It was found that the chlorination and volatilization treatment was effective to separate antimony from the composite oxide catalyst and change uranium into its removable form. (orig.)

  2. Microbial antimony biogeochemistry: Enzymes, regulation, and related metabolic pathways

    Science.gov (United States)

    Li, Jingxin; Qian Wang,; Oremland, Ronald S.; Kulp, Thomas R.; Rensing, Christopher; Wang, Gejiao

    2016-01-01

    Antimony (Sb) is a toxic metalloid that occurs widely at trace concentrations in soil, aquatic systems, and the atmosphere. Nowadays, with the development of its new industrial applications and the corresponding expansion of antimony mining activities, the phenomenon of antimony pollution has become an increasingly serious concern. In recent years, research interest in Sb has been growing and reflects a fundamental scientific concern regarding Sb in the environment. In this review, we summarize the recent research on bacterial antimony transformations, especially those regarding antimony uptake, efflux, antimonite oxidation, and antimonate reduction. We conclude that our current understanding of antimony biochemistry and biogeochemistry is roughly equivalent to where that of arsenic was some 20 years ago. This portends the possibility of future discoveries with regard to the ability of microorganisms to conserve energy for their growth from antimony redox reactions and the isolation of new species of “antimonotrophs.”

  3. Identification of Potential Biomarkers for Antimony Susceptibility ...

    Indian Academy of Sciences (India)

    Probing natural antimony resistance using customised DNA microarrays with oligos of all ABC transporters · Slide 38 · Comparative proteomics to reveal changes in drug resistant parasites · isobaric tags for relative and absolute quantification (iTRAQ®) allows global analyses of protein expression and quantitative ...

  4. Identification of Potential Biomarkers for Antimony Susceptibility ...

    Indian Academy of Sciences (India)

    Identification of Potential Biomarkers for Antimony Susceptibility/Resistance in L. donovani Rentala Madhubala School of Life Sciences Jawaharlal Nehru ... tags for relative and absolute quantification (iTRAQ®) allows global analyses of protein expression and quantitative comparison among samples by mass spectrometry.

  5. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta Etel Treiger; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Lab. de Biologia Molecular]. E-mail: samanta@usp.br; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo (IMT-SP), SP (Brazil). Lab. de Protozoologia]. E-mail:hfandrad@usp.br

    2005-10-15

    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes {sup 122} Sb and {sup 124} Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  6. Speciation analysis of antimony in marine biota by HPLC-(UV)-HG-AFS: Extraction procedures and stability of antimony species.

    Science.gov (United States)

    De Gregori, Ida; Quiroz, Waldo; Pinochet, Hugo; Pannier, Florence; Potin-Gautier, Martine

    2007-09-30

    Speciation analysis of antimony in marine biota is not well documented, and no specific extraction procedure of antimony species from algae and mollusk samples can be found in the literature. This work presents a suitable methodology for the speciation of antimony in marine biota (algae and mollusk samples). The extraction efficiency of total antimony and the stability of Sb(III), Sb(V) and trimethylantimony(V) in different extraction media (water at 25 and 90 degrees C, methanol, EDTA and citric acid) were evaluated by analyzing the algae Macrosystis integrifolia (0.55+/-0.04mugSbg(-1)) and the mollusk Mytilus edulis (0.23+/-0.01mugSbg(-1)). The speciation analysis was performed by anion exchange liquid chromatography (post-column photo-oxidation) and hydride generation atomic fluorescence spectrometry as detection system (HPLC-(UV)-HG-AFS). Results demonstrated that, based on the extraction yield and the stability, EDTA proved to be the best extracting solution for the speciation analysis of antimony in these matrices. The selected procedure was applied to antimony speciation in different algae samples collected from the Chilean coast. Only the inorganic Sb(V) and Sb(III) species were detected in the extracts. In all analyzed algae the sum of total antimony extracted (determined in the extracts after digestion) and the antimony present in the residue was in good agreement with the total antimony concentration determined by HG-AFS. However, in some extracts the sum of antimony species detected was lower than the total extracted, revealing the presence of unknown antimony species, possibly retained on the column or not detected by HPLC-(UV)-HG-AFS. Further work must be carried out to elucidate the identity of these unknown species of antimony.

  7. The presence of antimony in various dental filling materials

    International Nuclear Information System (INIS)

    Molokhia, Anat; Combe, E.C.; Lilley, J.D.

    1985-01-01

    Antimony was determined in a number of non-metallic dental materials currently used for tooth restoration. The method applied was instrumental neutron activation analysis. The concentration of antimony in some of the brands tested was found to be as high as 900 fold that in the normal hard dental tissues. (author)

  8. The exposure to and health effects of antimony

    DEFF Research Database (Denmark)

    Cooper, Ross G.; Harrison, Adrian Paul

    2009-01-01

    of the eyes, skin, and lungs. Long-term inhalation of antimony can potentiate pneumoconiosis, altered electrocardiograms, stomach pain, diarrhea, vomiting, and stomach ulcers, results which were confirmed in laboratory animals. Although there were investigations of the effect of antimony in sudden infant...

  9. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta E.T.; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mails: samanta@usp.br; nnascime@ipen.br; Andrade Junior, Heitor F. de [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular; Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil); E-mail: hfandrad@usp.br; Osso Junior, Joao A. [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Centro de Radiofarmacia]. E-mail: jaosso@ipen.br

    2007-07-01

    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb{sup +5}) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes {sup 122}Sb and {sup 124}Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony

  10. New approach for in vivo detection of insulitis in type I diabetes: activated lymphocyte targeting with 123I-labelled interleukin 2

    International Nuclear Information System (INIS)

    Signore, S.; Chianelli, M.; Ferretti, E.; Toscano, A.; Britton, K.E.; Andreani, D.; Gale, E.A.M.; Pozzilli, P.

    1994-01-01

    Insulitis is considered the histopathological hallmark of type I diabetes. In the non-obese diabetic (NOD) mouse, diabetes has never been observed in the absence of insulitis. The in vivo detection of insulitis could be of relevance for early prediction of diabetes. As approximately 15% of islet-infiltrating lymphocytes express interleukin 2 receptors, the authors have labelled recombinant inter-leukin 2 with 123 I and used this radiopharmaceutical to detect insulitis by gamma camera imaging. The authors studied 71 prediabetic NOD and 27 normal Balb/c mice. Labelled α-lactalbumin was used as the control protein. In the first set of experiments the tissue distribution of radiolabelled interleukin 2 in isolated organs from animals sacrificed at different time points was studied. Higher radioactivity was detected in the pancreas of NOD mice injected with labelled interleukin 2, as compared to NOD mice receiving labelled α-lactalbumin. In another set of experiments, gamma camera images have been acquired after injection of 123 I-labelled interleukin 2. Radioactivity in the pancreatic region of prediabetic NOD and Balb/c mice showed similar kinetics to those observed by single organ counting, with higher accumulation in the pancreatic region of NOD mice. Finally, a positive correlation was found between the radioactivity in the pancreas and the extent of lymphocytic infiltration. This study demonstrates that 123 I-labelled interleukin 2 administered intravenously accumulates specifically in the inflamed pancreas of diabetes-prone NOD mice, suggesting its potential application in human insulin-dependent diabetes mellitus. 34 refs., 6 figs., 1 tab

  11. Identification of ischemia-regulated phosphorylation sites in connexin43: A possible target for the antiarrhythmic peptide analogue rotigaptide (ZP123)

    DEFF Research Database (Denmark)

    Axelsen, Lene Nygaard; Stahlhut, Martin; Mohammed, Shabaz

    2006-01-01

    Previous studies suggest that dephosphorylation of connexin43 (Cx43) is related to uncoupling of gap junction communication, which plays an important role in the genesis of ischemia-induced ventricular tachycardia. We studied changes in Cx43 phosphorylation during global ischemia in the absence...... and presence of the antiarrhythmic peptide analogue rotigaptide (formerly known as ZP123). Phosphorylation analysis was performed on Cx43 purified from isolated perfused rat hearts using matrix-assisted laser desorption/ionization mass spectrometry and liquid chromatography electrospray ionization tandem mass...

  12. Structural and electrical characterization of zinc oxide doped with antimony

    Directory of Open Access Journals (Sweden)

    G. Juárez Díaz

    2014-08-01

    Full Text Available In this work we report the results of structural and electrical characterization realized on zinc oxide single crystal samples with (001 orientation, which were doped with antimony. Doping was carried out by antimony thermal diffusion at 1000 °C for periods of 1 and 2 hours under nitrogen environment from a solid source formed by antimony oxide. Electrical characterization by I-V curves and Hall effect shown an increase in acceptor concentration which demonstrates that doping is effective and create holes in zinc oxide samples.

  13. Development and pharmacokinetic of antimony encapsulated in liposomes of phosphatidylserine using radioisotopes in experimental leishmaniasis

    International Nuclear Information System (INIS)

    Borborema, Samanta Etel Treiger

    2010-01-01

    Leishmaniasis are a complex of parasitic diseases caused by intra macrophage protozoa of the genus Leishmania, and is fatal if left untreated. Pentavalent antimonials, though toxic and their mechanism of action being unclear, remain the first-line drugs for treatment. Effective therapy could be achieved by delivering antileishmanial drugs to these sites of infection. Liposomes are phospholipid vesicles that promote improvement in the efficacy and action of drugs in target cell. Liposomes are taken up by the cells of mononuclear phagocytic system (MPS). The purpose of this study was to develop a preparation of meglumine antimonate encapsulated in liposomes of phosphatidylserine and to study its pharmacokinetic in healthy mice to establish its metabolism and distribution. Quantitative analysis of antimony from liposomes demonstrated that Neutron Activation Analysis was the most sensitive technique with almost 100 % of accuracy. All liposome formulations presented a mean diameter size of 150 nm. The determination of IC 50 in infected macrophage showed that liposome formulations were between 10 - 63 fold more effective than the free drug, indicating higher selectivity index. By fluorescence microscopy, an increased uptake of fluorescent-liposomes was seen in infected macrophages during short times of incubation compared with non-infected macrophages. Biodistribution studies showed that meglumine antimonate irradiated encapsulated in liposomes of phosphatidylserine promoted a targeting of antimony for MPS tissues and maintained high doses in organs for a prolonged period. In conclusion, these data suggest that meglumine antimonate encapsulated in liposomes showed higher effectiveness than the non-liposomal drug against Leishmania infection. The development of liposome formulations should be a new alternative for the chemotherapy of infection diseases, especially Leishmaniasis, as they are used to sustain and target pharmaceuticals to the local of infection. (author)

  14. Complex processing of antimony-mercury gold concentrates of Dzhizhikrut Deposit

    International Nuclear Information System (INIS)

    Abdusalyamova, M.N.; Gadoev, S.A.; Dreisinger, D.; Solozhenkin, P.M.

    2013-01-01

    Present article is devoted to complex processing of antimony-mercury gold concentrates of Dzhizhikrut Deposit. The purpose of research was obtaining the metallic mercury and antimony with further gold and thallium extraction.

  15. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    Johnson, E.; Littmark, U.; Johansen, A.; Christodoulides, C.

    1981-01-01

    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb + ions to a fluence of 5 x 10 20 ions/m 2 , thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  16. Molecular dynamics approaches to the design and synthesis of PCB targeting molecularly imprinted polymers: interference to monomer-template interactions in imprinting of 1,2,3-trichlorobenzene.

    Science.gov (United States)

    Cleland, Dougal; Olsson, Gustaf D; Karlsson, Björn C G; Nicholls, Ian A; McCluskey, Adam

    2014-02-07

    The interactions between each component of the pre-polymerisation mixtures used in the synthesis of molecularly imprinted polymers (MIP) specific for 1,2,3,4,5-pentachlorobenzene (1) and 1,2,3-trichlorobenzene (2) were examined in four molecular dynamics simulations. These simulations revealed that the relative frequency of functional monomer-template (FM-T) interactions was consistent with results obtained by the synthesis and evaluation of the actual MIPs. The higher frequency of 1 interaction with trimethylstyrene (TMS; 54.7%) than 1 interaction with pentafluorostyrene (PFS; 44.7%) correlated with a higher imprinting factor (IF) of 2.1 vs. 1.7 for each functional monomer respectively. The higher frequency of PFS interactions with 2 (29.6%) than TMS interactions with 2 (1.9%) also correlated well with the observed differences in IF (3.7) of 2 MIPs imprinted using PFS as the FM than the IF (2.8) of 2 MIPs imprinted using TMS as the FM. The TMS-1 interaction dominated the molecular simulation due to high interaction energies, but the weaker TMS-2 resulted in low interaction maintenance, and thus lower IF values. Examination of the other pre-polymerisation mixture components revealed that the low levels of TMS-2 interaction was, in part, due to interference caused by the cross linker (CL) ethyleneglycol dimethylacrylate (EGDMA) interactions with TMS. The main reason was, however, attributed to MeOH interactions with TMS in both a hydrogen bond and perpendicular configuration. This positioned a MeOH directly above the π-orbital of all TMS for an average of 63.8% of MD2 creating significant interference to π-π stacking interactions between 2 and TMS. These findings are consistent with the deviation from the 'normal' molecularly imprinted polymer synthesis ratio of 1 : 4 : 20 (T : FM : CL) of 20 : 1 : 29 and 15 : 6 : 29 observed with 2 and TMS and PFS respectively. Our molecular dynamics simulations correctly predicted the high level

  17. [Pollution characteristics of antimony, arsenic and mercury in human hair at Xikuangshan antimony mining area and Guiyang City, China].

    Science.gov (United States)

    Liu, Bi-Jun; Wu, Feng-Chang; Deng, Qiu-Jing; Mo, Chang-Li; Zhu, Jing; Zeng, Li; Fu, Zhi-You; Li, Wen

    2009-03-15

    The concentration levels of antimony, arsenic and mercury in human hair collected from Xikuangshan antimony mining area and Guiyang City were determined by hydride generation-atomic fluorescence spectrometry after having been digested by nitric acid and perchloric acid. The contents of Sb, As and Hg are 15.9, 4.21, 1.79 microg/g in the samples from Xikuangshan antimony mining area and 0.532, 0.280, 0.338 microg/g in the samples from Guiyang City respectively. The contents of Sb, As and Hg in human hair of Xikuangshan antimony area are much higher than those of Guiyang City. The independent-samples t-test shows that there are no marked differences in the contents of Sb and As between male and female hair samples from both Xikuangshan antimony mining area and Guiyang City (p > 0.05), while Hg contents in male hair are apparently higher than those in female hair from Guiyang City (p mining area may significantly affect human health than in the un-mining areas.

  18. Nanoscaled hydrated antimony (V oxide as a new approach to first-line antileishmanial drugs

    Directory of Open Access Journals (Sweden)

    Franco AMR

    2016-12-01

    Full Text Available Antonia MR Franco,1 Iryna Grafova,2 Fabiane V Soares,1,3 Gennaro Gentile,4 Claudia DC Wyrepkowski,1,3 Marcos A Bolson,5 Ézio Sargentini Jr,5 Cosimo Carfagna,4 Markku Leskelä,2 Andriy Grafov2 1Laboratory of Leishmaniasis and Chagas Disease, National Institute of Amazonian Research (INPA, Manaus, Amazonas, Brazil; 2Department of Chemistry, University of Helsinki, Helsinki, Finland; 3Multi-Institutional Post-Graduate Program in Biotechnology, Federal University of Amazonas, Manaus, Amazonas, Brazil; 4Institute for Polymers, Composites, and Biomaterials, National Research Council, Pozzuoli, Naples Province, Italy; 5Laboratory of Environmental Chemistry, National Institute of Amazonian Research (INPA, Manaus, Amazonas, Brazil Background: Coordination compounds of pentavalent antimony have been, and remain, the first-line drugs in leishmaniasis treatment for >70 years. Molecular forms of Sb (V complexes are commercialized as sodium stibogluconate (Pentostam® and meglumine antimoniate (MA (Glucantime®. Ever-increasing drug resistance in the parasites limits the use of antimonials, due to the low drug concentrations being administered against high parasitic counts. Sb5+ toxicity provokes severe side effects during treatment. To enhance therapeutic potency and to increase Sb (V concentration within the target cells, we decided to try a new active substance form, a hydrosol of Sb2O5⋅nH2O nanoparticles (NPs, instead of molecular drugs. Methodology/principal findings: Sb2O5⋅nH2O NPs were synthesized by controlled SbCl5 hydrolysis in a great excess of water. Sb2O5⋅nH2O phase formation was confirmed by X-ray diffraction. The surface of Sb (V NPs was treated with ligands with a high affinity for target cell membrane receptors. The mean particle size determined by dynamic light scattering and transmission electron microscopy was ~35–45 nm. In vitro tests demonstrated a 2.5–3 times higher antiparasitic activity of Sb (V nanohybrid hydrosols

  19. Heat-treated Saccharomyces cerevisiae for antimony speciation and antimony(III) preconcentration in water samples

    Energy Technology Data Exchange (ETDEWEB)

    Marcellino, Sebastien [Universite de Lyon, Lyon1, Laboratoire des Sciences Analytiques, CNRS UMR 5180, bat CPE, 43, boulevard du 11 novembre 1918, 69622 Villeurbanne cedex (France); Attar, Hossein [Universite Louis Pasteur de Strasbourg, Laboratoire de Chimie Analytique et Sciences Separatives, CNRS UMR 7178, ECPM, 25 rue Becquerel 67087 Strasbourg (France); Lievremont, Didier; Lett, Marie-Claire [Universite Louis Pasteur de Strasbourg, Laboratoire de Genetique Moleculaire, Genetique et Microbiologie, CNRS UMR 7156, 28 rue Goethe, 67000 Strasbourg (France); Barbier, Frederique [CNRS USR 59, Service Central d' Analyse, 59 Chemin du Canal BP22 69390 Vernaison (France); Lagarde, Florence [Universite de Lyon, Lyon1, Laboratoire des Sciences Analytiques, CNRS UMR 5180, bat CPE, 43, boulevard du 11 novembre 1918, 69622 Villeurbanne cedex (France); Universite Louis Pasteur de Strasbourg, Laboratoire de Chimie Analytique et Sciences Separatives, CNRS UMR 7178, ECPM, 25 rue Becquerel 67087 Strasbourg (France)], E-mail: florence.lagarde@univ-lyon1.fr

    2008-11-23

    An analytical method was developed for antimony speciation and antimony(III) preconcentration in water samples. The method is based on the selective retention of Sb(III) by modified Saccharomyces cerevisiae in the presence of Sb(V). Heat, caustic and solvent pretreatments of the biomass were investigated to improve the kinetics and thermodynamics of Sb(III) uptake process at room temperature. Heating for 30 min at 80 deg. C was defined as the optimal treatment. Antimony accumulation by the cells was independent of pH (5-10) and ionic strength (0.01-0.1 mol L{sup -1}). 140 mg of yeast and 2 h of contact were necessary to ensure quantitative sequestration of Sb(III) up to 750 {mu}g L{sup -1}. In these conditions, Sb(V) was not retained. Sb(V) was quantified in sorption supernatant by inductively coupled plasma mass spectrometry (ICP-MS) or inductively coupled plasma optical emission spectrometry (ICP-OES). Sb(III) was determined after elution with 40 mmol L{sup -1} thioglycolic acid at pH 10. A preconcentration factor close to nine was achieved for Sb(III) when 100 mL of sample was processed. After preconcentration, the detection limits for Sb(III) and Sb(V) were 2 and 5 ng L{sup -1}, respectively, using ICP-MS, 7 and 0.9 {mu}g L{sup -1} using ICP-OES. The proposed method was successfully applied to the determination of Sb(III) and Sb(V) in spiked river and mineral water samples. The relative standard deviations (n = 3) were in the 2-5% range at the tenth {mu}g L{sup -1} level and less than 10% at the lowest Sb(III) and Sb(V) tested concentration (0.1 {mu}g L{sup -1}). Corrected recoveries were in all cases close to 100%.

  20. Antimony recovery from end-of-life products and industrial process residues: A critical review

    OpenAIRE

    Dupont, David; Arnout, Sander; Jones, Peter Tom; Binnemans, Koen

    2016-01-01

    Antimony has become an increasingly critical element in recent years, due to a surge in industrial demand and the Chinese domination of primary production. Antimony is produced from stibnite ore (Sb2O3) which is processed into antimony metal and antimony oxide (Sb2O3). The industrial importance of antimony is mainly derived from its use as flame retardant in plastics, coatings, and electronics, but also as decolourizing agent in glass, alloys in lead-acid batteries, and catalysts for the p...

  1. Labeling and quality control of 123I-MIBG

    International Nuclear Information System (INIS)

    Figols de Barboza, Marycel Rosa

    2002-01-01

    This report describes a method to facilitate routine production of 123 I-MIBG in Radiopharmacy Centre of IPEN-CNEN/SP. Iodine-123 radioisotope is produced in the form of sodium iodide in Cyclone-30 (IBA) at IPEN-CNEN/SP through proton irradiation of gaseous 124 Xe target. The labelling procedure uses MIBG-sulphate and leads to 123 I-MIBG with radiochemical purity at least 98% and specific activity of 300-380 MBq/mg

  2. Selective oxidation of propene on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony

    International Nuclear Information System (INIS)

    Pendleton, P.; Taylor, D.

    1976-01-01

    Propene + 18 0 2 reactions have been studied in a static reaction system on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony. The [ 16 0] acrolein content of the total acrolein formed and the proportion of 16 0 in the oxygen of the carbon dioxide by-product have been determined. The results indicate that for each catalyst the lattice is the only direct source of the oxygen in the aldehyde, and that lattice and/or gas phase oxygen is used in carbon dioxide formation. Oxygen anion mobility appears to be greater in the molybdate catalyst than in the other two. (author)

  3. Neutron activation analysis of arsenic and antimony in human hair

    International Nuclear Information System (INIS)

    Kanda, Yukio; Isono, Hideo; Kozuka, Hiroshi.

    1975-01-01

    A radiochemical neutron activation method for the determination of trace amounts of arsenic and antimony in human hair samples is studied. The sample of hair (100 mg) irradiated for 5 hours with a neutron flux of 2.1x10 12 n/cm 2 s was decomposed with a sulfuric-nitric acid mixture after addition of each 5 mg of arsenic and antimony as carrier. Arsine and stibine were evolved from the solution of decomposed hair by reduction with 3 g of granular zinc and were absorbed in 0.1N iodine solution for half an hour. Metal arsenic was separated from iodine solution by precipitation with sodium hypophosphite, followed by precipitation of antimony as sulfide with thioacetamide. These precipitates were dissolved and their gamma-ray spectra were measured with a well type 3''x3'' NaI(TI) detector equipped with a 200 channel pulse-height analyzer. After the measurement of gamma-ray spectra, the chemical yields were determined by colorimetric methods. The relative standard deviations were 7% and 4% for 0.01 μg As and 0.024 μg Sb, respectively. The sensitivity of this method was estimated to be 1x10 -3 μg for arsenic and 2x10 -3 μg for antimony. (auth.)

  4. Electrical Properties of Antimony (Sb) Metal Contacts to Silicon (Si ...

    African Journals Online (AJOL)

    The study investigates the behaviour of the contacts formed by Antimony (Sb) metal to Silicon (Si) thin films for electric field values 10 – 100V/m. Measurements of I-v characteristics were obtained at temperatures 303, 313, 323, 333, 343 and 353K respectively. The results show linear I – V relationship over a specified range ...

  5. electrocardiographic findings in ethiopians on penta valent antimony ...

    African Journals Online (AJOL)

    East Africa Medical Journal Vol. 78 No. 11 November 2001. ELECTROCARDIOGRAPHIC FINDINGS IN ETHIOPIANS ON PENTA VALENT ANTIMONY THERAPY FOR VISCERAL LEISHMANIASIS. N. Berhe, MD, DTMH, Institute of Pathobiology, Addis Ababa University, P.O. Box 1176, Addis Ababa, Ethiopia, Y. Abraham, ...

  6. Vapor pressures of dimethylcadmium, trimethylbismuth, and tris(dimethylamino)antimony

    Czech Academy of Sciences Publication Activity Database

    Morávek, Pavel; Fulem, Michal; Pangrác, Jiří; Hulicius, Eduard; Růžička, K.

    2013-01-01

    Roč. 360, Dec (2013), s. 106-110 ISSN 0378-3812 R&D Projects: GA ČR GA13-15286S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : vapor pressure * dimethylcadmium * trimethylbismuth * tris(dimethylamino)antimony * sublimation and vaporization enthalpy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.241, year: 2013

  7. Application of KWU antimony removal process at Gentilly-2

    International Nuclear Information System (INIS)

    Dundar, Y.; Odar, S.; Streit, K.; Allsop, H.; Guzonas, D.

    1996-09-01

    This paper describes the work performed to adapt the KWU PWR antimony removal process to CANDU plant conditions, and the application of the process at the Hydro Quebec unit, Gentilly-2. The results of the application will be presented and the 'lessons learned' will be discussed in detail. (author)

  8. Antimony content of macrofungi from clean and polluted areas

    Czech Academy of Sciences Publication Activity Database

    Borovička, J.; Řanda, Zdeněk; Jelínek, E.

    2006-01-01

    Roč. 64, č. 11 (2006), s. 1837-1844 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z10480505 Keywords : mushrooms * antimony pollution * bioaccumulation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.442, year: 2006

  9. The decoration of vicinal copper polycrystalline surface by Antimony

    CSIR Research Space (South Africa)

    Ndlovu, GF

    2011-07-01

    Full Text Available An Ultra-high Vacuum Variable Temperature Scanning Tunnelling Microscope was used to study the growth mechanism of Antimony on vicinal Cu polycrystalline samples. The STM data after deposition of 0.3 ML Sb at 300°C showed localization of Sb atoms...

  10. Antimony trioxide-induced apoptosis is dependent on SEK1/JNK signaling.

    Science.gov (United States)

    Mann, Koren K; Davison, Kelly; Colombo, Myrian; Colosimo, April L; Diaz, Zuanel; Padovani, Alessandra M S; Guo, Qi; Scrivens, P James; Gao, Wenli; Mader, Sylvie; Miller, Wilson H

    2006-01-05

    Very little is known concerning the toxicity of antimony, despite its commercial use as a flame retardant and medical use as a treatment for parasitic infections. Our previous studies show that antimony trioxide (Sb(2)O(3)) induces growth inhibition in patient-derived acute promyelocytic leukemia (APL) cell lines, a disease in which a related metal, arsenic trioxide (As(2)O(3)), is used clinically. However, signaling pathways initiated by Sb(2)O(3) treatment remain undefined. Here, we show that Sb(2)O(3) treatment of APL cells is associated with increased apoptosis as well as differentiation markers. Sb(2)O(3)-induced reactive oxygen species (ROS) correlated with increased apoptosis. In addition, when we decreased the buffering capacity of the cell by depleting glutathione, ROS production and apoptosis was enhanced. Arsenic-resistant APL cells with increased glutathione levels exhibited increased cross-resistance to Sb(2)O(3). Based on studies implicating c-jun kinase (JNK) in the mediation of the response to As(2)O(3), we investigated the role for JNK in Sb(2)O(3)-induced apoptosis. Sb(2)O(3) activates JNK and its downstream target, AP-1. In fibroblasts with a genetic deletion in SEK1, an upstream regulator of JNK, Sb(2)O(3)-induced growth inhibition as well as JNK activation was decreased. These data suggest roles for ROS and the SEK1/JNK pathway in the cytotoxicity associated with Sb(2)O(3) exposure.

  11. Antimony and arsenic biogeochemistry in the East China Sea

    Science.gov (United States)

    Ren, Jing-Ling; Zhang, Xu-Zhou; Sun, You-Xu; Liu, Su-Mei; Huang, Daji; Zhang, Jing

    2016-02-01

    The biogeochemical cycles of the metalloid elements arsenic and antimony in the East China Sea (ECS), one of the most important marginal seas for western Pacific, were examined in May 2011. Dissolved inorganic arsenic (As(V) and As(III)) and antimony (Sb(V) and Sb(III)) species were determined by selective hydride generation-atomic fluorescence spectrometry (HG-AFS). Results show that total dissolved inorganic arsenic (TDIAs; [TDIAs]=[As(V)]+[As(III)]) were moderately depleted in the surface water and enriched in the deep water. Arsenite (As(III)) showed different vertical profiles with that of TDIAs, with significant surface enrichment in the middle shelf region where the concentrations of phosphate were extremely low. Speciation of dissolved arsenic was subtly controlled by the stoichiometric molar ratio of arsenate (As(V)) to phosphate. The average As(V)/P ratio for the ECS in spring 2011 was 10.8×10-3, which is higher than previous results and indicates the arsenate stress. The concentrations of total dissolved inorganic antimony (TDISb; [TDISb]=[Sb(V)]+[Sb(III)]) were high near the Changjiang Estuary and the coastal area of Hangzhou Bay and decreased moderately off the coast. TDISb displayed moderate conservative behavior in the ECS that confirms by the correlations with salinity and dissolved aluminum. Different with that of As(III), antimonite (Sb(III)) concentrations were extremely lower in the ECS, with relative higher concentration appeared at the bottom layer which indicates the contribution from sediment-water interface. A preliminary box model was established to estimate the water-mass balance and antimony budgets for the ECS. Compared with other areas in the world, the concentrations of dissolved inorganic arsenic and antimony in the ECS remain at natural levels.

  12. BioGeochemistry of antimony, Sources, Transfers, Impacts and Assessment

    Science.gov (United States)

    Le Roux, Gael; Pinelli, Eric; Hedde, Mickael; Guiresse, Maritxu; De Vleeschouwer, François; Silvestre, Jérôme; Enrico, Maxime; Gandois, Laure; Monna, Fabrice; Gers, Charles; Probst, Anne

    2013-04-01

    BioGeoSTIB is a project funded by ADEME (French Environmental Protection Agency). Its aim is to provide a better understanding of biogeochemical cycle disturbances of antimony by man. Specifically, it is focused on the atmosphere-soil-organism interfaces. Based on a multi-scale approach, the impact of antimony on organisms and organism communities and the factors of Sb dispersion in the environment aim to better characterized. This report gives the main results of 2 and 1 -2 years of research. Using peat bogs as environmental archives, we show that Sb contamination in soils date back to the beginning of the metallurgy. Atmospheric deposition of Sb largely increased by 100 times during the Industrial Revolution compared to natural levels (~0,001-0,01 mg m-2 an-1) estimated in the deepest peat layers. This disturbance in the antimony geochemical cycle modified its concentrations in soils. One main source of present Sb contamination is automotive traffic due to Sb in braking lines. This emerging contamination was characterized close to a roundabout. This additional source of Sb does not seem to impact soil fauna but Sb concentrations in soil solutions exceed 1 μg L-1. Genotoxicity tests have been performed on the model plant Vicia faba and show that antimony is genotoxic at its lowest concentrations and that there is a synergistic effect lead, a trace metal frequently found in association with antimony in the environment. It is a main issue to determine Sb critical loads in the environment but main identified lacks are thermodynamic data, which are not available yet, to model the behavior of Sb in soil solutions and the fact the antimony is always associated with other anthropogenic trace metals like lead. Critical thresholds of Sb have been determined for the first time based on genotoxicity experiment. Simulations show that these thresholds can be exceeded in the future, whereas present limits for invertebrates (US-EPA) are and will not be reached. However

  13. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2005-10-01

    Full Text Available Pentavalent antimony, as meglumine antimoniate (Glucantime® or sodium stibogluconate (Pentostam® , is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology.Os antimoniais pentavalentes, como o antimoniato de meglumina (Glucantime® ou estibogluconato de sódio (Pentostam® , são o principal tratamento para a leishmaniose, um complexo de doenças causadas pelo protozoário parasita Leishmania, uma doença endêmica e negligenciada no Brasil. Apesar do seu uso clínico por mais de meio século, seu mecanismo de ação, toxicidade e dados de farmacocinética permanecem desconhecidos. Os métodos analíticos para determinação de antimônio em sistemas biológicos são complexos e apresentam baixa sensibilidade. Estudos utilizando radiotraçadores têm papel potencial no desenvolvimento farmacológico. O objetivo deste estudo foi desenvolver um radiotraçador de antimônio, com propriedades físicas e biológicas adequadas. O antimoniato de meglumina foi irradiado por nêutrons no reator nuclear IEA-R1, produzindo dois radioisótopos: 122

  14. Selective synthesis of ternary copper-antimony sulfide nanocrystals.

    Science.gov (United States)

    Xu, Dongying; Shen, Shuling; Zhang, Yejun; Gu, Hongwei; Wang, Qiangbin

    2013-11-18

    Ternary copper-antimony sulfide nanocrystals (CAS NCs) have attracted increasing attention in photovoltaics and photoelectric nanodevices due to their tunable band gaps in the near-IR regime. Although much progress in the synthesis of CAS NCs has been achieved, the selective synthesis of CAS NCs with controllable morphologies and compositions is preliminary: in particular, a facile method is still in demand. In this work, we have successfully selectively synthesized high-quality CAS NCs with diverse morphologies, compositions, and band gaps, including rectangular CuSbS2 nanosheets (NSs), trigonal-pyramidal Cu12Sb4S13 NCs, and rhombic Cu3SbS3 NSs, by cothermodecomposition of copper diethyldithiocarbamate trihydrate (Cu(Ddtc)2) and antimony diethyldithiocarbamate trihydrate (Sb(Ddtc)3). The direct and indirect band gaps of the obtained CAS NCs were systematically studied by performing Kubelka-Munk transformations of their solid-state diffuse reflectance spectra.

  15. Determination of phosphorus contamination during antimony implantation by measurement and simulation

    International Nuclear Information System (INIS)

    Kuruc, M.; Hulenyi, L.; Kinder, R.

    2006-01-01

    Experimental determination of phosphorus cross-contamination during antimony implantation is presented. As a suitable structure for this experiment, a buried layer was employed which is created by implanting antimony followed by a long diffusion process. The samples implanted in different implanters were analysed by secondary ion mass spectrometry (SIMS), four-point probe and spreading resistance methods. The obtained results were compared with those calculated by program SUPREM-IV. Methods that can and cannot be used to determine phosphorus contamination during antimony implantation and to estimate the fluence of phosphorus being co-implanted with antimony are described in detail

  16. High dose implantations of antimony for buried layer applications

    International Nuclear Information System (INIS)

    Gailliard, J.P.; Dupuy, M.; Garcia, M.; Roussin, J.C.

    1978-01-01

    Electrical and physical properties of high dose implantations of antimony in silicon have been studied for use in buried layer applications. The results have been obtained both on and oriented silicon wafers. Following implantations which lead to amorphization we perform an annealing at 600 0 C for 10 mn in order to recrystallize the layer. The observed electrical properties (μ, R) show that the concentration of electrically active antimony ions is greater than that predicted from the solubility of antimony in silicon. Further annealing (in the range 1050 0 - 1200 0 ) induces: firstly a precipitation of the Sb and secondly a diffusion and dissolution of the precipitates. There is a different evolution of the defects in the and silicon slices. T.E.M. reveals no defects in the wafers after one hour annealing at 1200 0 C, whereas defects and twins remain in wafers. Having obtained the evolution of R with time and temperature it is then determined the implantation and annealing conditions which lead to the low resistivity (R = 10) needed for buried layer applications. Results with very many industrially made devices are discussed

  17. Research on the Characteristics and Mechanism of the Cumulative Release of Antimony from an Antimony Smelting Slag Stacking Area under Rainfall Leaching

    Science.gov (United States)

    Zhou, Yingying; Deng, Renjian

    2017-01-01

    We aimed to study the characteristics and the mechanism of the cumulative release of antimony at an antimony smelting slag stacking area in southern China. A series of dynamic and static leaching experiments to simulate the effects of rainfall were carried out. The results showed that the release of antimony from smelting slag increased with a decrease in the solid-liquid ratio, and the maximum accumulated release was found to be 42.13 mg Sb/kg waste and 34.26 mg Sb/kg waste with a solid/liquid ratio of 1 : 20; the maximum amount of antimony was released within 149–420 μm size fraction with 7.09 mg/L of the cumulative leaching. Also, the antimony release was the greatest and most rapid at pH 7.0 with the minimum release found at pH 4.0. With an increase in rainfall duration, the antimony release increased. The influence of variation in rainfall intensity on the release of antimony from smelting slag was small. PMID:28804669

  18. Antimony leaching from polyethylene terephthalate (PET) plastic used for bottled drinking water.

    Science.gov (United States)

    Westerhoff, Paul; Prapaipong, Panjai; Shock, Everett; Hillaireau, Alice

    2008-02-01

    Antimony is a regulated contaminant that poses both acute and chronic health effects in drinking water. Previous reports suggest that polyethylene terephthalate (PET) plastics used for water bottles in Europe and Canada leach antimony, but no studies on bottled water in the United States have previously been conducted. Nine commercially available bottled waters in the southwestern US (Arizona) were purchased and tested for antimony concentrations as well as for potential antimony release by the plastics that compose the bottles. The southwestern US was chosen for the study because of its high consumption of bottled water and elevated temperatures, which could increase antimony leaching from PET plastics. Antimony concentrations in the bottled waters ranged from 0.095 to 0.521 ppb, well below the US Environmental Protection Agency (USEPA) maximum contaminant level (MCL) of 6 ppb. The average concentration was 0.195+/-0.116 ppb at the beginning of the study and 0.226+/-0.160 ppb 3 months later, with no statistical differences; samples were stored at 22 degrees C. However, storage at higher temperatures had a significant effect on the time-dependent release of antimony. The rate of antimony (Sb) release could be fit by a power function model (Sb(t)=Sb 0 x[Time, h]k; k=8.7 x 10(-6)x[Temperature ( degrees C)](2.55); Sb 0 is the initial antimony concentration). For exposure temperatures of 60, 65, 70, 75, 80, and 85 degrees C, the exposure durations necessary to exceed the 6 ppb MCL are 176, 38, 12, 4.7, 2.3, and 1.3 days, respectively. Summertime temperatures inside of cars, garages, and enclosed storage areas can exceed 65 degrees C in Arizona, and thus could promote antimony leaching from PET bottled waters. Microwave digestion revealed that the PET plastic used by one brand contained 213+/-35 mgSb/kg plastic; leaching of all the antimony from this plastic into 0.5L of water in a bottle could result in an antimony concentration of 376 ppb. Clearly, only a small

  19. Complexation of HSA with different forms of antimony (Sb): An application of fluorescence spectroscopy

    International Nuclear Information System (INIS)

    Song, Wenjuan; Zhang, Daoyong; Pan, Xiangliang; Lee, Duu-Jong

    2013-01-01

    Antimony (Sb) pollution has been of a great environmental concern in some areas in China. Sb enters human body via drinking water, inhalation and food chain, unavoidably interacts with human serum albumin (HSA) in blood plasma, and consequently does harm to human health. The harmful effects of Sb on human health depend on the Sb species and their binding ability to HSA. In the present study, binding of three forms of Sb with HSA was investigated by excitation-emission matrix (EEM) spectroscopy. All of antimony potassium tartrate, antimony trichloride and potassium pyroantimonate quenched fluorescence of HSA. Values of conditional stability constant K a (×10 5 /M) for Sb and HSA systems were 8.13–9.12 for antimony potassium tartrate, 2.51–4.27 for antimony trichloride and 3.63–9.77 for potassium pyroantimonate. The binding constant K b (×10 4 /M) values of HSA with antimony potassium tartrate, antimony trichloride and potassium pyroantimonate were 0.02–0.07, 3.55–5.01, and 0.07–1.08, respectively. There was one independent class of binding site for antimony trichloride towards HSA. There was more than one Sb binding site and negative cooperativity between multiple binding sites for potassium pyroantimonate and antimony potassium tartrate towards HSA. The binding ability of HSA to complex Sb followed the order: antimony trichloride>potassium pyroantimonate>antimony potassium tartrate. -- Highlights: ► The first study reporting interaction of Sb with HSA. ► Sb can effectively quench the fluorescence of HSA. ► The binding ability of HSA to Sb was dependent on the form of Sb. ► Binding differences indicate differences in toxicity of various forms Sb to human. ► HAS-Sb binding parameters are important for understanding toxicity of Sb

  20. Heavy weight vehicle traffic and its relationship with antimony content in human blood.

    Science.gov (United States)

    Quiroz, Waldo; De Gregori, Ida; Basilio, Paola; Bravo, Manuel; Pinto, Marcela; Lobos, Maria Gabriela

    2009-05-01

    Brake pads systems are nowadays considered as one of the most important sources of antimony in airborne particulate matter. One way that antimony can enter the body is through the lungs and specially by the interaction of antimony with -SH groups present in erythrocyte membrane cells. In spite of that, there are no studies about antimony enrichment in blood of workers exposed to high vehicle traffic. Port workers are generally exposed to heavy weight vehicle traffic. In Chile the biggest marine port is found in Valparaíso City. In this study antimony in whole blood and its fractions (erythrocytes-plasma and erythrocytes membranes-cytoplasm) of 45 volunteers were determined. The volunteers were port workers from Valparaíso city, and two control groups, one from Valparaíso and another from Quebrada Alvarado, the latter being a rural area located about 100 Km away from Valparaíso. The results demonstrate that port workers are highly impacted by antimony emissions from heavy weight vehicle traffic showing an average concentration of 27 +/- 9 ng Sb kg(-1), 5-10 times higher than the concentration of antimony in the blood of control groups. These are the highest antimony levels in blood ever reported in the literature. The highest antimony percentages (>60%) were always found in the erythrocyte fractions. However, the exposure degree to vehicle traffic is significant over antimony distribution in plasma, erythrocytes and cytoplasm. This results shows that the antimony mass in the erythrocyte membranes, was approximately constant at 1.0 +/- 0.1 ng Sb g(-1) of whole blood in all blood samples analyzed.

  1. Leishmania donovani isolates with antimony-resistant but not -sensitive phenotype inhibit sodium antimony gluconate-induced dendritic cell activation.

    Directory of Open Access Journals (Sweden)

    Arun Kumar Haldar

    2010-05-01

    Full Text Available The inability of sodium antimony gluconate (SAG-unresponsive kala-azar patients to clear Leishmania donovani (LD infection despite SAG therapy is partly due to an ill-defined immune-dysfunction. Since dendritic cells (DCs typically initiate anti-leishmanial immunity, a role for DCs in aberrant LD clearance was investigated. Accordingly, regulation of SAG-induced activation of murine DCs following infection with LD isolates exhibiting two distinct phenotypes such as antimony-resistant (Sb(RLD and antimony-sensitive (Sb(SLD was compared in vitro. Unlike Sb(SLD, infection of DCs with Sb(RLD induced more IL-10 production and inhibited SAG-induced secretion of proinflammatory cytokines, up-regulation of co-stimulatory molecules and leishmanicidal effects. Sb(RLD inhibited these effects of SAG by blocking activation of PI3K/AKT and NF-kappaB pathways. In contrast, Sb(SLD failed to block activation of SAG (20 microg/ml-induced PI3K/AKT pathway; which continued to stimulate NF-kappaB signaling, induce leishmanicidal effects and promote DC activation. Notably, prolonged incubation of DCs with Sb(SLD also inhibited SAG (20 microg/ml-induced activation of PI3K/AKT and NF-kappaB pathways and leishmanicidal effects, which was restored by increasing the dose of SAG to 40 microg/ml. In contrast, Sb(RLD inhibited these SAG-induced events regardless of duration of DC exposure to Sb(RLD or dose of SAG. Interestingly, the inhibitory effects of isogenic Sb(SLD expressing ATP-binding cassette (ABC transporter MRPA on SAG-induced leishmanicidal effects mimicked that of Sb(RLD to some extent, although antimony resistance in clinical LD isolates is known to be multifactorial. Furthermore, NF-kappaB was found to transcriptionally regulate expression of murine gammaglutamylcysteine synthetase heavy-chain (mgammaGCS(hc gene, presumably an important regulator of antimony resistance. Importantly, Sb(RLD but not Sb(SLD blocked SAG-induced mgammaGCS expression in DCs by

  2. Comparison of modification with strontium and the refining with antimony in A 356 aluminium alloys

    International Nuclear Information System (INIS)

    Fuoco, Ricardo; Correa, Edison Roberto; Correa, Alzira V.O.; Bocalini Junior, Mario

    1992-01-01

    Strontium and Antimony treated A356 aluminium alloy samples were metallographically characterized in the as cast and solution and aged conditions. Antimony treated alloy has shown slower spheroidizing kinetics of the Silicon particles during solution treatment, lower porosity level and higher tensile strength and elongation than Strontium treated one. (author)

  3. Effect of antimony on the microbial growth and the activities of soil enzymes.

    Science.gov (United States)

    An, Youn-Joo; Kim, Minjin

    2009-02-01

    The effects of antimony (Sb) on microbial growth inhibition and activities of soil enzymes were investigated in the present study. Test bacterial species were Escherichia coli, Bacillus subtilis and Streptococcus aureus. Among the microorganisms tested, S. aureus was the most sensitive. The 50% effects on the inhibition of specific growth rate of E. coli, B. subtilis, and, S. aureus were 555, 18.4, and 15.8 mg Sb L(-1), respectively. A silt loam soil was amended with antimony and incubated in a controlled condition. Microbial activities of dehydrogenase, acid phosphatase (P cycle), arylsulfatase (S cycle), beta-glucosidase (C cycle), urease (N cycle), and fluorescein diacetate hydrolase in soil were measured. Activities of urease and dehydrogenase were related with antimony and can be an early indication of antimony contamination. The maximum increase in soil urease activity by antimony was up to 168% after 3d compared with the control. The activities of other four enzymes (acid phosphatase, fluorescein diacetate hydrolase, arylsulfatase and ss-glucosidase) were less affected by antimony. This study suggested that antimony affects nitrogen cycle in soil by changing urease activity under the neutral pH, however, soil enzyme activities may not be a good protocol due to their complex response patterns to antimony pollution.

  4. The Hydrothermal Chemistry of Gold, Arsenic, Antimony, Mercury and Silver

    Energy Technology Data Exchange (ETDEWEB)

    Bessinger, Brad; Apps, John A.

    2003-03-23

    A comprehensive thermodynamic database based on the Helgeson-Kirkham-Flowers (HKF) equation of state was developed for metal complexes in hydrothermal systems. Because this equation of state has been shown to accurately predict standard partial molal thermodynamic properties of aqueous species at elevated temperatures and pressures, this study provides the necessary foundation for future exploration into transport and depositional processes in polymetallic ore deposits. The HKF equation of state parameters for gold, arsenic, antimony, mercury, and silver sulfide and hydroxide complexes were derived from experimental equilibrium constants using nonlinear regression calculations. In order to ensure that the resulting parameters were internally consistent, those experiments utilizing incompatible thermodynamic data were re-speciated prior to regression. Because new experimental studies were used to revise the HKF parameters for H2S0 and HS-1, those metal complexes for which HKF parameters had been previously derived were also updated. It was found that predicted thermodynamic properties of metal complexes are consistent with linear correlations between standard partial molal thermodynamic properties. This result allowed assessment of several complexes for which experimental data necessary to perform regression calculations was limited. Oxygen fugacity-temperature diagrams were calculated to illustrate how thermodynamic data improves our understanding of depositional processes. Predicted thermodynamic properties were used to investigate metal transport in Carlin-type gold deposits. Assuming a linear relationship between temperature and pressure, metals are predicted to predominantly be transported as sulfide complexes at a total aqueous sulfur concentration of 0.05 m. Also, the presence of arsenic and antimony mineral phases in the deposits are shown to restrict mineralization within a limited range of chemical conditions. Finally, at a lesser aqueous sulfur

  5. Successful therapy with hemoperfusion and plasma exchange in acute 1,2,3-trichloropropane poisoning.

    Science.gov (United States)

    Liu, P; Liang, Y-G; Meng, Q-Y; Zhang, C-G; Wang, H-C; Zhang, X-G; Li, G; Liu, Z-Y; He, Y-Z

    2012-05-01

    1,2,3-trichloropropane (1,2,3-TCP) is commonly used as an intermediate in pesticide and an industrial specialty solvent. Acute 1,2,3-TCP poisoning is rare but a medical emergency. Sporadic cases of toxic hepatic injury from 1,2,3-TCP in humans have been reported. Liver is a target organ for 1,2,3-TCP toxicity, which may ensue in a short period after ingestion. A specific antidote against 1,2,3-TCP is not available. So it is important to distinguish that a patient with 1,2,3-TCP poisoning constitutes a medical emergency. In this case study, the poisoned patient's clinical condition and laboratory values improved gradually after she received hemoperfusion (HP) and plasma exchange, which indicated that the therapy with HP and plasma exchange were helpful in the treatment of 1,2,3-TCP poisoning.

  6. Metabolism of antimony-124 in lactating dairy cows

    International Nuclear Information System (INIS)

    Bruwaene, R. van; Gerber, G.B.; Kirchmann, R.; Colard, J.

    1982-01-01

    Lactating cows received oral and intravenous administrations of radioactive antimony (III) chloride to study its intestinal and urinary excretion, secretion into milk and organ distribution. Milk samples were taken twice a day and the milk, feces and urine assayed using gamma spectroscopy. Cows administered orally were sacrificed at 102 days and those injected intravenously at 70 days. Distribution of 124 Sb in the organs was determined at the time of sacrifice. Excretion of 124 Sb occurs mainly via urine, little is secreted into milk. Highest organ concentrations are in the spleen, liver and bone. (U.K.)

  7. Extraction of antimony and arsenic from sulphidic concentrates

    Directory of Open Access Journals (Sweden)

    BalហPeter

    2000-09-01

    Full Text Available The efficiency of both mineral processing and extractive metallurgy of minerals depends on the separation of individual mineral components and on the exposure of their surface. The production of flotation concentrates, with particle sizes of tens of microns, is not sufficient for many hydrometallurgical processes to operate at their optimum. As a consequence, metallurgical plants require for the effective processing high temperatures and pressures and some sort of concentrate pretreatment. Mechanical activation is an innovative procedure where an improvement in hydrometallurgical processes can be attained via a combination of new surface area and formation of crystalline defects in minerals. The lowering of reaction temperatures, the increase of rate and amount of solubility, preparation of water soluble compounds, the necessity for simpler and less expensive reactors and shorter reaction times are some of the advantages of mechanical activation. The environmental aspects of these processes are particularly attractive.This paper is devoted to the examples of application of mechanochemical treatment in the processing of sulfidic concentrates. The sulphide concentrates of various origin (Peru, Chile, Slovakia were succesfully tested for antimony and arsenic extraction. The mechanochemical treatment improve the degree of recovery and the rate of leaching of both metals. Two modes of mechanochemical treatment were tested: the mechanical activation before leaching and the mechanochemical leaching which integrates mechanical activation and leaching into a common step. The flowsheet consisted of mechanochemical leaching in an attritor and further operations as filtration, cementation, antimony precipitation, crystallization and arsenic precipitation. The pilot plant unit was designed for 500 kg per day feed of tetrahedrite concentrate. For the antimony extraction, electrowinning has also been considered. The residue which is a CuAgAu concentrate was

  8. Electrostatically defined silicon quantum dots with counted antimony donor implants

    Energy Technology Data Exchange (ETDEWEB)

    Singh, M., E-mail: msingh@sandia.gov; Luhman, D. R.; Lilly, M. P. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Integrated Nanotechnologies, Sandia National Laboratories, Albuquerque, New Mexico 87175 (United States); Pacheco, J. L.; Perry, D.; Garratt, E.; Ten Eyck, G.; Bishop, N. C.; Wendt, J. R.; Manginell, R. P.; Dominguez, J.; Pluym, T.; Bielejec, E.; Carroll, M. S. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)

    2016-02-08

    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants.

  9. Apparatus of hot cell for iodine-123 production

    International Nuclear Information System (INIS)

    Almeida, G.L. de; Rautenberg, F.A.; Souza, A.S.F. de.

    1986-01-01

    The hot cell installation at IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. Several devices, such as, tube furnace coupling system, tube furnace driving system, sup(123)I target transfer system, product extraction system, furnace control system, and effluent systems, were constructed and modified for implanting process engineering. The requirements of safety engineering for operation process were based on ALARA concept. (M.C.K.)

  10. Electrical conductivity of uranium-antimony oxide catalysts

    International Nuclear Information System (INIS)

    Golunski, S.E.; Nevell, T.G.; Hucknall, D.J.

    1985-01-01

    The relative ionic and electronic contributions to the electrical conductivity of a uranium-antimony oxide catalyst and of USbO 5 have been determined from measurements of a.c. and d.c. conductance. Under inert atmospheres (390 to 775 K) conduction in the catalyst (predominantly USb 3 O 10 together with small proportions of Sb 2 O 4 and USbO 5 ) is associated with both electronic and effectively charged atomic point defects. Only electronic conduction occurs in USbO 5 . Under oxygen (10 to 70 kPa, 493 to 682 K) both materials are n-type semiconductors at higher temperatures, but at lower temperatures semiconducting behaviour varies with the pressure of oxygen. Heating USbO 5 in oxygen induces an ionic contribution to conductivity. Ionic conduction in the catalyst is eliminated by heating in hydrogen or propene at 470 K but is restored by heating in oxygen. It is suggested that both charged oxygen vacancies and interstitial oxide ions are involved in interactions of gaseous components with uranium-antimony oxides. With alkenes, interstitial oxide ions give rise to the products of selective partial oxidation. (author)

  11. Segregation of antimony in InP in MOVPE

    International Nuclear Information System (INIS)

    Weeke, Stefan

    2008-01-01

    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  12. Segregation of antimony in InP in MOVPE

    Energy Technology Data Exchange (ETDEWEB)

    Weeke, Stefan

    2008-07-01

    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  13. Characterization of SGN-CD123A, A Potent CD123-Directed Antibody-Drug Conjugate for Acute Myeloid Leukemia.

    Science.gov (United States)

    Li, Fu; Sutherland, May Kung; Yu, Changpu; Walter, Roland B; Westendorf, Lori; Valliere-Douglass, John; Pan, Lucy; Cronkite, Ashley; Sussman, Django; Klussman, Kerry; Ulrich, Michelle; Anderson, Martha E; Stone, Ivan J; Zeng, Weiping; Jonas, Mechthild; Lewis, Timothy S; Goswami, Maitrayee; Wang, Sa A; Senter, Peter D; Law, Che-Leung; Feldman, Eric J; Benjamin, Dennis R

    2018-02-01

    Treatment choices for acute myelogenous leukemia (AML) patients resistant to conventional chemotherapies are limited and novel therapeutic agents are needed. IL3 receptor alpha (IL3Rα, or CD123) is expressed on the majority of AML blasts, and there is evidence that its expression is increased on leukemic relative to normal hematopoietic stem cells, which makes it an attractive target for antibody-based therapy. Here, we report the generation and preclinical characterization of SGN-CD123A, an antibody-drug conjugate using the pyrrolobenzodiazepine dimer (PBD) linker and a humanized CD123 antibody with engineered cysteines for site-specific conjugation. Mechanistically, SGN-CD123A induces activation of DNA damage response pathways, cell-cycle changes, and apoptosis in AML cells. In vitro , SGN-CD123A-mediated potent cytotoxicity of 11/12 CD123 + AML cell lines and 20/23 primary samples from AML patients, including those with unfavorable cytogenetic profiles or FLT3 mutations. In vivo , SGN-CD123A treatment led to AML eradication in a disseminated disease model, remission in a subcutaneous xenograft model, and significant growth delay in a multidrug resistance xenograft model. Moreover, SGN-CD123A also resulted in durable complete remission of a patient-derived xenograft AML model. When combined with a FLT3 inhibitor quizartinib, SGN-CD123A enhanced the activity of quizartinib against two FLT3-mutated xenograft models. Overall, these data demonstrate that SGN-CD123A is a potent antileukemic agent, supporting an ongoing trial to evaluate its safety and efficacy in AML patients (NCT02848248). Mol Cancer Ther; 17(2); 554-64. ©2017 AACR . ©2017 American Association for Cancer Research.

  14. Removal of arsenic and antimony from anode slime by vacuum dynamic flash reduction.

    Science.gov (United States)

    Lin, Deqiang; Qiu, Keqiang

    2011-04-15

    Anode slime is an important material of recycling precious metals. Up to now, treating the arsenic- and antimony-rich anode slime by conventional processes has the following problems: its economic and environmental effect is less than satisfactory, and the removal effect of arsenic and antimony from anode slime in present processes is not all that could be desired. Therefore, vacuum dynamic flash reduction, a new process for treating arsenic- and antimony-rich anode slime, was investigated in this work. During vacuum dynamic flash reduction, silver from the arsenic- and antimony-rich anode slime was left behind in the distilland as the silver alloy, and trivalent oxides of arsenic and antimony were evaporated in the distillate. The experimental results showed that the evaporation percent of the arsenic- and antimony-rich anode slime was 65.6%. Namely, 98.92% by weight of arsenic and 93.67% by weight of antimony can be removed under the following experimental conditions: temperature of 1083 K, vacuum evaporation time of 60 min, and air flow rate of 400 mL/min corresponding to the residual gas pressure of 250 Pa. Moreover, vacuum treatment eliminates much of the air pollution and material losses associated with other conventional treatment methods.

  15. Immobilization of antimony waste slag by applying geopolymerization and stabilization/solidification technologies.

    Science.gov (United States)

    Salihoglu, Güray

    2014-11-01

    During the processing of antimony ore by pyrometallurgical methods, a considerable amount of slag is formed. This antimony waste slag is listed by the European Union as absolutely hazardous waste with a European Waste Catalogue code of 10 08 08. Since the levels of antimony and arsenic in the leachate of the antimony waste slag are generally higher than the landfilling limits, it is necessary to treat the slag before landfilling. In this study, stabilization/solidification and geopolymerization technologies were both applied in order to limit the leaching potential of antimony and arsenic. Different combinations ofpastes by using Portland cement, fly ash, clay, gypsum, and blast furnace slag were prepared as stabilization/solidification or geopoljymer matrixes. Sodium silicate-sodium hydroxide solution and sodium hydroxide solution at 8 M were used as activators for geopolymer samples. Efficiencies of the combinations were evaluated in terms of leaching and unconfined compressive strength. None of the geopolymer samples prepared with the activators yielded arsenic and antimony leaching below the regulatory limit at the same time, although they yielded high unconfined compressive strength levels. On the other hand, the stabilization/solidification samples prepared by using water showed low leaching results meeting the landfilling criteria. Use of gypsum as an additive was found to be successful in immobilizing the arsenic and antimony.

  16. In Vitro Antiparasitic and Apoptotic Effects of Antimony Sulfide Nanoparticles on Leishmania infantum

    Directory of Open Access Journals (Sweden)

    Saied Soflaei

    2012-01-01

    Full Text Available Visceral leishmaniasis is one of the most important sever diseases in tropical and subtropical countries. In the present study the effects of antimony sulfide nanoparticles on Leishmania infantum in vitro were evaluated. Antimony sulfide NPs (Sb2S5 were synthesized by biological method from Serratia marcescens bacteria. Then the cytotoxicity effects of different concentrations (5, 10, 25, 50, and 100 μg/mL of this nanoparticle were assessed on promastigote and amastigote stages of L. infantum. MTT method was used for verification results of promastigote assay. Finally, the percentages of apoptotic, necrotic, and viable cells were determined by flow cytometry. The results indicated the positive effectiveness of antimony sulfide NPs on proliferation of promastigote form. The IC50 (50% inhibitory concentration of antimony sulfide NPs on promastigotes was calculated 50 μg/mL. The cytotoxicity effect was dose-dependent means by increasing the concentration of antimony sulfide NPs, the cytotoxicity curve was raised and the viability curve of the parasite dropped simultaneously. Moreover, the IC50 of antimony sulfide NPs on amastigote stage was calculated 25 μg/mL. On the other hand, however, antimony sulfide NPs have a low cytotoxicity effect on uninfected macrophages but it can induce apoptosis in promastigote stage at 3 of 4 concentrations.

  17. The potential DNA toxic changes among workers exposed to antimony trioxide.

    Science.gov (United States)

    El Shanawany, Safaa; Foda, Nermine; Hashad, Doaa I; Salama, Naglaa; Sobh, Zahraa

    2017-05-01

    Occupational exposure to antimony has gained much interest when specific toxic effects were noticed among workers processing antimony. Thus, the aim of the present work was to investigate the potential DNA oxidative damage occurring among Egyptian workers occupationally exposed to antimony trioxide. The study was conducted on 25 subjects exposed to antimony trioxide while working in the polymerization process of polyester in Misrayon and Polyester Fiber Company, KafrEldawwar, Beheira, Egypt. Urinary antimony levels were assessed using inductive coupled plasma-optical emission spectrometry (ICP-OES) and considered as a biological exposure index. DNA damage and total oxidant capacity (TOC) were assessed using ELISA. DNA damage was detected in the form of increased apurinic/apyrimidinic (AP) sites among antimony trioxide-exposed workers compared to control subjects, but it could not be explained by oxidative mechanisms due to lack of significant correlation between DNA damage and measured TOC. Antimony trioxide might have a genotoxic impact on occupationally exposed workers which could not be attributed to oxidative stress in the studied cases.

  18. Production of 123 I for medical diagnosis application

    International Nuclear Information System (INIS)

    Britto, J.L.Q. de.

    1982-01-01

    A method for production of carrier free 123 I with high radionuclidic purity in which the processing is done remotely was developed at Instituto de Engenharia Nuclear in Rio de Janeiro. The 123 I is produced in the decay of 123 Xe which is obtained through the reaction 122 Te ( 3 He, 2 n) 123 Xe with 30 MeV 3 He beams of IEN's variable energy cyclotron. The irradiated natural Te O 2 target is heated in a furnace at 675 0 C and the diffused out 123 Xe is adsorbed in a copper trap maintained at -196 0 C. The 123 Xe is allowed to decay during 6.3 hours and the 123 I produced washed out of the trap with a 0.1 N solution of NaOH. All the process is remotely controlled by using electric and pneumatic systems as well as manipulators and tongs. The quality control was achieved by atomic absorption and gamma-ray spectroscopy. (author)

  19. Behaviour of antimony during thermal treatment of Sb-rich halogenated waste

    Energy Technology Data Exchange (ETDEWEB)

    Klein, J. [Laboratoire Gestion des Risques et Environnement, 25 rue de Chemnitz, 68200 Mulhouse (France); Dorge, S., E-mail: sophie.dorge@uha.fr [Laboratoire Gestion des Risques et Environnement, 25 rue de Chemnitz, 68200 Mulhouse (France); Trouve, G. [Laboratoire Gestion des Risques et Environnement, 25 rue de Chemnitz, 68200 Mulhouse (France); Venditti, D.; Durecu, S. [TREDI Departement de Recherche, Technopole de Nancy-Brabois, 9 avenue de la Foret de Haye, BP 184, 54505 Vandoeuvre-les-Nancy (France)

    2009-07-30

    Antimony compounds have a wide range of industrial applications, particularly as additives in flame retardants. To ensure environmentally friendly waste incineration of Sb-rich wastes, it is essential to strengthen the knowledge about the fate of antimony and the potential formation of harmful species. Investigations should be conducted particularly in relation with the main operational parameters controlling the process, chiefly temperature, residence time and air supply in the oven and in the post-combustion zone, prior final adapted cleaning of the flue-gas stream. Experimental studies focusing on antimony behaviour were undertaken through laboratory-scale thermal treatment at 850 deg. C and 1100 deg. C of a Sb-rich halogenated waste, originating from the sector of flame retardants formulation. The configuration of our laboratory experimental device allowed to achieve only low oxidative conditions in the waste bed, but high oxidative strength coupled with high temperature and sufficient gas residence time in the post-combustion zone, as prescribed during the incineration of hazardous wastes. Atomic absorption spectroscopy was used to assess the partition of antimony in the different compartments of the process. The oxidation degree of antimony in the gas-phase was determined by the use of electrochemical techniques, namely polarography coupled with anodic stripping voltamperometry. The partition of antimony between the residual ash and the gas-phase under moderate oxidative conditions in the waste bed was constant, whatever the temperature: the volatilization rate for antimony was {approx}64%, while a {approx}36% fraction remained in the residual bottom ashes. But interestingly, while at 850 {sup o}C, antimony was mainly present in the gas-phase at a +III oxidation degree, an increase in temperature of 250 {sup o}C favoured the presence of antimony to its highest oxidation degree +V in the flue-gas stream, a valence known to be involved in less toxic species.

  20. Synthesis, characterisation and electrochemical evaluation of reduced graphene oxide modified antimony nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Silwana, Bongiwe; Horst, Charlton van der [Natural Resources and the Environment (NRE), Council for Scientific and Industrial Research (CSIR), Stellenbosch 7600 (South Africa); SensorLab, Department of Chemistry, University of the Western Cape, Bellville 7535 (South Africa); Iwuoha, Emmanuel [SensorLab, Department of Chemistry, University of the Western Cape, Bellville 7535 (South Africa); Somerset, Vernon, E-mail: vsomerset@csir.co.za [Natural Resources and the Environment (NRE), Council for Scientific and Industrial Research (CSIR), Stellenbosch 7600 (South Africa)

    2015-10-01

    This paper demonstrates some aspects on the synthesis and characterisation of nanoparticles of metallic alloys using polyvinyl alcohol as a stabiliser, which combines high surface area and superior hybrid properties. The present experimental design was to synthesise a nanocomposite of reduced graphene oxide and antimony nanoparticles to be used as thin films for macro- and micro-carbon electrodes for enhancing sensing of different toxic metal pollutants in the environment. The synthetic process of reduced graphene oxide was done using the modified Hummers method while antimony pentachloride was reduced with sodium borohydride into nanoparticles of antimony using polyvinyl-alcohol as a stabiliser. The systematic investigation of morphology was done by scanning electron microscopy and high resolution-transmission electron microscope, which revealed the synthesis of a product, consists of reduced graphene oxide antimony nanoparticles. The electrochemical behaviour of the reduced graphene oxide antimony nanoparticles coated on a glassy carbon electrode was performed using voltammetric and impedance techniques. Electrochemical impedance measurements showed that the overall resistance, including the charge–transfer resistance, was smaller with reduced graphene oxide antimony nanoparticles than reduced graphene oxide and antimony nanoparticles, on their own. Evaluation of the reduced graphene oxide antimony nanoparticle sensor in the stripping voltammetry has shown a linear working range for concentration of platinum (II) between 6.0 × 10{sup −6}–5.4 × 10{sup −5} μg L{sup −1} with limit of detection of 6 × 10{sup −6} μg L{sup −1} (signal-to-noise ratio = 3), which is below the World Health Organisation guidelines for freshwater. - Highlights: • Reduced graphene oxide modified antimony nanoparticles were chemically synthesised. • TEM results show rGO-Sb nanoparticles with a diameter range of between 2 and 20 nm. • Impedance results confirm

  1. An investigation of inorganic antimony species and antimony associated with soil humic acid molar mass fractions in contaminated soils

    International Nuclear Information System (INIS)

    Steely, Sarah; Amarasiriwardena, Dulasiri; Xing Baoshan

    2007-01-01

    The presence of antimony compounds is often suspected in the soil of apple orchards contaminated with lead arsenate pesticide and in the soil of shooting ranges. Nitric acid (1 M) extractable Sb from the shooting range (8300 μg kg -1 ) and the apple orchard (69 μg kg -1 ) had considerably higher surface Sb levels than the control site ( -1 ), and Sb was confined to the top ∼30 cm soil layer. Sb(V) was the principal species in the shooting range and the apple orchard surface soils. Size exclusion chromatography-inductively coupled plasma-mass spectrometry (SEC-ICP-MS) analysis of humic acids isolated from the two contaminated soils demonstrated that Sb has complexed to humic acid molar mass fractions. The results also indicate that humic acids have the ability to arrest the mobility of Sb through soils and would be beneficial in converting Sb(III) to a less toxic species, Sb(V), in contaminated areas. - The soil surface and depth distribution Sb(V) and Sb(III) species in a contaminated apple orchard and a shooting range, and the effect soil humic acids on inorganic antimony species is reported

  2. Varicella zoster virus reactivation during or immediately following treatment of tegumentary leishmaniasis with antimony compounds

    Directory of Open Access Journals (Sweden)

    Andrea Barbieri Barros

    2014-07-01

    Full Text Available Antimony compounds are the cornerstone treatments for tegumentary leishmaniasis. The reactivation of herpes virus is a side effect described in few reports. We conducted an observational study to describe the incidence of herpes zoster reactivation during treatment with antimony compounds. The global incidence of herpes zoster is approximately 2.5 cases per 1,000 persons per month (or 30 cases per 1,000 persons per year. The estimated incidence of herpes zoster in patients undergoing antimony therapy is higher than previously reported.

  3. Antimony(V) and Bismuth(V) Complexes of Lapachol: Synthesis, Crystal Structure and Cytotoxic Activity

    OpenAIRE

    Cynthia Demicheli; Carlos A. de Simone; Frédéric Frézard; Eufrânio N. da Silva Júnior; Cláudio L. Donnici; Elene C. Pereira-Maia; Ludmila G. de Oliveira; Meiriane M. Silva; Flávia C. S. de Paula

    2011-01-01

    Antimony(V) and bismuth(V) complexes of lapachol have been synthesized by the reaction of Ph3SbCl2 or Ph3BiCl2 with lapachol (Lp) and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V) complex is a monomeric derivative, (Lp)(Ph3Sb)OH, and the bismuth(V) complex is a dinuclear compound bridged by an oxygen atom, (Lp)2(Ph3Bi)2O. Both compounds inhibited ...

  4. Investigation of123I production using electron accelerator.

    Science.gov (United States)

    Avetisyan, Albert; Avagyan, Robert; Dallakyan, Ruben; Avdalyan, Gohar; Dobrovolsky, Nikolay; Gavalyan, Vasak; Kerobyan, Ivetta; Harutyunyan, Gevorg

    2017-04-01

    The possibility of 123 I isotope production with the help of the high-intensity bremsstrahlung photons produced by the electron beam of the LUE50 linear electron accelerator at the A.I. Alikhanyan National Science Laboratory (Yerevan Physics Institute [YerPhI]) is considered. The production method has been established and shown to be successful. The 124 Xe(γ,n) 123 Xe→ 123 I nuclear reaction has been investigated and the cross-section was calculated by nuclear codes TALYS 1.6 and EMPIRE 3.2. The optimum parameter of the thickness of the target was determined by GEANT4 code. For the normalized yield of 123 I, the value of 143Bq/(mg·μA·h) has been achieved. Copyright © 2016 Elsevier Inc. All rights reserved.

  5. Investigation of 123I production using electron accelerator

    International Nuclear Information System (INIS)

    Avetisyan, Albert; Avagyan, Robert; Dallakyan, Ruben; Avdalyan, Gohar; Dobrovolsky, Nikolay; Gavalyan, Vasak; Kerobyan, Ivetta; Harutyunyan, Gevorg

    2017-01-01

    The possibility of 123 I isotope production with the help of the high-intensity bremsstrahlung photons produced by the electron beam of the LUE50 linear electron accelerator at the A.I. Alikhanyan National Science Laboratory (Yerevan Physics Institute [YerPhI]) is considered. The production method has been established and shown to be successful. The 124 Xe(γ,n) 123 Xe → 123 I nuclear reaction has been investigated and the cross-section was calculated by nuclear codes TALYS 1.6 and EMPIRE 3.2. The optimum parameter of the thickness of the target was determined by GEANT4 code. For the normalized yield of 123 I, the value of 143 Bq/(mg·μA·h) has been achieved.

  6. Silicon quantum dots with counted antimony donor implants

    Science.gov (United States)

    Singh, Meenakshi; Pacheco, Jose; Perry, Daniel; Wendt, Joel; Manginell, Ronald; Dominguez, Jason; Pluym, Tammy; Luhman, Dwight; Bielejec, Edward; Lilly, Michael; Carroll, Malcolm

    Antimony donor implants next to silicon quantum dots have been detected with integrated solid-state diode detectors with single ion precision. Devices with counted number of donors have been fabricated and low temperature transport measurements have been performed. Charge offsets, indicative of donor ionization and coupling to the quantum dot, have been detected in these devices. The number of offsets corresponds to 10-50% of the number of donors counted. We will report on tunneling time measurements and spin readout measurements on the donor offsets. This work was performed, in part, at the Center for Integrated Nanotechnologies, a U.S. DOE Office of Basic Energy Sciences user facility. The work was supported by Sandia National Laboratories Directed Research and Development Program. Sandia National Laboratories is a multi-program laboratory operated by Sandia Corporation, a Lockheed-Martin Company, for the U. S. Department of Energy under Contract No. DE-AC04-94AL85000.

  7. Fluoride and oxyfluoride compounds and niobium, antimony and tellurium

    International Nuclear Information System (INIS)

    Corbin, Odile.

    1982-02-01

    This paper is a detailed bibliographic report on fluoride and oxyfluoride compounds and niobium, antimony and tellurium oxides. Compounds identified to date are: NbF 3 , NbF 4 , NbF 5 , NbF 6 , NbO 2 F, NbOF 3 , Nb 3 O 7 F, SbF 3 , SbF 5 , SbOF, SbOF 3 , SbO 2 F, Sb 2 O 3 , Sb 2 O 4 , TeF 4 , Te 2 F 10 , TeF 6 , Te 2 OF 10 , Te 3 O 2 F 14 , Te 6 F 26 O 5 , TeO, TeO 2 , TeO 3 . Synthesis processes, physical properties and chemical properties are given for each of the above compounds [fr

  8. Calcium metal as a scavenger for antimony from aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Bonsignore, P.V.; Daniels, E.J.; Wu, C.T.

    1994-10-04

    Previous work has shown that trace amounts of antimony (Sb) can affect the mechanical properties of strontium (Sr) modified aluminum castings. ANL has been investigating technology to remove or neutralize Sb to reduce its negative effect on the physical properties of those alloys. Review of past work on processing and recovery of scrap aluminum inferred that calcium (Ca) is an effective scavenger of Sb, bismuth, lead and cadmium. Following up on that lead, we have found that Ca is, indeed, effective for removing Sb from molten aluminum alloys although its effectiveness can be compromised by a wide range of processing conditions. A minimum ratio of about four to one, by weight, of Ca to Sb appears necessary to insure an effective scavenging of contained Sb.in 356 aluminum alloys.

  9. Antimony Accumulation Risk in Lettuce Grown in Brazilian Urban Gardens

    Directory of Open Access Journals (Sweden)

    Silvia Mancarella

    2016-08-01

    Full Text Available More than 80% of the Brazilian population inhabits urban areas. Diffused poverty and the lack of fresh vegetables have generated malnutrition and unbalanced diets. Thus, the interest in growing food locally, in urban allotments and community gardens, has increased. However, urban agriculture may present some risks caused by the urban pollution. Road traffic is considered the biggest source of heavy metals in urban areas. Hence, the objective of the study was the assessment of the accumulation of heavy metals in an urban garden in the city of Recife, at different distances from a road with high traffic burden. The results showed that the distance from the street decreased the accumulation of many potentially toxic elements. Furthermore, the human health risk was estimated, revealing that greater danger was associated with the accumulation of antimony. Concentration of other elements in the leaf tissues were within previously reported thresholds.

  10. Antimony as a global dilemma: Geochemistry, mobility, fate and transport.

    Science.gov (United States)

    Herath, Indika; Vithanage, Meththika; Bundschuh, Jochen

    2017-04-01

    Elevated concentrations of antimony (Sb) in environmental, biological and geochemical systems originating from natural, geological and anthropogenic sources are of particular global concern. This review presents a critical overview of natural geochemical processes which trigger the mobilization of Sb from its host mineral phases and related rocks to the surrounding environments. The primary source of Sb contamination in the environment is geogenic. The geochemical characteristics of Sb are determined by its oxidation states, speciation and redox transformation. Oxidative dissolution of sulfide minerals and aqueous dissolution are the most prevalent geochemical mechanisms for the release of Sb to the environment. Transformation of mobile forms of Sb is predominantly controlled by naturally occurring precipitation and adsorption processes. Oxyhydroxides of iron, manganese and aluminum minerals have been recognized as naturally occurring Sb sequestrating agents in the environment. Antimony is also immobilized in the natural environment via precipitation with alkali and heavy metals resulting extremely stable mineral phases, such as schafarzikite, tripuhyite and calcium antimonates. Many key aspects, including detection, quantification, and speciation of Sb in different environmental systems as well as its actual human exposure remain poorly understood. Identification of global distribution of most vulnerable Sb-contaminated regions/countries along with aquifer sediments is an urgent necessity for the installation of safe drinking water wells. Such approaches could provide the global population Sb-safe drinking and irrigation water and hinder the propagation of Sb in toxic levels through the food chain. Hence, raising awareness through the mobility, fate and transport of Sb as well as further transdisciplinary research on Sb from global scientific communities will be a crucial stage to establish a sustainable Sb mitigation on a global scale. Copyright © 2017 Elsevier

  11. NEW THIO S2- ADDUCTS WITH ANTIMONY (III AND V HALIDE: SYNTHESIS AND INFRARED STUDY

    Directory of Open Access Journals (Sweden)

    HASSAN ALLOUCH

    2013-12-01

    Full Text Available Five new S2- adducts with SbIII and SbV halides have been synthesized and studied by infrared. Discrete structures have been suggested, the environment around the antimony being tetrahedral, trigonal bipyramidal or octahedral.

  12. Antimony-based focal plane arrays for shortwave-infrared to visible applications, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose to develop antimony-based focal plane arrays (FPAs) for NASA's imaging and spectroscopy applications in the spectral band from visible to...

  13. Antimony-Based Focal Plane Arrays for Shortwave-Infrared to Visible Applications, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose to develop antimony-based focal plane arrays (FPAs) for NASA's imaging and spectroscopy applications in the spectral band from visible to...

  14. Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

    International Nuclear Information System (INIS)

    Bajo, S.; Wyttenbach, A.

    1978-03-01

    The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

  15. Exposure to antimony from polyethylene terephthalate (PET) trays used in ready-to-eat meals.

    Science.gov (United States)

    Haldimann, M; Blanc, A; Dudler, V

    2007-08-01

    Antimony residues, a result of the use of a polycondensation catalyst in the production of polyethylene terephthalate (PET) oven-proof trays, were analysed in ready-to-eat meals. The toxicity of antimony has raised concerns about consumer safety; therefore, the migration of small fractions of these residues into ready meals and foods as a result of cooking directly in the PET trays was studied. A straightforward approach of measuring real samples was selected to obtain accurate exposure data. Background antimony concentration was determined separately from a series of lunch meals, which ranged from not detectable to 3.4 microg kg(-1). Microwave and conventional oven-cooking caused a distinct increase in the concentration of antimony in food and ready meals of 0-17 and 8-38 microg kg(-1), respectively, depending, to a certain extent, on the industrial preparations. The migrated quantities of antimony corresponded to 3-13 microg. For comparison, PET roasting bags and ready-made dough products in PET baking dishes were also evaluated. About half of the products prepared at a temperature of 180 degrees C exceeded the specific migration limit set for food contact material by the European Commission. However, the migrated amounts of antimony relative to the accepted tolerable daily intake (TDI) show that exposure from this type of food is currently not of toxicological concern.

  16. /sup 123/I research and production at Brookhaven

    Energy Technology Data Exchange (ETDEWEB)

    Mausner, L.F.; Srivastava, S.C.; Mirzadeh, S.; Meinken, G.E.; Prach, T.

    1985-01-01

    The procedures for preparing high purity /sup 123/I at the BLIP using the /sup 127/I(p,5n)/sup 123/Xe reaction on an NaI target are described. The activity is supplied in a glass ampoule with anhydrous /sup 123/I deposited on the interior walls, allowing maximum flexibility in subsequent iodinations. Preliminary experience with a continuous flow target is also described. The results of a series of measurements of specific activity by neutron activation, x-ray fluorescence, uv absorption, and wet chemistry generally showed no detectable carrier. HPLC methods to analyse the chemical form of radioiodine and to characterize various iodinated radiopharmaceuticals have been developed. These methods provide higher sensitivity, speed and resolution than commonly used techniques. 19 refs., 6 figs., 2 tabs.

  17. Simulation of antimony adsorption on nano-zero valent iron and kaolinite and analyzing the influencing parameters.

    Science.gov (United States)

    Saeidnia, Setareh; Asadollahfardi, Gholamreza; Darban, Ahmad Khodadadi; Mohseni, Mehdi

    2016-01-01

    Antimony is one of the most toxic pollutants in industrial and mineral wastewaters threatening the life of humans and other creatures. We simulated the adsorption of antimony in the presence of nano-zero valent iron (nZVI) adsorbent, on kaolinite and in the presence of nZVI coated on kaolinite from mineral wastewater using VISUAL MINTEQ 3.1 software. Our aim was to determine the factors affecting the adsorption of antimony by applying simulation. The simulation was performed using an adsorption model of a diffuse layer model. The results of the simulation indicated that the nZVI concentration, initial concentrations of antimony and pH factor are effective on the adsorption of antimony. In the conducted stimulation, the optimum pH was 2-5 and the highest adsorption occurred in an acidic state. With increasing initial concentrations of antimony in the simulation, we concluded that nZVI had absorbed various concentrations above 90% and, by increasing the concentration of nZVI, antimony adsorption rate increased. The increased surface area of nZVI and the expansion of more interchangeable surfaces available for reaction with antimony ions causes more antimony ions to be adsorbed. In all cases, the coefficient of determination between the laboratory results and the model predictions that was obtained was more than 0.9.

  18. Method of purifying a gas stream using 1,2,3-triazolium ionic liquids

    Science.gov (United States)

    Luebke, David; Nulwala, Hunald; Tang, Chau

    2014-12-09

    A method for separating a target gas from a gaseous mixture using 1,2,3-triazolium ionic liquids is presented. Industrial effluent streams may be cleaned by removing carbon dioxide from the stream by contacting the effluent stream with a 1,2,3-triazolium ionic liquid compound.

  19. Effects of [123I]ADAM, a serotonin transporter radiopharmaceutical, on pregnant Sprague–Dawley rats

    International Nuclear Information System (INIS)

    Chang, K.W.; Lin, M.C.; Lee, S.Y.; Chen, H.Y.; Chen, C.C.; Fu, Y.K.

    2012-01-01

    Serotonin transport abnormalities are implicated in neuropsychiatric disorders. [ 123 I]ADAM ([ 123 I]-2-([2-({dimethylamino}methyl)phenyl]thio)-5-iodophenylamine) is a novel radiotracer that targets serotonin transporters. We assessed the toxicity of [ 123 I]ADAM (18.5 MBq) administered in early- and late-phases (8 and 14 day postfertilization, respectively) of pregnancy. The mortality, clinical status, and gross necropsy were measured in pregnant rats, and the fertility index was measured in rat offspring (weight, clinical observations). We found no dosing-related clinical signs. In conclusion, [ 123 I]ADAM was not toxic in an animal pregnancy model.

  20. Synthesis, antitumor activity, and cytotoxicity of 4-substituted 1-benzyl-5-diphenylstibano-1H-1,2,3-triazoles.

    Science.gov (United States)

    Yamada, Mizuki; Takahashi, Tsutomu; Hasegawa, Mai; Matsumura, Mio; Ono, Kanna; Fujimoto, Ryota; Kitamura, Yuki; Murata, Yuki; Kakusawa, Naoki; Tanaka, Motohiro; Obata, Tohru; Fujiwara, Yasuyuki; Yasuike, Shuji

    2018-01-15

    Trisubstituted 5-organostibano-1H-1,2,3-triazoles (3a-f) were synthesized by the Cu-catalyzed azide-alkyne cycloaddition of various ethynylstibanes (1) with benzylazide (2) in the presence of CuBr (5 mol%) under aerobic conditions. The reaction of 5-stibanotriazoles with HCl afforded C5-unsubstituted 1,2,3-triazoles (4a-f). The antitumor activity of trisubstituted 5-organostibano-1H-1,2,3-triazoles (3a-f) and their 5-unsubstituted 1,2,3-triazoles (4a-f) were evaluated in several tumor cell lines. All 5-stibanotriazoles (3a-f) exerted an excellent antitumor activity. On the contrary, 5-unsubstituted 1,2,3-triazoles (4a-f) without a diphenylantimony group in the molecule exhibited very low antitumor activity compared with 5-stibanotriazoles (3a-f). In compounds of both the series, the substituted 4-butyl group appeared to decrease antitumor activity. However, results suggested that organometal (antimony) in the molecule was required for greater antitumor activity. In addition, all 5-stibanotriazoles (3a-f), but not all 5-unsubstituted 1,2,3-triazoles (4a-f), exhibited cytotoxicity in normal vascular endothelial cells derived from bovine aorta. Among the compounds (3b-e) that exhibited excellent antitumor activity, those with 4-methylphenyl (3b) and 1-cyclohexenyl (3e) showed relatively low cytotoxicity to vascular endothelial cells. Together, these results suggest that trisubstituted 5-organostibano-1H-1,2,3-triazoles, including compounds 3b and 3e, may serve as potential anticancer therapeutic drugs in the future. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. New fluorescent polymeric nanocomposites synthesized by antimony dodecyl-mercaptide thermolysis in polymer

    Directory of Open Access Journals (Sweden)

    2009-04-01

    Full Text Available In this work, the formation of semiconductive Sb2S3 nanoparticles inside amorphous polystyrene has been achieved by thermal degradation of the corresponding antimony dodecyl-mercaptide, Sb(SC12H253. The thermolysis of the dodecyl-mercaptide precursor was studied as both pure phase and mercaptide solution in polystyrene. The thermal decomposition of the antimony mercaptide precursor at 350°C, under vacuum, showed the formation of a mixture of antimony trisulfide (stibnite, Sb2S3 and zero-valent antimony (Sb phase. X-ray Powder Diffraction (XRD and Rietveld analysis carried out on the obtained nanostructured powder confirmed the presence of Sb and Sb2S3 phases in 10.4 wt% and 89.6 wt% amount, respectively. The same pyrolysis reaction was carried out in the polymer and the resulting nanocomposite material was characterized by X-ray diffraction (XRD, transmission electron microscopy (TEM, UV-VIS spectroscopy, and fluorescence spectroscopy. The nanocomposite structural characterization indicated the presence of well-dispersed nanoclusters of antimony and stibnite (15–30 nm in size inside the amorphous polymeric phase. Optical measurements on the obtained nanocomposite films showed a strong emission at 432 nm upon excitation at 371 nm, probably related to the presence of Sb2S3 nanoclusters.

  2. Predictors of an unsatisfactory response to pentavalent antimony in the treatment of American visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Santos Mácia A.

    2002-01-01

    Full Text Available Although treatment of visceral leishmaniasis with pentavalent antimony is usually successful, some patients require second-line drug therapy, most commonly with amphotericin B. To identify the clinical characteristics that predict an inadequate response to pentavalent antimony, a case-control study was undertaken in Teresina, Piaui, Brazil. Over a two-year period, there were 19 cases of VL in which the staff physicians of a hospital prescribed second-line therapy with amphotericin B after determining that treatment with pentavalent antimony had failed. The control group consisted of 97 patients that were successfully treated with pentavalent antimony. A chart review using univariate and multivariate analysis was performed. The cure rate was 90% with amphotericin B. The odds ratio for the prescription of amphotericin B was 10.2 for children less than one year old, compared with individuals aged over 10 years. Patients who presented coinfection had an OR of 7.1 while those on antibiotics had an OR of 2.8. These data support either undertaking a longer course of therapy with pentavalent antimony for children or using amphotericin B as a first-line agent for children and individuals with coinfections. It also suggests that chemoprophylaxis directed toward bacterial coinfection in small children with VL may be indicated.

  3. Mixed Antimony(V Complexes with Different Sugars to Modulate the Oral Bioavailability of Pentavalent Antimonial Drugs

    Directory of Open Access Journals (Sweden)

    Weverson A. Ferreira

    2014-04-01

    Full Text Available Previous studies have shown that the association of the drug meglumine antimoniate (MA with β-cyclodextrin can improve its bioavailability by the oral route. In this work, ribose and maltose were investigated for their ability to form mixed or association complexes with MA, release MA and modulate the serum levels of Sb after oral administration in mice. Analysis of the MA/ribose composition by high performance liquid chromatography coupled to mass spectrometry (LCMS-IT-TOF revealed the presence of mixed meglumine-Sb-ribose and Sb-ribose complexes. Analysis of the MA/maltose composition suggested the formation of MA-maltose association compounds. Circular dichroism characterization of these compositions following dilution in water at 37 °C suggested a partial and slow dissociation of the association compounds. When the MA/ribose composition was administered orally and compared to MA, the serum concentration of Sb was significantly lower after 1 h and greater after 3 h. On the other hand, the MA/maltose composition showed similar serum Sb concentration after 1 h and higher level of Sb after 3 h, when compared to MA. In conclusion, the present study has demonstrated the formation of mixed or association complexes of MA with sugars, such as maltose and ribose, which promoted sustained serum level of Sb after oral administration.

  4. A comparative study of antimony accumulation in plants growing in two mining areas in Iran, Moghanlo, and Patyar

    NARCIS (Netherlands)

    Hajiani, N.J.; Ghaderian, S.M.; Karimi, N.; Schat, H.

    2015-01-01

    Antimony occurs locally at high concentrations in some mineralized soils. Very little is known about behavior of antimony in plants. In this study, we analyzed the soil and vegetation of two mining areas in Iran, Patyar, and Moghanlo. Total Sb concentrations in soil were 358–3482 mg/kg in Moghanlo

  5. Study of upscaling possibilities for antimony sulfide solid state sensitized solar cells

    Science.gov (United States)

    Nikolakopoulou, Archontoula; Raptis, Dimitrios; Dracopoulos, Vasilios; Sygellou, Lamprini; Andrikopoulos, Konstantinos S.; Lianos, Panagiotis

    2015-03-01

    Solid state solar cells of inverted structure were constructed by successive deposition of nanoparticulate titania, antimony sulfide sensitizer and P3HT on FTO electrodes with PEDOT:PSS:Ag as counter electrode. Sensitized photoanode electrodes were characterized by XRD, Raman, XPS, FESEM and UV-vis. Small laboratory scale cells were first constructed and optimized. Functional cells were obtained by annealing the antimony sulfide film either in air or in inert atmosphere. High short-circuit currents were recorded in both cases with air-annealed sample producing more current but lower voltage. Small unit cells were combined to form cell modules. Connection of unit cells in parallel increased current but not proportionally to that of the unit cell. Connection in series preserved current and generated voltage multiplication. Cells were constructed and studied under ambient conditions, without encapsulation. The results encourage upscaling of antimony sulfide solar cells.

  6. Anodic stripping voltammetry of antimony using gold nanoparticle-modified carbon screen-printed electrodes

    International Nuclear Information System (INIS)

    Dominguez Renedo, Olga; Arcos Martinez, M. Julia

    2007-01-01

    Carbon screen-printed electrodes (CSPE) modified with gold nanoparticles present an interesting alternative in the determination of antimony using differential pulse anodic stripping voltammetry. Metallic gold nanoparticles deposits have been obtained by direct electrochemical deposition. Scanning electron microscopy measurements show that the electrochemically synthesized gold nanoparticles are deposited in aggregated form. Any undue effects caused by the presence of foreign ions in the solution were also analyzed to ensure that common interferents in the determination of antimony by ASV. The detection limit for Sb(III) obtained was 9.44 x 10 -10 M. In terms of reproducibility, the precision of the above mentioned method in %R.S.D. values was calculated at 2.69% (n = 10). The method was applied to determine levels of antimony in seawater samples and pharmaceutical preparations

  7. Conceptual design for treatment of mining and metallurgical wastewaters which contains arsenic and antimony

    Directory of Open Access Journals (Sweden)

    Željko Kamberović

    2012-12-01

    Full Text Available This paper presents a preliminary design for treatment of mining and metallurgical wastewaters (MMW from the basin of antimony “Zajača“, which contains high concentrations of arsenic and antimony. MMW have been investigated in laboratory, due to large difference in concentrations of pollutants. Metallurgical wastewaters were treated using iron (II-sulfate and lime milk used to adjust the pH value at 7. After chemical treatment of metallurgical wastewater and its joining with mining wastewater, residual amount of arsenic in water was below maximum allowed concentrations, while the concentration of antimony, remained above the maximum allowed value. The final phase of purification process was performed using ion exchange resin. After treatment of MMW, they can be used as technical water in the smelting process of secondary raw lead materials.

  8. Enhanced Photoelectrochemical Response from Copper Antimony Zinc Sulfide Thin Films on Transparent Conducting Electrode

    Directory of Open Access Journals (Sweden)

    Prashant K. Sarswat

    2013-01-01

    Full Text Available Copper antimony sulfide (CAS is a relatively new class of sustainable absorber material, utilizing cost effective and abundant elements. Band gap engineered, modified CAS thin films were synthesized using electrodeposition and elevated temperature sulfurization approach. A testing analog of copper zinc antimony sulfide (CZAS film-electrolyte interface was created in order to evaluate photoelectrochemical performance of the thin film of absorber materials. Eu3+/Eu2+ redox couple was selected for this purpose, based on its relative band offset with copper antimony sulfide. It was observed that zinc has a significant effect on CAS film properties. An enhanced photocurrent was observed for CAS film, modified with zinc addition. A detailed investigation has been carried out by changing stoichiometry, and corresponding surface and optical characterization results have been evaluated. A summary of favorable processing parameters of the films showing enhanced photoelectrochemical response is presented.

  9. Antimony(V) and bismuth(V) complexes of lapachol: synthesis, crystal structure and cytotoxic activity.

    Science.gov (United States)

    Oliveira, Ludmila G de; Silva, Meiriane M; Paula, Flávia C S de; Pereira-Maia, Elene C; Donnici, Cláudio L; Simone, Carlos A de; Frézard, Frédéric; Silva, Eufrânio N da; Demicheli, Cynthia

    2011-12-13

    Antimony(V) and bismuth(V) complexes of lapachol have been synthesized by the reaction of Ph₃SbCl₂ or Ph₃BiCl₂ with lapachol (Lp) and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V) complex is a monomeric derivative, (Lp)(Ph₃Sb)OH, and the bismuth(V) complex is a dinuclear compound bridged by an oxygen atom, (Lp)₂(Ph₃Bi)₂O. Both compounds inhibited the growth of a chronic myelogenous leukemia cell line and the complex of Bi(V) was about five times more active than free lapachol. This work provides a rare example of an organo-Bi(V) complex showing significant cytotoxic activity.

  10. Antimony(V and Bismuth(V Complexes of Lapachol: Synthesis, Crystal Structure and Cytotoxic Activity

    Directory of Open Access Journals (Sweden)

    Cynthia Demicheli

    2011-12-01

    Full Text Available Antimony(V and bismuth(V complexes of lapachol have been synthesized by the reaction of Ph3SbCl2 or Ph3BiCl2 with lapachol (Lp and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V complex is a monomeric derivative, (Lp(Ph3SbOH, and the bismuth(V complex is a dinuclear compound bridged by an oxygen atom, (Lp2(Ph3Bi2O. Both compounds inhibited the growth of a chronic myelogenous leukemia cell line and the complex of Bi(V was about five times more active than free lapachol. This work provides a rare example of an organo-Bi(V complex showing significant cytotoxic activity.

  11. Genotoxicity studies of heavy metals: lead, bismuth, indium, silver and antimony.

    Science.gov (United States)

    Asakura, Keiko; Satoh, Hiroshi; Chiba, Momoko; Okamoto, Masahide; Serizawa, Koji; Nakano, Makiko; Omae, Kazuyuki

    2009-01-01

    Many kinds of heavy metals are used in industry; thus, it is important for us to clarify their toxicity. For example, lead, which is a component of solder, is notorious for its neurotoxicity, and substitute materials have been sought for many years. Therefore, we examined the genotoxicity of lead and also those of metallic bismuth, indium, silver and antimony which are possible substitutes for lead in solder. Bacterial reverse mutation tests and chromosomal aberration tests in cultured mammalian cells were performed according to standard procedures. Antimony showed genotoxicity in both tests, and bismuth also showed positive results in the chromosomal aberration test. In contrast, lead, indium, and silver were considered to be inactive by the criteria of the present study. Although further studies are needed because of the difficulty of genotoxicity evaluation using an in vitro system, sufficient precautions should be made when antimony and bismuth are used.

  12. Iodine-123 in Western Europe

    International Nuclear Information System (INIS)

    Qaim, S.M.; Stoecklin, G.; Weinreich, R.

    1976-08-01

    The major object of this panel was to obtain information on the state of art of Iodine-123 production in Western Europe. Technical, medical and organizational problems were discussed extensively during the one-day meeting and a stimulating exchange of information between the various 123 I-producers and users has been initiated. Some specific examples of medical application were also included in order to get a feeling of the degree of acceptance by the medical community and the demand for this isotope. The meeting clearly demonstrated the great demand for this isotope but it also showed that the present rate of production is well below the demand. In order to fill this gap, not only further technical development is needed but also the organizational question of distribution has to be solved, perhaps within a network of collaborating cyclotrons, a task which is considerably more difficult in Western Europe than in the USA. (orig./HP) [de

  13. 32 CFR 701.123 - PA fees.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false PA fees. 701.123 Section 701.123 National... DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.123 PA fees. The PA fee schedule is only applicable... PA system of record. DON activities receiving requests under PA, FOIA, or PA/FOIA shall only charge...

  14. 22 CFR 123.2 - Import jurisdiction.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Import jurisdiction. 123.2 Section 123.2 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS LICENSES FOR THE EXPORT OF DEFENSE ARTICLES § 123.2 Import jurisdiction. The Department of State regulates the temporary import of...

  15. 40 CFR 123.29 - Prohibition.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Prohibition. 123.29 Section 123.29 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS STATE PROGRAM REQUIREMENTS State Program Submissions § 123.29 Prohibition. State permit programs shall provide that no permit...

  16. 21 CFR 163.123 - Sweet chocolate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet chocolate. 163.123 Section 163.123 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.123 Sweet chocolate. (a) Description. (1) Sweet chocolate is the solid or semiplastic food prepared by intimately mixing and grinding...

  17. 7 CFR 1280.123 - State.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false State. 1280.123 Section 1280.123 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Definitions § 1280.123 State. State means each of the 50 States and the District of Columbia. ...

  18. 40 CFR 123.61 - Approval process.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Approval process. 123.61 Section 123... REQUIREMENTS Program Approval, Revision, and Withdrawal § 123.61 Approval process. (a) After determining that a...; and (6) Briefly outline the fundamental aspects of the State's proposed program, and the process for...

  19. 40 CFR 61.123 - Emission testing.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Emission testing. 61.123 Section 61.123... Elemental Phosphorus Plants § 61.123 Emission testing. (a) Each owner or operator of an elemental phosphorus... annually thereafter. The Administrator may temporarily or permanently waive the annual testing requirement...

  20. 50 CFR 648.123 - Gear restrictions.

    Science.gov (United States)

    2010-10-01

    ... limited to, nets, net strengtheners, ropes, lines, or chafing gear, on the top of the regulated portion of... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Gear restrictions. 648.123 Section 648.123... § 648.123 Gear restrictions. (a) Trawl vessel gear restrictions—(1) Minimum mesh size. No owner or...

  1. 34 CFR 668.123 - Collection.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Collection. 668.123 Section 668.123 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION... Program Review Determinations § 668.123 Collection. To the extent that the decision of the Secretary...

  2. 10 CFR 71.123 - Test control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 71.123 Section 71.123 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PACKAGING AND TRANSPORTATION OF RADIOACTIVE MATERIAL Quality Assurance § 71.123 Test control. The licensee, certificate holder, and applicant for a CoC shall establish a test...

  3. 21 CFR 123.10 - Training.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Training. 123.10 Section 123.10 Food and Drugs... CONSUMPTION FISH AND FISHERY PRODUCTS General Provisions § 123.10 Training. At a minimum, the following functions shall be performed by an individual who has successfully completed training in the application of...

  4. Industrial system for producing iodine-123

    International Nuclear Information System (INIS)

    Brantley, J.C.

    1985-01-01

    An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments

  5. 29 CFR 570.123 - Agriculture.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is so...

  6. On-line lab-in-syringe cloud point extraction for the spectrophotometric determination of antimony.

    Science.gov (United States)

    Frizzarin, Rejane M; Portugal, Lindomar A; Estela, José M; Rocha, Fábio R P; Cerdà, Victor

    2016-02-01

    Most of the procedures for antimony determination require time-consuming sample preparation (e.g. liquid-liquid extraction with organic solvents), which are harmful to the environment. Because of the high antimony toxicity, a rapid, sensitive and greener procedure for its determination becomes necessary. The goal of this work was to develop an analytical procedure exploiting for the first time the cloud point extraction on a lab-in-syringe flow system aiming at the spectrophotometric determination of antimony. The procedure was based on formation of an ion-pair between the antimony-iodide complex and H(+) followed by extraction with Triton X-114. The factorial design showed that the concentrations of ascorbic acid, H2SO4 and Triton X-114, as well as second and third order interactions were significant at the 95% confidence level. A Box-Behnken design was applied to obtain the response surfaces and to identify the critical values. System is robust at the 95% confidence level. A linear response was observed from 5 to 50 µg L(-1), described by the equation A=0.137+0.050C(Sb) (r=0.998). The detection limit (99.7% confidence level), the coefficient of variation (n=5; 15 µg L(-1)) and the sampling rate was estimated at 1.8 µg L(-1), 1.6% and 16 h(-1), respectively. The procedure allows quantification of antimony in the concentrations established by environmental legislation (6 µg L(-1)) and it was successfully applied to the determination of antimony in freshwater samples and antileishmanial drugs, yielding results in agreement with those obtained by HGFAAS at the 95% confidence level. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. Purity and crystallinity of microwave synthesized antimony sulfide microrods

    Energy Technology Data Exchange (ETDEWEB)

    Martínez-Alonso, Claudia, E-mail: claudiamartinezalonso30@gmail.com [Facultad de Química, Universidad Autónoma de Querétaro, Querétaro, Querétaro, 76010 (Mexico); Olivos-Peralta, Eliot U. [Instituto de Energías Renovables, Universidad NacionalAutónoma de México, Temixco, Morelos, 62580 (Mexico); Sotelo-Lerma, Mérida [Universidad de Sonora, Hermosillo, Sonora, 83000 (Mexico); Sato-Berrú, Roberto Y. [Centro de Ciencias Aplicadas y Desarrollo Tecnológico, Universidad Nacional Autónoma de México, MéxicoD.F., 04510 (Mexico); Mayén-Hernández, S.A. [Facultad de Química, Universidad Autónoma de Querétaro, Querétaro, Querétaro, 76010 (Mexico); Hu, Hailin, E-mail: hzh@ier.unam.mx [Instituto de Energías Renovables, Universidad NacionalAutónoma de México, Temixco, Morelos, 62580 (Mexico)

    2017-01-15

    Antimony sulfide (Sb{sub 2}S{sub 3}) is a promising semiconductor material for solar cell applications. In this work, microrods of Sb{sub 2}S{sub 3} were synthesized by microwave heating with different sulfur sources, solvents, temperature, heating rate, power, and solution concentration. It was found that 90% of stoichiometric Sb{sub 2}S{sub 3} can be obtained with thiourea (TU) or thioacetamide (TA) as sulfur sources and that their optical band gap values were within the range of 1.59–1.60 eV. The most crystalline Sb{sub 2}S{sub 3} were obtained by using TU. The morphology of the Sb{sub 2}S{sub 3} with TU the individual rods were exhibited, whereas rods bundles appeared in TA-based products. The solvents were ethylene glycol (EG) and dimethylformamide (DMF). EG generates more heat than DMF during the microwave synthesis. As a result, the Sb{sub 2}S{sub 3} obtained with EG contained a larger percentage of oxygen and smaller crystal sizes compared to those from DMF. On the other hand, the length and diameter of Sb{sub 2}S{sub 3} microrods can be increased by applying higher heating power although the crystal size did not change at all. In summary, pure and highly crystalline Sb{sub 2}S{sub 3} microrods of 6–10 μm long and 330–850 nm in diameter can be obtained by the microwave method with a careful selection of chemical and thermodynamic parameters of the synthesis. - Highlights: • Purity up to 90% of crystalline Sb{sub 2}S{sub 3} nanorods can be obtained by microwave heating. • The combination of solvent and sulfide type affects crystallinity & purity of Sb2S3. • The high pressure generated in microwave heating helps to form Sb{sub 2}S{sub 3} nanorods.

  8. Levels and risk factors of antimony contamination in human hair from an electronic waste recycling area, Guiyu, China.

    Science.gov (United States)

    Huang, Yue; Ni, Wenqing; Chen, Yaowen; Wang, Xiaoling; Zhang, Jingwen; Wu, Kusheng

    2015-05-01

    The primitive electronic waste (e-waste) recycling has brought a series of environmental pollutants in Guiyu, China. Antimony is one of the important metal contaminants and has aroused the global concerns recently. We aimed to investigate concentrations of antimony in human hair from Guiyu and compared them with those from a control area where no e-waste recycling exists, and assessed the potential risk factors. A total of 205 human hair samples from Guiyu and 80 samples from Jinping were collected for analysis. All volunteers were asked to complete a questionnaire including socio-demographic characteristics and other possible factors related to hair antimony exposure. The concentrations of hair antimony were analyzed using atomic absorption spectrophotometer. Our results indicated that the level of hair antimony in volunteers from Guiyu (median, 160.78; range, 6.99-4412.59 ng/g) was significantly higher than those from Jinping (median, 61.74; range, 2.98-628.43 ng/g). The residents who engaged in e-waste recycling activities in Guiyu had higher hair antimony concentrations than others (P waste recycling. Multiple stepwise regression analysis indicated that hair antimony concentrations were associated with education level (β = -0.064), the time of residence in Guiyu (β = 0.112), living house also served as e-waste workshop (β = 0.099), the work related to e-waste (β = 0.169), and smoking (β = 0.018). The elevated hair antimony concentrations implied that the residents in Guiyu might be at high risk of antimony contamination, especially the e-waste recycling workers. Work related to e-waste recycling activities and long-time residence in Guiyu contributed to the high hair antimony exposure.

  9. Automated system for separation and distribution of 123I according to the GMP requirements

    International Nuclear Information System (INIS)

    Szucs, Z.; Szadai, J.; Isza, S.; Hegyesi, Gy.; Isza, P.; Kovacs, Z.

    2006-01-01

    The radioisotope of 123 I is routinely used in nuclear medicine, especially for SPECT imaging. The chemical separation of the produced radioisotope from the irradiated 123 Te target is based on the volatile behaviour of the iodine in high temperature. However, in this case, high attention and perfect operations are required from the staff. Therefore we have developed a PC-controlled automated system for dry distillation of 123 I from the irradiated target material and for its dispensation to pre-decided users. The main goal was, besides avoiding the error from human handling, to fulfill the regulations of the Good Manufacturing Practice (GMP) and the personal dosimetric aspect

  10. Systemic Meglumine Antimoniate in Cutaneous Leishmaniasis of Children: Clinical and Laboratory Complications.

    Science.gov (United States)

    Layegh, Pouran; Khademi, Zeinab; Afzal Aghaee, Monavar; Moghiman, Toktam

    2015-12-01

    Children account for 7%-20% of cutaneous leishmaniasis cases in Iran, but there are few safety data to guide pediatric antiparasitic therapy. We evaluated the clinical and laboratory tolerance of the systemic pentavalent antimonial compound meglumine antimoniate, in 70 Iranian children with cutaneous leishmaniasis. Adverse effects were similar to those seen in adults. © The Author 2014. Published by Oxford University Press on behalf of the Pediatric Infectious Diseases Society. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  11. Redox speciation analysis of antimony in soil extracts by hydride generation atomic fluorescence spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Fuentes, Edwar; Pinochet, Hugo; Gregori, Ida de E-mail: idegrego@ucv.cl; Potin-Gautier, Martine

    2003-07-18

    A sensitive atomic spectrometric method for the redox speciation analysis of antimony in soils is described. The method is based on the selective generation of stibine from Sb(III) in a continuous flow system using atomic fluorescence spectrometry for detection. Sb(V) is masked by citric or oxalic acid in HCl medium. The procedure was optimized with synthetic solutions of Sb(III) and Sb(V). The effect of carboxylic acid and HCl concentration on the recovery of Sb(III) and Sb(V) species from standard solutions, and on the fluorescence signal were studied. Both species were extracted from soil with H{sub 2}O, 0.05 mol l{sup -1} EDTA and 0.25 mol l{sup -1} H{sub 2}SO{sub 4}. Since the soil samples were collected from sites impacted by copper mining activities, the effect of Cu{sup 2+} on the determination of antimony in synthetic solutions and soil extracts was studied. Cu{sup 2+} decreased the Sb(III) signal, but had no effect on the total antimony determination. Therefore, the selective determination of Sb(III) was carried out in citric acid-HCl medium, using the analyte addition technique. Total antimony in soil extracts was determined using the standard calibration technique after reducing Sb(V) to Sb(III) at room temperature with KI-ascorbic acid. The Sb(V) concentration was calculated from the difference between total antimony and Sb(III). The limits of detection (PS Analytical, Excalibur Millennium model) were 17 and 10 ng l{sup -1} for Sb(III) and total antimony, respectively, and the R.S.D. at the 0.5-{mu}g l{sup -1} level were 2.5 and 2.4%, respectively. The total antimony concentration of soils is in the mg kg{sup -1} range; the Sb recovery from the different soils by the extracting solutions was between less than 0.02% and approximately 10%. Similar recoveries were obtained using EDTA and sulfuric acid solutions. Sb(V) was found to be the main antimony species extracted from soils.

  12. Co-doping with antimony to control phosphorous diffusion in germanium

    KAUST Repository

    Tahini, H. A.

    2013-02-15

    In germanium, phosphorous and antimony diffuse quickly and as such their transport must be controlled in order to design efficient n-typed doped regions. Here, density functional theory based calculations are used to predict the influence of double donor co-doping on the migration activation energies of vacancy-mediated diffusion processes. The migration energy barriers for phosphorous and antimony were found to be increased significantly when larger clusters involving two donor atoms and a vacancy were formed. These clusters are energetically stable and can lead to the formation of even larger clusters involving a number of donor atoms around a vacancy, thereby affecting the properties of devices.

  13. Reaction of Antimony-Uranium Composite Oxide in the Chlorination Treatment of Waste Catalyst - 13521

    International Nuclear Information System (INIS)

    Sawada, Kayo; Hirabayashi, Daisuke; Enokida, Youichi

    2013-01-01

    The effect of oxygen gas concentration on the chlorination treatment of antimony-uranium composite oxide catalyst waste was investigated by adding different concentrations of oxygen at 0-6 vol% to its chlorination agent of 0.6 or 6 vol% hydrogen chloride gas at 1173 K. The addition of oxygen tended to prevent the chlorination of antimony in the oxide. When 6 vol% hydrogen chloride gas was used, the addition of oxygen up to 0.1 vol% could convert the uranium contained in the catalyst to U 3 O 8 without any significant decrease in the reaction rate compared to that of the treatment without oxygen. (authors)

  14. Renal function study using I-123-OIH

    International Nuclear Information System (INIS)

    Yamashita, Masato; Osaka, Yosio; Aikawa, Ichiro

    1989-01-01

    Twenty-eight renal function studies were performed in 24 patients with renal diseases with I-123 orthoiodohippurate (I-123 OIH). Neither side effects nor abnormal laboratory values were attributable to I-123 OIH. Imaging with Tc-99m diethylene triaminepentaacetic acid (DTPA) was also performed in 20 patients within one week after I-123 imaging. Findings with I-123 OIH and Tc-99m DTPA were similar in all except for two patients. The two patients had received cadaveric renal transplantation. One patient presented with acute tubular necrosis and the other with chronic renal rejection. In these patients, I-123 imaging showed vascular stricture and Tc-99m imaging showed a decreased glomerular function. Because I-123 OIH and Tc-99m DTPA had different pharmacodynamics, combined use of the two imaging agents may be useful in evaluating renal rejection or acute tubular necrosis. (N.K.)

  15. 123I and 13I purification for biomolecules labelling

    International Nuclear Information System (INIS)

    Catanoso, Marcela Forli

    2011-01-01

    The 123 I and 131 I are iodine radioisotopes widely used in Nuclear Medicine. The radioisotope 123 I is used in diagnosis through the SPECT technique and is routinely produced at IPEN in cyclotron through the reaction: '1 24 Xe (p, 2n) '1 23 Cs -> 123 Xe -> 123 I. The radioisotope 131 I is used both in diagnosis and therapy due to its physical characteristics of decay by β - and its γ-ray emissions that are softened with the use of specific collimators for diagnosis. It is routinely produced at IPEN using the nuclear reactor through the indirect reaction: 130 Te (n, γ) -> 131 Te -> 131 I, irradiating compounds containing Te. The radiopharmaceuticals prepared with these radioisotopes go through rigorous quality control tests and the chemical purity of the primary radioisotopes 123 I and 131 I are within the permissible limits currently defined. However, the presence of some chemical contaminants can prejudice the biomolecules labeling (monoclonal antibodies and peptides), that will produce radiopharmaceuticals of first generation to the oncology area. The aim of this work was to obtain a new purification method of these radioisotopes, allowing the labeling of biomolecules and also to established a process control on those radioisotopes. The methodology was separated on 3 steps: Evaluation of '1 23 I e 131 I radionuclidic purity using a hyper pure germanium detector, chemical purity using ICP-OES and the retention and elution study of 131 I in several absorbers to choose the most appropriate for the purification tests analyzing the behavior of the possible contaminants. The radionuclidic analyses showed the presence of Te and Co on 131 I samples and Te, Tc e Co on 123 I samples. The chemical purity analyses showed the presence of Al and Mo in 123 I, coming from the window material of the target holder and the presence of Al and Te in 131 I samples, coming from the target holder and the target, respectively. The retention and elution study selected the most

  16. Influence of cooling rate and antimony addition content on graphite morphology and mechanical properties of a ductile iron

    Directory of Open Access Journals (Sweden)

    Liu Zhe

    2012-05-01

    Full Text Available Cooling rate and inoculation practice can greatly affect the graphite morphology of ductile irons. In the present research, the effects of the cooling rate and antimony addition on the graphite morphology and mechanical properties of ductile irons have been studied. Three ductile iron castings were prepared through solidification under cooling conditions S (slow, M (medium and F (fast. The cooling rates around the equilibrium eutectic temperature (1,150 ℃ for these cooling conditions (S, M and F were set at 0.21 ℃·min-1, 0.32 ℃·min-1 and 0.37 ℃·min-1, respectively. In addition, four ductile iron castings were prepared by adding 0.01%, 0.02%, 0.03% and 0.04% (by weight antimony, respectively under the slow cooling condition. The results show that the nodularity index, tensile strength and hardness of the ductile iron castings without antimony addition are all improved with the increase of cooling rate, while the ductile iron casting solidified under the medium cooling rate possesses the largest number of graphite nodules. Furthermore, for the four antimony containing castings, the graphite morphology and tensile strength are also improved by the antimony additions, and the effect of antimony addition is intensified when the addition increases from 0.01% to 0.03%. Moreover, the rare earth elements (REE/antimony ratio of 2 appears to be the most effective for fine nodular graphite formation in ductile iron.

  17. Effects of spark plasma sintering conditions on the anisotropic thermoelectric properties of bismuth antimony telluride

    DEFF Research Database (Denmark)

    Han, Li; Hegelund Spangsdorf, Steeven; Van Nong, Ngo

    2016-01-01

    Bismuth antimony telluride (BixSb2-xTe3, 0.4 room-temperature thermoelectric power generation. In this work, p-type Bi0.4Sb1.6Te3 samples were prepared under various conditions (temperature, holding time, and ramp...

  18. Mixing of phosphorus and antimony ions in silicon by recoil implantation

    International Nuclear Information System (INIS)

    Kwok, H.L.; Lam, Y.W.; Wong, S.P.; Poon, M.C.

    1986-01-01

    The effects of mixing phosphorus and antimony ions in silicon by recoil implantation were examined. The electrical properties after ion mixing were investigated, and the results were compared with those obtained using other techniques. Different degrees of activation were also studied, by investigating the annealing behaviour. (U.K.)

  19. Improvement of hydrogen storage kinetics in ball-milled magnesium doped with antimony

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Král, Lubomír; Roupcová, Pavla

    2017-01-01

    Roč. 42, č. 9 (2017), s. 6144-6151 ISSN 0360-3199 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Hydrogen * Hydrogen storage * Storage capacity * Magnesium alloys * Antimony Subject RIV: JJ - Other Materials OBOR OECD: Materials engineering Impact factor: 3.582, year: 2016

  20. Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery.

    Science.gov (United States)

    Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric

    2017-04-01

    Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi 2 Te 3 and (Bi 0,5 Sb 1,5 )Te 3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.

  1. ANTIMONY HALIDES AND HgX2 (X = Cl, Br AMINE ADDUCTS: SYNTHESIS AND INFRARED STUDY

    Directory of Open Access Journals (Sweden)

    NDONGO GUEYE

    2013-12-01

    Full Text Available Eight new SbF3, SbCl5 and HgX2 (X = Cl, Br amine adducts have been synthesized and their infrared study carried out. Discrete structures have been suggested on the basis of elemental analysis and infrared data, the coordination number of antimony varying from five to nine, while the environment around Hg is tetrahedral.

  2. On the segregation behavior of tin and antimony at grain boundaries of polycrystalline bcc iron

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Šandera, P.; Horníková, J.; Pokluda, J.; Godec, M.

    2016-01-01

    Roč. 363, Feb (2016), 140-144 ISSN 0169-4332 R&D Projects: GA ČR GAP108/12/0144 Institutional support: RVO:68378271 Keywords : grain boundary segregation * tin * antimony * Fe based alloy * AES quantification Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.387, year: 2016

  3. Morphology and photoresponse of crystalline antimony film grown on mica by physical vapor deposition

    Directory of Open Access Journals (Sweden)

    Shafa Muhammad

    2016-09-01

    Full Text Available Antimony is a promising material for the fabrication of photodetectors. This study deals with the growth of a photosensitive thin film by the physical vapor deposition (PVD of antimony onto mica surface in a furnace tube. The geometry of the grown structures was studied via scanning electron microscopy (SEM, X-ray diffraction (XRD, energy-dispersive X-ray spectroscopy (EDX and elemental diffraction analysis. XRD peaks of the antimony film grown on mica mostly matched with JCPDF Card. The formation of rhombohedral crystal structures in the film was further confirmed by SEM micrographs and chemical composition analysis. The Hall measurements revealed good electrical conductivity of the film with bulk carrier concentration of the order of 1022 Ω·cm-3 and mobility of 9.034 cm2/Vs. The grown film was successfully tested for radiation detection. The photoresponse of the film was evaluated using its current-voltage characteristics. These investigations revealed that the photosensitivity of the antimony film was 20 times higher than that of crystalline germanium.

  4. Reaction products and corrosion of molybdenum electrode in glass melt containing antimony oxides and sodium sulfate

    Czech Academy of Sciences Publication Activity Database

    Matěj, J.; Langrová, Anna

    2012-01-01

    Roč. 56, č. 3 (2012), s. 280-285 ISSN 0862-5468 Institutional support: RVO:67985831 Keywords : antimony oxides * corrosion * glass melt * Molybdenum electrode * sulfate Subject RIV: DD - Geochemistry Impact factor: 0.418, year: 2012 http://www.ceramics-silikaty.cz/2012/pdf/2012_03_280.pdf

  5. Differences in antimony and arsenic releases from lead smelter fly ash in soils

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Šebek, O.; Valigurova, R.; Klementová, Mariana

    2012-01-01

    Roč. 72, Supp. 4 (2012), s. 15-22 ISSN 0009-2819 Institutional research plan: CEZ:AV0Z40320502 Keywords : Antimony * Arsenic * Lead smelting * Fly ash * Soil * Mobility Subject RIV: CA - Inorganic Chemistry Impact factor: 1.351, year: 2012

  6. Diel variation of arsenic, molybdenum and antimony in a stream draining natural As geochemical anomaly

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Nováková, B.; Matoušek, Tomáš; Mihaljevič, M.; Rohovec, Jan; Filippi, Michal

    2013-01-01

    Roč. 31, APR (2013), s. 84-93 ISSN 0883-2927 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:68081715 ; RVO:67985831 Keywords : arsenic * molybdenum * antimony * trace elements * diel cycle Subject RIV: CB - Analytical Chemistry, Separation; DD - Geochemistry (GLU-S) Impact factor: 2.021, year: 2013

  7. Acetazolamide tomoscintigraphic study of the effect on cerebral blood perfusion using 123I isopropyliodoamphetamine (IAMP 123I). Preliminary results

    International Nuclear Information System (INIS)

    Moretti, J.L.; Defer, G.; Delmon, L.; Caillat-Vigneron, N.; Devinoy, A.; Sergent, A.; Safai, N.; Cesaro, P.

    1987-01-01

    The effect of Acetazolamide (Diamox) on cerebral blood perfusion has been studied in ten patients with cerebral ischemia. Previously, the dose and time effects was tested in two independent groups of male Wistar rats. The cerebral blood perfusion was estimated in man by the cerebral distribution of Isopropyliodoamphetamine 123 I (IAMP 123 I) visualised with conventional emission tomography. The study involved two identical examinations, the second one followed an injection of 1 g of Diamox. The biodistribution of IAMP 123 I was studied in rats without or after different doses of Diamox by counting of target organs. In animals, the pulmonary activity curve versus the dose showed a maximum for 100 mg/kg as the cerebral activity curve increased proportional to the dose. The study of time effect indicated that the best conditions for cerebral imaging by IAMP 123 I seems to take place twenty minutes after the injection of Diamox. In man, the results obtained after Diamox confirmed the known effect of decreasing of vascular resistance, especially in brain. The total cerebral activity in IAMP 123 I was increased in all the patients. In six patients of the ten, the activity of the ischemic region was lower than expected because of the high uptake of the controlateral hemisphere. This phenomenon may increase the sensitivity of detecting lightly hypoperfused cerebral regions. In some other patients, a high activity of the ischemic zone seems to proove an early regulation of the regional blood flow and may be an element of good pronostic. Making an Acetazolamide injection before a tomoscintigraphic examination of the brain with IAMP 123 I seems to provide conventional imaging with sensitivity and pronostic value [fr

  8. The presence and leachability of antimony in different wastes and waste handling facilities in Norway.

    Science.gov (United States)

    Okkenhaug, G; Almås, Å R; Morin, N; Hale, S E; Arp, H P H

    2015-11-01

    The environmental behaviour of antimony (Sb) is gathering attention due to its increasingly extensive use in various products, particularly in plastics. Because of this it may be expected that plastic waste is an emission source for Sb in the environment. This study presents a comprehensive field investigation of Sb concentrations in diverse types of waste from waste handling facilities in Norway. The wastes included waste electrical and electronic equipment (WEEE), glass, vehicle fluff, combustibles, bottom ash, fly ash and digested sludge. The highest solid Sb concentrations were found in WEEE and vehicle plastic (from 1238 to 1715 mg kg(-1)) and vehicle fluff (from 34 to 4565 mg kg(-1)). The type of acid used to digest the diverse solid waste materials was also tested. It was found that HNO3:HCl extraction gave substantially lower, non-quantitative yields compared to HNO3:HF. The highest water-leachable concentration for wastes when mixed with water at a 1 : 10 ratio were observed for plastic (from 0.6 to 2.0 mg kg(-1)) and bottom ash (from 0.4 to 0.8 mg kg(-1)). For all of the considered waste fractions, Sb(v) was the dominant species in the leachates, even though Sb(iii) as Sb2O3 is mainly used in plastics and other products, indicating rapid oxidation in water. This study also presents for the first time a comparison of Sb concentrations in leachate at waste handling facilities using both active grab samples and DGT passive samples. Grab samples target the total suspended Sb, whereas DGT targets the sum of free- and other chemically labile species. The grab sample concentrations (from 0.5 to 50 μg L(-1)) were lower than the predicted no-effect concentration (PNEC) of 113 μg L(-1). The DGT concentrations were substantially lower (from 0.05 to 9.93 μg L(-1)) than the grab samples, indicating much of the Sb is present in a non-available colloidal form. In addition, air samples were taken from the chimney and areas within combustible waste incinerators, as

  9. Microautoradiography of [{sup 123}I]ADAM in mice treated with fluoxetine and serotonin reuptake inhibitors

    Energy Technology Data Exchange (ETDEWEB)

    Ye, X.-X.; Chen, J.-C.; Liu, R.-S.; Wey, S.-P.; Lee, J.-S.; Chen, C.-C.; Fu, Y.-K.; Ting, Gann; Hwang, J.-J. E-mail: jjhwang@ym.edu.tw

    2004-07-01

    A radiopharmaceutical, {sup 123}I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine ([{sup 123}I]ADAM), has been developed recently for evaluation of how serotonin transporters (SERT) function in the brain. However, the detailed biodistribution and specific binding in certain brain areas are not well investigated. In this study, both phosphor plate imaging and microautoradiography were applied to explore the binding characteristics of [{sup 123}I]ADAM in SERT neurons. The effect of two psychotropics and one narcotic on the binding of [{sup 123}I]ADAM to SERT was also studied. Fluoxetine and desipramine, both are psychotropics and specific SERT ligands and decreased the affinity of [{sup 123}I]ADAM, while p-chloroamphetamine (PCA), a narcotic, destroyed most of serotonergic neurons, as well as reducing the concentration of serotonin and the number of SERT in the brain as shown by the biodistribution of [{sup 123}I]ADAM. Significant and selective accumulation of [{sup 123}I]ADAM in the areas from midbrain to brain stem in normal mice with maximum target-to-background ratio was found at 90 minutes postinjection. A rapid clearance of [{sup 131}I]ADAM at 120 minutes postinjection was found in the CA1, CA3 and ThN brain areas. In addition, the inhibition effect on binding ability of [{sup 123}I]ADAM to SERT by the psychotropics and the narcotic was found to have the order of: PCA > fluoxetine > desipramine.

  10. Iodine-123 (123I) is promising radiopharmaceutical in the radionuclide diagnostics

    International Nuclear Information System (INIS)

    Tazhedinov, I.T.

    2003-01-01

    In the paper some advantages of the radiopharmaceuticals with 123 I against 99m Tc preparations are shown. It is noted that the 123 I is the most favourable among cyclotron radionuclides for radionuclide diagnostics by it nuclear-physical characteristics. With application of 123 I it is possible to attain a significant progress in the thyroid examination. 123 I labelled preparations should have a high bond strength providing the high information valuation of examinations

  11. Carbon paste electrodes modified with a reaction product obtained by hydrolysis of an antimony(III) salt

    OpenAIRE

    Švancara, Ivan; Florescu, Monica; Stočes, Matěj; Baldrianová, Lucie; Svobodová, Eva; Badea, Mihaela

    2010-01-01

    In this article, a new type of antimony-modified electrode is described based on carbon-paste bulk dispersion of a precipitate obtained by hydrolysis of the respective Sb(III) salt. Subsequently, the resultant electrode (SbOL-CPE in two variants)  operated via the antimony film formed in nascenti at the electrode surface  was subjected to the basic characterisation with respect to its electroanalytical performance in the anodic stripping voltammetry of six heavy metal ions (Z...

  12. On the Effect of Antimony Segregation to the Electronic Properties of InAs/InAsSb Superlattices (Preprint)

    Science.gov (United States)

    2017-01-03

    distribution at the hetero-interfaces engendered by Sb segregation. * Electronic mail: heather.haugan.ctr@us.af.mil 2 I. INTRODUCTION Reuse After...AFRL-RX-WP-JA-2017-0231 ON THE EFFECT OF ANTIMONY SEGREGATION TO THE ELECTRONIC PROPERTIES OF INAS/INASSB SUPERLATTICES (PREPRINT...December 2016 Interim 11 September 2013 – 12 November 2016 4. TITLE AND SUBTITLE ON THE EFFECT OF ANTIMONY SEGREGATION TO THE ELECTRONIC

  13. Molecular Preadaptation to Antimony Resistance in Leishmania donovani on the Indian Subcontinent.

    Science.gov (United States)

    Dumetz, F; Cuypers, B; Imamura, H; Zander, D; D'Haenens, E; Maes, I; Domagalska, M A; Clos, J; Dujardin, J-C; De Muylder, G

    2018-04-25

    Antimonials (Sb) were used for decades for chemotherapy of visceral leishmaniasis (VL). Now abandoned in the Indian subcontinent (ISC) because of Leishmania donovani resistance, this drug offers a unique model for understanding drug resistance dynamics. In a previous phylogenomic study, we found two distinct populations of L. donovani : the core group (CG) in the Gangetic plains and ISC1 in the Nepalese highlands. Sb resistance was only encountered within the CG, and a series of potential markers were identified. Here, we analyzed the development of resistance to trivalent antimonials (Sb III ) upon experimental selection in ISC1 and CG strains. We observed that (i) baseline Sb III susceptibility of parasites was higher in ISC1 than in the CG, (ii) time to Sb III resistance was higher for ISC1 parasites than for CG strains, and (iii) untargeted genomic and metabolomic analyses revealed molecular changes along the selection process: these were more numerous in ISC1 than in the CG. Altogether these observations led to the hypothesis that CG parasites are preadapted to Sb III resistance. This hypothesis was experimentally confirmed by showing that only wild-type CG strains could survive a direct exposure to the maximal concentration of Sb III The main driver of this preadaptation was shown to be MRPA , a gene involved in Sb III sequestration and amplified in an intrachromosomal amplicon in all CG strains characterized so far. This amplicon emerged around 1850 in the CG, well before the implementation of antimonials for VL chemotherapy, and we discuss here several hypotheses of selective pressure that could have accompanied its emergence. IMPORTANCE The "antibiotic resistance crisis" is a major challenge for scientists and medical professionals. This steady rise in drug-resistant pathogens also extends to parasitic diseases, with antimony being the first anti- Leishmania drug that fell in the Indian subcontinent (ISC). Leishmaniasis is a major but neglected infectious

  14. 13 CFR 123.500 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... economic injury means an economic harm to the small business such that it cannot: (1) Meet its obligations... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 123.500 Section 123.500 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Military...

  15. 21 CFR 123.7 - Corrective actions.

    Science.gov (United States)

    2010-04-01

    ... of their HACCP plans in accordance with § 123.6(c)(5), by which they predetermine the corrective... in accordance with § 123.10, to determine whether the HACCP plan needs to be modified to reduce the risk of recurrence of the deviation, and modify the HACCP plan as necessary. (d) All corrective actions...

  16. 21 CFR 123.8 - Verification.

    Science.gov (United States)

    2010-04-01

    ..., including signing and dating, by an individual who has been trained in accordance with § 123.10, of the... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION FISH AND FISHERY PRODUCTS General Provisions § 123.8 Verification. (a) Overall verification. Every...

  17. 27 CFR 28.123 - Export marks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.123..., or Transportation to a Manufacturing Bonded Warehouse § 28.123 Export marks. (a) General. In addition... filled under the provisions of part 24 of this chapter, the proprietor shall mark the word “Export” on...

  18. 7 CFR 1260.123 - Research.

    Science.gov (United States)

    2010-01-01

    ... beef products, other related food science research, and new product development. ... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1260.123 Section 1260.123 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef...

  19. 21 CFR 123.16 - Process controls.

    Science.gov (United States)

    2010-04-01

    ... of toxin by Clostridium botulinum for at least as long as the shelf life of the product under normal... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Process controls. 123.16 Section 123.16 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

  20. 38 CFR 59.123 - Conference.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Conference. 59.123... TO STATES FOR CONSTRUCTION OR ACQUISITION OF STATE HOMES § 59.123 Conference. At any time, VA may recommend that a conference (such as a design development conference) be held in VA Central Office in...

  1. Selective speciation of inorganic antimony on tetraethylenepentamine bonded silica gel column and its determination by graphite furnace atomic absorption spectrometry.

    Science.gov (United States)

    Mendil, Durali; Bardak, Hilmi; Tuzen, Mustafa; Soylak, Mustafa

    2013-03-30

    A speciation system for antimony (III) and antimony (V) ions that based on solid phase extraction on tetraethylenepentamine bonded silica gel has been established. Antimony was determined by graphite furnace atomic absorption spectrometry (GF-AAS). Analytical conditions including pH, sample volume, etc., were studied for the quantitative recoveries of Sb (III) and Sb (V). Matrix effects on the recovery were also investigated. The recovery values and detection limit for antimony (III) at optimal conditions were found as >95% and 0.020 μg L(-1), respectively. Preconcentration factor was calculated as 50. The capacity of adsorption for the tetraethylenepentamine bonded silica gel was 7.9 mg g(-1). The validation was checked by analysis of NIST SRM 1573a Tomato laves and GBW 07605 Tea certified reference materials. The procedure was successfully applied to speciation of antimony in tap water, mineral water and spring water samples. Total antimony was determined in refined salt, unrefined salt, black tea, rice, tuna fish and soil samples after microwave digestion and presented enrichment method combination. Copyright © 2013 Elsevier B.V. All rights reserved.

  2. Treatment of antimony mine drainage: challenges and opportunities with special emphasis on mineral adsorption and sulfate reducing bacteria.

    Science.gov (United States)

    Li, Yongchao; Hu, Xiaoxian; Ren, Bozhi

    2016-01-01

    The present article summarizes antimony mine distribution, antimony mine drainage generation and environmental impacts, and critically analyses the remediation approach with special emphasis on iron oxidizing bacteria and sulfate reducing bacteria. Most recent research focuses on readily available low-cost adsorbents, such as minerals, wastes, and biosorbents. It is found that iron oxides prepared by chemical methods present superior adsorption ability for Sb(III) and Sb(V). However, this process is more costly and iron oxide activity can be inhibited by plenty of sulfate in antimony mine drainage. In the presence of sulfate reducing bacteria, sulfate can be reduced to sulfide and form Sb(2)S(3) precipitates. However, dissolved oxygen and lack of nutrient source in antimony mine drainage inhibit sulfate reducing bacteria activity. Biogenetic iron oxide minerals from iron corrosion by iron-oxidizing bacteria may prove promising for antimony adsorption, while the micro-environment generated from iron corrosion by iron oxidizing bacteria may provide better growth conditions for symbiotic sulfate reducing bacteria. Finally, based on biogenetic iron oxide adsorption and sulfate reducing bacteria followed by precipitation, the paper suggests an alternative treatment for antimony mine drainage that deserves exploration.

  3. Substituted 4-hydroxy-1,2,3-triazoles

    DEFF Research Database (Denmark)

    Pippione, Agnese C.; Dosio, Franco; Ducime, Alex

    2015-01-01

    Bioisosterism and scaffold hopping are two widely used approaches in medicinal chemistry for the purpose of lead optimization. The study highlights the physicochemical properties of the 4-hydroxy-1,2,3-triazole scaffold, a less investigated heterocyclic system. Synthetic strategies to obtain...... different N-substituted 4-hydroxy-1,2,3-triazole isomers are presented, and their role as possible isosteres of the carboxylic acid is discussed. The aim is to use this system to modulate the acidic moieties present in lead compounds and, at the same time, to regiodirect substituents in set directions......, through targeted substitution on the three nitrogen atoms of the triazole ring. Through this approach, compounds having enhanced binding affinity, will be sought. Two examples of bioisosteric applications of this moiety are presented. In the first example, a classical bioisosteric approach mimicking...

  4. Speciation of inorganic antimony in polyethylene terephthalate (PET) bottled water using hydride generation atomic absorption spectrophotometry (HG-AAS)

    International Nuclear Information System (INIS)

    Markwo, Ali

    2015-07-01

    Antimony (Sb) is a regulated drinking water contaminant that has been found to leach from polyethylene terephthalate (PET) plastic containers into the waters stored in them. The common inorganic species of antimony in water are Sb(III) and Sb(V), with the former being more toxic and the latter being more soluble. In order to assess the extent to which waters stored in PET bottles are contaminated with inorganic Sb and to further examine the effect of typical storage conditions on migration rates, speciation analysis of inorganic Sb using hydride generation atomic absorption spectrophotometry (HG-AAS) was undertaken on selected PET plastic bottled waters marketed in the Greater Accra Region of Ghana. Six brands of PET plastic bottled waters were obtained at source on the day of packaging, and analyses undertaken on samples of the waters stored in the plastic containers at intervals of four weeks for twelve weeks, under three carefully chosen storage conditions distinctive of bottled water usage. Selected physicochemical properties of samples of the waters stored in the plastic containers and total Sb of samples of the plastic containers were also determined to discover the effect of some physical properties and certain major ions, and the influence of the different quality PET plastic types on Sb migration respectively. The study revealed amounts of total Sb in the PET plastic containers of the 6 brands ranging from 123.46 mg/kg to 146.45 mg/kg. The selected physicochemical properties of the waters stored in the PET plastic containers considered were pH (6.78 – 7.43), Ca2+ (1.61 – 12.39 mg/L), Mg2+ (1.00 – 4.96 mg/L), HCO3− (6.18 – 55.41 mg/L) and TDS (8.70 – 70.40 mg/L)). PET bottled waters of 5 out of the 6 brands contained Sb (initial total Sb ranging from 1.11 – 14.65 μg/L) before storage. Total Sb concentrations of the waters stored in the plastic containers were observed to increase with storage time under all the three storage conditions for

  5. Antimony Influence on Shape of Eutectic Silicium in Al-Si Based Alloys

    Directory of Open Access Journals (Sweden)

    Bolibruchová D.

    2017-12-01

    Full Text Available Liquid AI-Si alloys are usually given special treatments before they are cast to obtain finer or modified matrix and eutectic structures, leading to improved properties. For many years, sodium additions to hypoeutectic and eutectic AI-Si melts have been recognized as the most effective method of modifying the eutectic morphology, although most of the group IA or IIA elements have significant effects on the eutectic structure. Unfortunately, many of these approaches also have associated several founding difficulties, such as fading, forming dross in presence of certain alloying elements, reduced fluidity, etc. ln recent years, antimony additions to AI-Si castings have attracted considerable attention as an alternative method of refining the eutectic structure. Such additions eliminate many of the difficulties listed above and provide permanent (i.e. non-fading refining ability. In this paper, the authors summarize work on antimony treatment of Al-Si based alloys.

  6. A facile and fast route to prepare antimony (Sb) nanostructures without additives

    KAUST Repository

    Shah, M.A.

    2011-12-01

    Herein, we report a safe, low cost and reproducible approach for the synthesis of antimony (Sb) nanostructures with most of them having prism like morphology and having well defined faces in the range of ∼70210 nm. The organics free approach is based on a reaction of antimony powder and pure water at ∼210 °C without using any harmful additives and amines. The XRD pattern confirmed the composition and crystallinity of the grown nanostructures. The reported method besides being organics free is economical, fast and free of pollution, which will make it suitable for large scale production. Furthermore, it is well expected that such a technique could be extended to prepare many other important metal and metal oxide nanostructures. The prospects of the process are bright and promising. © 2012 Sharif University of Technology. Production and hosting by Elsevier B.V. All rights reserved.

  7. Evaluation of the efficiency of the processes of purification of antimony to semiconductor grade purity

    International Nuclear Information System (INIS)

    Walis, L.; Rowinska, L.; Panczyk, E.

    1992-01-01

    A complex of techniques for purification of antimony from arsenic has been examined with the aid of radiotracer 76 As. The investigated processes comprised vacuum distillation, zone melting and remelting of the metal under artificial slags. The purification efficiencies for the above processes were high and amounted to 94% (for 30% of the charge), 50% (for 50% of the charge) and 99.5% (for 60% of the charge), respectively. Attempts were made to determine the kinetics of the separation of arsenic from antimony by distillation. The application of the radioactive tracer made it possible to determine rapidly the distribution of impurities after each stage of the process within a wide concentration range (10 -2 -10 -7 g/g). (author). 7 refs, 4 figs, 6 tabs

  8. Determination by neutron activation analysis of loss of arsenic, antimony, bromine and mercury during lyophilization

    International Nuclear Information System (INIS)

    Carlson, M.; Litman, R.

    1978-01-01

    Neutron activation analysis has been used to monitor the loss of arsenic, as dimethylarsinic acid, (CH 3 ) 2 AsOOH, or as sodium arsenate (Na 2 HAsO 4 .7H 2 O), antimony (as potassium antimony, tartrate, KSbC 4 O 7 .1/2H 2 O) and bromine (as bromide ion) during lyophilization of acidified and neutral aqueous synthetic and environmental samples. Losses of Sb and As ranged from zero to 60%, while losses of bromine were constant (at 91%) in acidic solutions. The variable losses of As and Sb were due solely to the presence of and partial decomposition of the (CH 3 ) 2 AsOOH. Electrochemical oxidation of Br - to Br 2 is responsible for the high losses of bromine. In addition losses of mercury (as methylmercuric chloride) were 1O0% in both acidic and neutral aqueous synthetic samples during lyophilization. (author)

  9. Reaction of Antimony-Uranium Composite Oxide in the Chlorination Treatment of Waste Catalyst - 13521

    Energy Technology Data Exchange (ETDEWEB)

    Sawada, Kayo [EcoTopia Science Institute (Japan); Hirabayashi, Daisuke; Enokida, Youichi [Department of Materials, Physics and Energy Engineering, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8603 (Japan)

    2013-07-01

    The effect of oxygen gas concentration on the chlorination treatment of antimony-uranium composite oxide catalyst waste was investigated by adding different concentrations of oxygen at 0-6 vol% to its chlorination agent of 0.6 or 6 vol% hydrogen chloride gas at 1173 K. The addition of oxygen tended to prevent the chlorination of antimony in the oxide. When 6 vol% hydrogen chloride gas was used, the addition of oxygen up to 0.1 vol% could convert the uranium contained in the catalyst to U{sub 3}O{sub 8} without any significant decrease in the reaction rate compared to that of the treatment without oxygen. (authors)

  10. Synthesis and vibrational spectrum of antimony phosphate, SbPO4.

    Science.gov (United States)

    Brockner, Wolfgang; Hoyer, Lars P

    2002-07-01

    SbPO4 was synthesized via a new route by reacting antimony metal with meta-phosphoric acid, (HPO3)n at high temperatures. The Raman and IR spectra of the title compound were recorded and the vibrational modes assigned on the basis of a factor group analysis. The internal vibrations are derived from tetrahedral PO4 units (approaching Sb[PO4]) by the correlation method, although the structure is polymeric and not ionic.

  11. Preconcentration and Determination of Antimony in Drinking Water Bottled by Modified Nano-Alumina

    Directory of Open Access Journals (Sweden)

    M Mohammad Zakizade

    2016-01-01

    Full Text Available Abstract Introduction: Antimony trioxide (Sb2O3 has been utilized as a catalyst in polyethylene terephtalate (PET production, and the studies conducted on the bottled water has demonstrated that antimony can be leached from PET bottles into drinking water. Methods: In this study, a simple method was applied in order to determine the trace amount of antimony in bottled drinking water based on preconcentration /solid phase extraction. The nano alumina modified with Schiff base ligand was used in regard with Sb preconcentration. The experiments were performed in a continuous system and HCI was used as eluent of Sb ion. Several chemical and flow variables were optimized for a quantitative preconcentration and determination of Sb ion. The atomic absorption spectroscopy was used to determine Sb ion concentration. In order to study the keeping conditions on the leaching of Sb ion from PET plastic, drinking water bottles were kept in different conditions(room temperature, sunny light and -18˚C. Results: The calibration graph was linear in the range of 0.5 to 15.0 ppm Sb with detection limit of 0.055 ppm. The flow rate of sample was optimized in range of 1.0-9.0 mLmin-1 and Sb ion can be quantitatively eluted at 90 Vsample: Veluent retio. Conclusion: The study results revealed that the modified nano alumina is an effective sorbent in regard with absorbing Sb ion from water and HCI 1M can be used as an appropriate eluent. Maximum leaching of Sb ion is observed when the bottled drinking water was exposed to the sun light. Keywords: Antimony; Bottled drinking water; Modified alumina; Preconcentration

  12. Purification of indium, gallium, and antimony by melting with synthetic slug

    International Nuclear Information System (INIS)

    Walis, L.; Rowinska, L.; Nowicki, A.

    1997-01-01

    The tracer technique has been used for metal purification process control. The indium, gallium and antimony have been purified up to semiconductor purity in the melting with synthetic slug process. The 115m Cd, 59 Fe, 204 Tl. 76 As, 210 Bi have been used as tracers. The high effectiveness of proposed purification method have been found in the cases of indium and gallium. 6 refs, 2 figs, 2 tabs

  13. Optical switching property of a light-induced pinhole in antimony thin film

    Science.gov (United States)

    Fukaya, Toshio; Tominaga, Junji; Nakano, Takashi; Atoda, Nobufumi

    1999-11-01

    Optical near-field recording, called a super-resolution near-field structure, records and retrieves small marks beyond the diffraction limit. A thin layer of an antimony (Sb) film, added to the usual phase-change optical disk, is the key material of this technique. Nonlinear optical properties of an Sb film, especially optical switching, were studied in the stationary state using a nanosecond pulse laser. Clear switching was observed under microscopic measurement.

  14. Development and pharmacokinetic of antimony encapsulated in liposomes of phosphatidylserine using radioisotopes in experimental leishmaniasis; Desenvolvimento e farmacocinetica de antimonio encapsulado em lipossomas de fosfatidilserina utilizando radioisotopos em leishmaniose experimental

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta Etel Treiger

    2010-07-01

    Leishmaniasis are a complex of parasitic diseases caused by intra macrophage protozoa of the genus Leishmania, and is fatal if left untreated. Pentavalent antimonials, though toxic and their mechanism of action being unclear, remain the first-line drugs for treatment. Effective therapy could be achieved by delivering antileishmanial drugs to these sites of infection. Liposomes are phospholipid vesicles that promote improvement in the efficacy and action of drugs in target cell. Liposomes are taken up by the cells of mononuclear phagocytic system (MPS). The purpose of this study was to develop a preparation of meglumine antimonate encapsulated in liposomes of phosphatidylserine and to study its pharmacokinetic in healthy mice to establish its metabolism and distribution. Quantitative analysis of antimony from liposomes demonstrated that Neutron Activation Analysis was the most sensitive technique with almost 100 % of accuracy. All liposome formulations presented a mean diameter size of 150 nm. The determination of IC{sub 50} in infected macrophage showed that liposome formulations were between 10 - 63 fold more effective than the free drug, indicating higher selectivity index. By fluorescence microscopy, an increased uptake of fluorescent-liposomes was seen in infected macrophages during short times of incubation compared with non-infected macrophages. Biodistribution studies showed that meglumine antimonate irradiated encapsulated in liposomes of phosphatidylserine promoted a targeting of antimony for MPS tissues and maintained high doses in organs for a prolonged period. In conclusion, these data suggest that meglumine antimonate encapsulated in liposomes showed higher effectiveness than the non-liposomal drug against Leishmania infection. The development of liposome formulations should be a new alternative for the chemotherapy of infection diseases, especially Leishmaniasis, as they are used to sustain and target pharmaceuticals to the local of infection. (author)

  15. Antimony in the Contaminated Site of El Triunfo, Baja California Sur, Mexico

    Directory of Open Access Journals (Sweden)

    Marmolejo-Rodríguez A. J.

    2013-04-01

    Full Text Available Antimony has properties similar to arsenic with some of its compounds toxic to humans. Therefore it is necessary to control the wastes accumulated by anthropogenic activities, such as mining, where it is in tailings to be released to the environment. According to the Environment Protection Agency, the maximum value in sediments is 11.2 mg Sb kg–1 and the Earth’s crust average is 0.2 mg Sb kg–1. In this semiarid area, the drainage basin El Carrizal is impacted with wastes of an abandoned gold mine at the Mining District El Triunfo (MD – ET which have tailings with 17,600 mg kg–1 of antimony. In the main dry river (arroyo, the Sb content is between 0.6 and 122 mg kg–1. This element is transported from the source throughout the fluvial basin to discharge into the Pacific Ocean. In the arroyo mouth we collected one sedimentary core and the sediment from dunes (28.6 – 45.7 and 6.43 – 7.74 mg Sb kg–1. This research concluded the antimony is enriched in this semiarid system, with Normalized Enrichment Factors severely enriched mainly in arroyo sediments close to the MD-ET

  16. A NOVEL METHOD OF THE HYDRIDE SEPARATION FOR THE DETERMINATION OF ARSENIC AND ANTIMONY BY AAS

    Directory of Open Access Journals (Sweden)

    Ganden Supriyanto

    2010-06-01

    Full Text Available A novel method is proposed for the hydride separation when determinining of arsenic and antimony by AAS. A chromatomembrane cell was used as preconcentration-, extraction- and separation-manifold instead of the U-tube phase separator, which is normally fitted in continuous flow vapour systems generating conventionaly the hydrides. The absorbances of the hydrides produced were measured by an atomic absorption spectrophotometer at 193.7 nm and 217.6 nm. Under optimized analytical conditions, the calibration plot for arsenic was linear from 50 to 500 ng.mL-1 (r2 = 0.9982. The precision for three subsequent measurements of 500 ng.mL-1 arsenic gave rise to a relative standard deviation of 0.4%. The detection limit was 15 ng.mL-1, which is much lower compared with that of the conventional hydride system (2000 ng.mL-1. A similar result was observed in case of antimony: the detection limit was 8 ng.mL-1 when the proposed method was applied. Consequently, the sensitivity of the novel method surpasses systems with conventional hydride generation, i.e. the precision and the acuracy increase whereas the standard deviation and the detection limit decrease. The proposed method was applied in pharmacheutial analysis and the certified As-content of a commercial product was very sufficiently confirmed.   Keywords: Chromatomembrane Cell, Hydride separation, Arsenic detection, Antimony detection, AAS

  17. Sequestration of Antimony on Calcite Observed by Time-Resolved Nanoscale Imaging.

    Science.gov (United States)

    Renard, François; Putnis, Christine V; Montes-Hernandez, German; King, Helen E; Breedveld, Gijs D; Okkenhaug, Gudny

    2018-01-02

    Antimony, which has damaging effects on the human body and the ecosystem, can be released into soils, ground-, and surface waters either from ore minerals that weather in near surface environments, or due to anthropogenic releases from waste rich in antimony, a component used in batteries, electronics, ammunitions, plastics, and many other industrial applications. Here, we show that dissolved Sb can interact with calcite, a widespread carbonate mineral, through a coupled dissolution-precipitation mechanism. The process is imaged in situ, at room temperature, at the nanometer scale by using an atomic force microscope equipped with a flow-through cell. Time-resolved imaging allowed following the coupled process of calcite dissolution, nucleation of precipitates at the calcite surface and growth of these precipitates. Sb(V) forms a precipitate, whereas Sb(III) needs to be oxidized to Sb(V) before being incorporated in the new phase. Scanning-electron microscopy and Raman spectroscopy allowed identification of the precipitates as two different calcium-antimony phases (Ca 2 Sb 2 O 7 ). This coupled dissolution-precipitation process that occurs in a boundary layer at the calcite surface can sequester Sb as a solid phase on calcite, which has environmental implications as it may reduce the mobility of this hazardous compound in soils and groundwaters.

  18. Antimony sulfide thin films prepared by laser assisted chemical bath deposition

    Energy Technology Data Exchange (ETDEWEB)

    Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolás de los Garza, Nuevo León, 66455 (Mexico); CIIDIT—Universidad Autónoma de Nuevo León, Apodaca, Nuevo León (Mexico); Garcia, L.V. [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolás de los Garza, Nuevo León, 66455 (Mexico); Loredo, S.L. [Centro de Investigación en Materiales Avanzados (CIMAV), Unidad Monterrey, PIIT, Apodaca, Nuevo León (Mexico); Krishnan, B. [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolás de los Garza, Nuevo León, 66455 (Mexico); CIIDIT—Universidad Autónoma de Nuevo León, Apodaca, Nuevo León (Mexico); and others

    2017-01-30

    Highlights: • Antimony sulfide thin films were prepared by normal CBD and laser assisted CBD. • Characterized these films using XRD, XPS, AFM, optical and electrical measurements. • Accelerated growth was observed in the laser assisted CBD process. • These films were photoconductive. - Abstract: Antimony sulfide (Sb{sub 2}S{sub 3}) thin films were prepared by laser assisted chemical bath deposition (LACBD) technique. These thin films were deposited on glass substrates from a chemical bath containing antimony chloride, acetone and sodium thiosulfate under various conditions of normal chemical bath deposition (CBD) as well as in-situ irradiation of the chemical bath using a continuous laser of 532 nm wavelength. Structure, composition, morphology, optical and electrical properties of the Sb{sub 2}S{sub 3} thin films produced by normal CBD and LACBD were analyzed by X-Ray diffraction (XRD), Raman Spectroscopy, Atomic force microscopy (AFM), X-Ray photoelectron spectroscopy (XPS), UV–vis spectroscopy and Photoconductivity. The results showed that LACBD is an effective synthesis technique to obtain Sb{sub 2}S{sub 3} thin films for optoelectronic applications.

  19. pH-regulated antimony oxychloride nanoparticle formation on titanium oxide nanostructures: a photocatalytically active heterojunction

    KAUST Repository

    Buchholcz, Balázs

    2017-02-06

    Improving the catalytic activity of heterogeneous photocatalysts has become a hot topic recently. To this end, considerable progress has been made in the efficient separation of photogenerated charge carriers by e.g. the realization of heterojunction photocatalysts. V-VI-VII compound semiconductors, namely, bismuth oxyhalides, are popular photocatalysts. However, results on antimony oxyhalides [SbOX (X = Br, Cl, I)], the very promising alternatives to the well-known BiOX photomodifiers, are scarce. Here, we report the successful decoration of titanium oxide nanostructures with 8-11 nm diameter SbOX nanoparticles for the first time ever. The product size and stoichiometry could be controlled by the pH of the reactant mixture, while subsequent calcination could transform the structure of the titanate nanotube (TiONT) support and the prepared antimony oxychloride particles. In contrast to the ease of composite formation in the SbOX/TiONT case, anatase TiO could not facilitate the formation of antimony oxychloride nanoparticles on its surface. The titanate nanotube-based composites showed activity in a generally accepted quasi-standard photocatalytic test reaction (methyl orange dye decolorization). We found that the SbOCl/TiONT synthesized at pH = 1 is the most active sample in a broad temperature range.

  20. Increased parasite surface antigen-2 expression in clinical isolates of Leishmania donovani augments antimony resistance.

    Science.gov (United States)

    Bhandari, Vasundhra; Kumar, Dhiraj; Verma, Sandeep; Srividya, Gurumurthy; Negi, Narendra Singh; Singh, Ruchi; Salotra, Poonam

    2013-11-01

    Resistance to sodium antimony gluconate (SAG) is a major cause of therapeutic failure in a large proportion of visceral leishmaniasis (VL) cases. Determinants of SAG resistance have been widely studied; however, the mechanism operating in clinical isolates is poorly understood. In the present study, expression of parasite surface antigen-2 (PSA-2) gene was studied in clinical isolates of Leishmania donovani comprising of antimony resistant (n=10) and sensitive (n=4) parasites. The expression of PSA-2 gene was found to be consistently high in SAG resistant clinical isolates (≥1.5-fold) at both transcript and protein level. Further, over-expression of PSA-2 in L. donovani isolates (LdPSA-2(++)) resulted in conversion of SAG sensitive phenotype to resistant. The LdPSA-2(++) parasites showed significantly decreased susceptibility towards SAG (>12-fold), amphotericin B (>4-fold) and miltefosine (>2.5-fold). Marked decrease in antimony accumulation and enhanced tolerance towards complement mediated lysis was evident in LdPSA-2(++) parasites. The study established the role of PSA-2 gene in SAG resistance and its potential as a biomarker to distinguish resistant and sensitive clinical isolates of L. donovani. Copyright © 2013 Elsevier Inc. All rights reserved.

  1. Parto prematuro após uso de antimonial pentavalente: relato de um caso Premature birth after the use of pentavalent antimonial: case report

    Directory of Open Access Journals (Sweden)

    Bruna Pinheiro Silveira

    2003-07-01

    Full Text Available Relata-se o caso de uma mulher de 19 anos, na 24ª semana de gravidez e com leishmaniose visceral. Tratada com antimonial pentavalente na posologia de 850mg/dia por 20 dias, ocorreu parto prematuro no quinto dia de tratamento e óbito da criança um dia após nascimento. Considerando a importância da protozoose no nosso meio e a raridade da associação com a gestação, julgamos de interesse a publicação do caso.A case is reported of a 19-year-old woman, at week 24 of gestation, with visceral leishmaniosis. She was treated with meglumine antimoniate at a dose of 850mg/day for 20 days. There occurred premature birth on day five of treatment and the neonate died one day after birth. Considering the importance of protozoiasis in our population and the rarity of the association with pregnancy, we resolved to publish the case.

  2. Cyclotron production of high-purity 123I for medical applications via the 127I(p,5n)123Xe → 123I nuclear reaction

    International Nuclear Information System (INIS)

    Lagunas-Solar, M.C.

    1985-01-01

    The use of iodine-123 in nuclear medicine procedures is well documented in the scientific literature. Also, several methods for its production based on accelerator techniques have been described. Indirectly made 123 I via the 127 I(p,5n) 123 Xe → 123 I reaction produces 123 I of > 99.9% radionuclidic purity, with only 125 I ( 123 I production were developed at the University of California at Davis, where since 1974 the 76-in. isochronous cyclotron of the Crocker Nuclear Laboratory has been used for routine biweekly production of high-purity no-carrier-added 123 I

  3. Global atmospheric chemistry of CFC-123.

    Science.gov (United States)

    Prinn, R G; Golombek, A

    1990-03-01

    THE compound 1,1-dichloro-2,2,2-trifluoroethane (CFC-123), which is potentially usable as a foam-blowing agent in the plastics industry, an aerosol propellant and a refrigerant, has been proposed as an industrial substitute for trichlorofluoromethane (CFC-11), the use of which is increasingly restricted because of its effects on the ozone layer and on climate(1-3). It is expected that CFC-123, although like CFC-11 an absorber of infrared radiation, will be less stable in the atmosphere because of its expected reaction with OH radicals in the troposphere. Using a three-dimensional global model of the atmosphere, we have calculated the chemical destruction rates of CFC-123 by various processes, confirming that the chief sink is destruction by OH radicals below 12 km, which accounts for 88% of its loss. The calculated destruction rate is greatest in the equatorial region below 2 km. The calculated steady-state lifetime of CFC-123 is 1.5 years, based on the best available estimate of the rate constant of the reaction with OH. This lifetime is very much shorter than that of CFC-11, the destruction of which is largely confined to the stratosphere. For equal rates (by mass) of CFC-123 and CFC-11 emission to the atmosphere, the molar content in the atmosphere and the injection rate of chlorine into the stratosphere are, respectively, 48 and 14 times greater for CFC-11 than for CFC-123 in steady-state.

  4. Increased biliary excretion of glutathione is generated by the glutathione-dependent hepatobiliary transport of antimony and bismuth.

    Science.gov (United States)

    Gyurasics, A; Koszorús, L; Varga, F; Gregus, Z

    1992-10-06

    We have recently demonstrated that the hepatobiliary transport of arsenic is glutathione-dependent and is associated with a profound increase in biliary excretion of glutathione (GSH), hepatic GSH depletion and diminished GSH conjugation (Gyurasics A, Varga F and Gregus Z, Biochem Pharmacol 41: 937-944 and Gyurasics A, Varga F and Gregus Z, Biochem Pharmacol 42: 465-468, 1991). The present studies in rats aimed to determine whether antimony and bismuth, other metalloids in group Va of the periodic table, also possess similar properties. Antimony potassium tartrate (25-100 mumol/kg, i.v.) and bismuth ammonium citrate (50-200 mumol/kg, i.v.) increased up to 50- and 4-fold, respectively, the biliary excretion of non-protein thiols (NPSH). This resulted mainly from increased hepatobiliary transport of GSH as suggested by a close parallelism in the biliary excretion of NPSH and GSH after antimony or bismuth administration. Within 2 hr, rats excreted into bile 55 and 3% of the dose of antimony (50 mumol/kg, i.v.) and bismuth (150 mumol/kg, i.v.), respectively. The time courses of the biliary excretion of these metalloids and NPSH or GSH were strikingly similar suggesting co-ordinate hepatobiliary transport of the metalloids and GSH. However, at the peak of their excretion, each molecule of antimony or bismuth resulted in a co-transport of approximately three molecules of GSH. Diethyl maleate, indocyanine green and sulfobromophthalein (BSP), which decreased biliary excretion of GSH, significantly diminished excretion of antimony and bismuth into bile indicating that hepatobiliary transport of these metalloids is GSH-dependent. Administration of antimony, but not bismuth, decreased hepatic GSH level by 30% and reduced the GSH conjugation and biliary excretion of BSP. These studies demonstrate that the hepatobiliary transport of trivalent antimony and bismuth is GSH-dependent similarly to the hepatobiliary transport of trivalent arsenic. Proportionally to their biliary

  5. Biodistribution of meglumine antimoniate in healthy and Leishmania (Leishmania infantum chagasi-infected BALB/c mice

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema

    2013-08-01

    Full Text Available Pentavalent antimonials such as meglumine antimoniate (MA are the primary treatments for leishmaniasis, a complex disease caused by protozoan parasites of the genus Leishmania . Despite over 70 years of clinical use, their mechanisms of action, toxicity and pharmacokinetics have not been fully elucidated. Radiotracer studies performed on animals have the potential to play a major role in pharmaceutical development. The aims of this study were to prepare an antimony radiotracer by neutron irradiation of MA and to determine the biodistribution of MA in healthy and Leishmania (Leishmania infantum chagasi-infected mice. MA (Glucantime(r was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes, 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This irradiated compound presented anti-leishmanial activity similar to that of non-irradiated MA in both in vitro and in vivo evaluations. In the biodistribution studies, healthy mice showed higher uptake of antimony in the liver than infected mice and elimination occurred primarily through biliary excretion, with a small proportion of the drug excreted by the kidneys. The serum kinetic curve was bi-exponential, with two compartments: the central compartment and another compartment associated with drug excretion. Radiotracers, which can be easily produced by neutron irradiation, were demonstrated to be an interesting tool for answering several questions regarding antimonial pharmacokinetics and chemotherapy.

  6. Development of an analytical method for antimony speciation in vegetables by HPLC-hydride generation-atomic fluorescence spectrometry.

    Science.gov (United States)

    Olivares, David; Bravo, Manuel; Feldmann, Jorg; Raab, Andrea; Neaman, Alexander; Quiroz, Waldo

    2012-01-01

    A new method for antimony speciation in terrestrial edible vegetables (spinach, onions, and carrots) was developed using HPLC with hydride generation-atomic fluorescence spectrometry. Mechanical agitation and ultrasound were tested as extraction techniques. Different extraction reagents were evaluated and optimal conditions were determined using experimental design methodology, where EDTA (10 mmol/L, pH 2.5) was selected because this chelate solution produced the highest extraction yield and exhibited the best compatibility with the mobile phase. The results demonstrated that EDTA prevents oxidation of Sb(III) to Sb(V) and maintains the stability of antimony species during the entire analytical process. The LOD and precision (RSD values obtained) for Sb(V), Sb(III), and trimethyl Sb(V) were 0.08, 0.07, and 0.9 microg/L and 5.0, 5.2, and 4.7%, respectively, for a 100 microL sample volume. The application of this method to real samples allowed extraction of 50% of total antimony content from spinach, while antimony extracted from carrots and onion samples ranged between 50 and 60 and 54 and 70%, respectively. Only Sb(V) was detected in three roots (onion and spinach) that represented 60-70% of the total antimony in the extracts.

  7. Effects of anesthetic agents on cellular 123I-MIBG transport and in vivo 123I-MIBG biodistribution

    International Nuclear Information System (INIS)

    Ko, Bong-Ho; Paik, Jin-Young; Jung, Kyung-Ho; Bae, Jun-Sang; Lee, Eun Jung; Choe, Yearn Seong; Kim, Byung-Tae; Lee, Kyung-Han

    2008-01-01

    Small animal imaging with meta-iodobenzylguanidine (MIBG) allows characterization of animal models, optimization of tumor treatment strategies, and monitoring of gene expression. Anesthetic agents, however, can affect norepinephrine (NE) transport and systemic sympathetic activity. We thus elucidated the effects of anesthetic agents on MIBG transport and biodistribution. SK-N-SH neuroblastoma and PC-12 pheochromocytoma cells were measured for 123 I-MIBG uptake after treatment with ketamine (Ke), xylazine (Xy), Ke/Xy, or pentobarbital (Pb). NE transporters were assessed by Western blots. Normal ICR mice and PC-12 tumor-bearing mice were injected with 123 I-MIBG 10 min after anesthesia with Ke/Xy, Ke, Xy, or Pb. Plasma NE levels and MIBG biodistribution were assessed. Cellular 123 I-MIBG uptake was dose-dependently inhibited by Ke and Xy but not by Pb. Treatment for 2 h with 300 μM Ke, Xy, and Ke/Xy decreased uptake to 46.0 ± 1.6, 24.8 ± 1.5, and 18.3 ± 1.6% of controls. This effect was completely reversed by fresh media, and there was no change in NE transporter levels. In contrast, mice anesthetized with Ke/Xy showed no decrease of MIBG uptake in target organs. Instead, uptakes and organ-to-blood ratios were increased in the heart, lung, liver, and adrenals. Plasma NE was notably reduced in the animals with corresponding decreases in blood MIBG, which partly contributed to the increase in target organ uptake. In spite of their inhibitory effect at the transporter level, Ke/Xy anesthesia is a satisfactory method for MIBG imaging that allows favorable target tissue uptake and contrast by reducing circulating NE and MIBG. (orig.)

  8. Highly active and stable Pt electrocatalysts promoted by antimony-doped SnO2 supports for oxygen reduction reactions

    DEFF Research Database (Denmark)

    Yin, Min; Xu, Junyuan; Li, Qingfeng

    2014-01-01

    Alternative composite supports for platinum catalysts were synthesized from antimony doped tin dioxide (ATO) nanoparticles. In the range of the antimony content from 0 to 11mol%, the highest electrical conductivity of 1.1Scm-1 at 130°C was obtained for the 5mol% Sb ATO, from which composite suppo...

  9. Leishmaniose cutânea com desfecho fatal durante tratamento com antimonial pentavalente American cutaneous leishmaniasis with fatal outcome during pentavalent antimoniate treatment

    Directory of Open Access Journals (Sweden)

    Meiri Vanderlei Nogueira de Lima

    2007-06-01

    Full Text Available Os autores relatam o caso de paciente de 58 anos, hipertensa e diabética, com diagnóstico de leishmaniose tegumentar americana, tratada com antimoniato de N-metil-glucamina (15mg SbV/kg/dia, acompanhada pelo serviço de atenção básica em saúde e que evoluiu para óbito no 18º dia de tratamento.The authors report a case of a 58 years-old, hypertensive, diabetic female patient, with the diagnosis of American cutaneous leishmaniasis, undergoing treatment with Nmethyl glucamine antimoniate (15mg SbV/Kg/day. She was followed up by the basic health care service, but has died on the 18th treatment day.

  10. Labeling of indocyanine green with carrier-free iodine-123

    International Nuclear Information System (INIS)

    Ansari, A.N.; Lambrecht, R.M.; Redvanly, C.S.; Wolf, A.P.

    1976-01-01

    The method is described for labeling indocyanine green (ICG) with carrier-free iodine-123 by condensing xenon-123 on crystals of ICG followed by permitting decay of the 123 Xe a sufficient length of time to produce 123 I-electronically excited ions and atoms which subsequently label ICG. 4 claims, no drawings

  11. Synthesis, characterization and single crystal X-ray analysis of chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III

    Directory of Open Access Journals (Sweden)

    H.P.S. Chauhan

    2015-07-01

    Full Text Available The title compound chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III has been prepared in distilled acetonitrile and characterized by physicochemical [melting point and molecular weight determination, elemental analysis (C, H, N, S & Sb], spectral [FT–IR, far IR, NMR (1H & 13C] studies. The crystal and molecular structure was further confirmed using single crystal X-ray diffraction analysis which features a five-coordinate geometry for antimony(III within a ClS4 donor set. The distortion in the co-planarity of ClSbS3 evidences the stereochemical influence exerts by the lone pair of electrons on antimony(III. Two centrosymmetrically related molecule held together via C–H···Cl secondary interaction result in molecular aggregation of the compound.

  12. Selective liquid-liquid extraction of antimony(III from hydrochloric acid media by N-n-octylaniline in xylene

    Directory of Open Access Journals (Sweden)

    M. A. ANUSE

    2004-04-01

    Full Text Available N-n-Octylaniline in xylene was used for the extraction separation of antimony(III from hydrochloric acid media. Antimony(III was extracted quantitatively with 10 mL 4 % N-n-octylaniline in xylene. It was stripped from the organic phase with 0.5 M ammonia and estimated photometrically by the iodide method. The effect of metal ion, acid, reagent concentration and various foreign ions was investigated. The method affords binary and ternary separation of antimony(III from tellurium(IV, selenium(IV, lead(II, bismuth(III, tin(IV, germanium(IV, copper(II, gold(III, iron(III and zinc(II. The method is applicable for the analysis of synthetic mixtures, alloys and semiconductor thin films. It is fast, accurate and precise.

  13. Leachability of antimony from energy ashes. Total contents, leachability and remedial suggestions; Lakning av antimon fraan energiaskor. Totalhalter, lakbarhet samt foerslag till aatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Baeckstroem, Mattias [Oerebro Univ. (Sweden)

    2006-01-15

    In the current project total concentrations for antimony in 31 energy ashes have been compiled. The average concentration of antimony in boiler fly ash and grate boiler fly ash is 192 and 1,140 mg/kg, respectively. The corresponding antimony concentrations for boiler ashes and grate bottom ashes are 86,5 and 61,8 mg/kg, respectively. Multivariate calculations clearly pointed out waste as the major source for antimony in ashes. The difference between total antimony concentration in fly ash and bottom ash is greatest for grate boilers, in average 18 times higher in the fly ash. The difference for CFB/BFB-boilers is only slightly more than 2. However, based on amount, 75% of the total antimony inventory is recovered in the fly ashes for both CFB/BFB and grate boilers. Eleven (eight of which were bottom ashes) out of the 31 samples exceeded the guidelines for inert waste. It is clear that the higher ionic strength in the solutions from the fly ashes contribute to decrease the solubility for critical minerals retaining antimony. In addition, the fly ashes have considerably larger effective surface able to sorb trace elements. A clear and positive covariance was discovered between aluminium and antimony. Furthermore, it was noted that antimony showed no typical anionic behaviour despite the fact that it according to the geochemical calculations should be present as SbO{sub 3}{sup -}. At L/S 10, a maximum of 1% of the total antimony concentration is leached. This should be compared to chloride that had 94% of the total concentration leached at L/S 10. There was no correlation between the leached antimony concentrations and the total antimony concentrations. The sequential extractions also suggest a low leachability for antimony from the ashes. In average only 9,6% is released at pH 7, 7,3% at pH 5, 3,6% during reducing conditions and 3,2% during oxidising conditions. In total, only 24% of the total antimony concentrations is released during the four extraction steps. The

  14. Field-portable-XRF reveals the ubiquity of antimony in plastic consumer products.

    Science.gov (United States)

    Turner, Andrew; Filella, Montserrat

    2017-04-15

    Very little systematic information exists on the occurrence and concentrations of antimony (Sb) in consumer products. In this study, a Niton XL3t field-portable-X-ray fluorescence (FP-XRF) spectrometer was deployed in situ and in the laboratory to provide quantitative information on Sb dissipated in plastic items and fixtures (including rubber, textile and foamed materials) from the domestic, school, vehicular and office settings. The metalloid was detected in 18% of over 800 measurements performed, with concentrations ranging from about 60 to 60,000μgg -1 . The highest concentrations were encountered in white, electronic casings and in association with similar concentrations of Br, consistent with the use of antimony oxides (e.g. Sb 2 O 3 ) as synergistic flame retardants. Concentrations above 1000μgg -1 , and with or without Br, were also encountered in paints, piping and hosing, adhesives, whiteboards, Christmas decorations, Lego blocks, document carriers, garden furniture, upholstered products and interior panels of private motor vehicles. Lower concentrations of Sb were encountered in a wide variety of items but its presence (without Br) in food tray packaging, single-use drinks bottles, straws and small toys were of greatest concern from a human health perspective. While the latter observations are consistent with the use of antimony compounds as catalysts in the production of polyethylene terephthalate, co-association of Sb and Br in many products not requiring flame retardancy suggests that electronic casings are widely recycled. Further research is required into the mobility of Sb when dissipated in new, recycled and aged polymeric materials. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Dual mode antimony electrode for simultaneous measurements of PO2 and pH.

    Science.gov (United States)

    Sjöberg, F; Nilsson, G

    2000-01-01

    In biomedical research and clinical medicine there is a demand for potent sensors to measure the components that make up blood gas analyses. Today, as when the electrochemical PO2, PCO2 and pH electrodes were first introduced, these measurements are usually made with the same type of sensor technology. The aims of the present study were, firstly, to find out whether the platinum cathode in the Clark electrode can be replaced by antimony for oxygen measurements (amperometry (A)); secondly, whether, during oxygen measurements, the inherent corrosion potential of the antimony metal can be used for measurement of pH in the same measurement area (potentiometry (P)). An electrode of purified, crystallographically orientated monocrystalline antimony (COMA) connected to a reference electrode (silver-silver chloride) was used for the P measurements. Measurements of A (at -900 mV) and P were made in an aqueous environment regulated for oxygen, pH, and temperature. Reproducible oxygen sensitivities of 0.925 nA/% oxygen (2% CV (coefficient of variation)) (A), 10.7 mV/% (P), and 0.7 mV/% (P) were found in the oxygen range: 0-21%, <5%, and above 5%, respectively. The pH sensitivity was 57 mV/pH unit (P). Oxygen and pH measurements were less accurate at oxygen concentrations close to 0%. Both the oxygen and pH part of the composite electrode signal can be identified by this dual mode technique (A and P). The sensor seems to be promising as it provides measurements of two separate variables (oxygen and pH) and also has the desirable characteristics of a solid state sensor.

  16. Pharmacokinetics and tissue distribution of Antimony after multiple intramuscular administrations in the Hamster

    International Nuclear Information System (INIS)

    Al-Jaser, May H.; Radwan, Mahasen A.; Zaghloul, Imam Y.

    2006-01-01

    The fate of pentavalent antimony (Sb) in different tissues in the body after intramuscular administration is of great interest for the future study of Sb therapy in different sitting. Pharmacokinetics and tissue distribution of antimony (Sb) were studied in the hamster after daily dose of sodium stibogluconate equivalent to 120 mg kg of Sb, administered intramuscularly for two weeks. Liver, spleen, heart, kidney and skin tissues were isolated after blood collection at the specified time. Antimony was measured in these tissues after suitable treatment, ashing and processing, by flame less atomic absorption spectrophotometry. The concentration of Sb time profile in blood showed a linear raid decline with elimination half life (tz1/2) of 1.7h. The concentration of drug (ug/gm) declined in a biphasic manner from almost all tissues. However, the concentrations of Sb were declined in slower fashion from the hamster tissues than from the blood. The maximum concentration of Sb was determined in the kidney tissues (3416+-631ug/gm) while the lowest concentration was in the spleen (209+-187ug/gm). The maximum concentration of Sb in the kidney (ug/gm) was more than 25 fold higher than that measured from blood (ug/ml). The AUC of Sb in the studied tissues was in this rank: kidney>liver>skin>spleen>heart>blood. Surprisingly, the heart, spleen and liver showed a similar t1/2 of 5.2-6.2h while the kidney and skin had a t1/2 of about 3h. Therefore, disposition of Sb seems to kinetically follow multicompartmental compartmental model. The kidneys got the highest concentration of drug which may lead to nephrotoxicity on long term therapy. (author)

  17. Identification and interconversion of isomeric 4,5-functionalized 1,2,3-thiadiazoles and 1,2,3-triazoles in conditions of electrospray ionization.

    Science.gov (United States)

    Mazur, D M; Zimens, M E; Bakulev, V A; Lebedev, A T

    2017-10-25

    1,2,3-Triazoles and 1,2,3-thiadiazoles have been receiving permanent interest due to their exciting chemical reactivity and interesting biological properties including antibacterial, anticancer and antiviral activities. There are four compounds bearing 1H-1,2,3-triazole core in clinical studies which may appear in the market of drugs in nearest future. Definitely reliable methods of their identification and quantification should be developed by that time. Mass spectrometry showed itself as the most reliable method of analysis when dealing with trace levels of organic compounds in the mixtures and in the most complex matrices, including biological ones. In the present study tandem mass spectrometry was used to study fragmentation pathways of protonated and deprotonated molecules of isomeric 4,5-functionalized 1,2,3-thiadiazoles and 1,2,3-triazoles in conditions of electrospray ionization (ESI). A group of marker ions allowing differentiation between the targeted isomeric compounds was established. Besides, interconversion of these isomers into one another was studied in the gas phase in conditions mimicking these processes in solution. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Antimony Adsorption from Zarshouran Gold Mineral Processing Plant Wastewater by Nano Zero Valent Iron Coated on Bentonite

    Directory of Open Access Journals (Sweden)

    nader nosrati

    2015-03-01

    Full Text Available The effluent from Zarshouran gold mineral processing plant contains high quantities of arsenic, antimony, mercury, and bismuth. These metals and metalloids are soluble in water and very toxic when they enter the environment. Their solubility in water causes the polluted area to extend beyond their point of origin. In this article, different methods of antimony removal from water and wastewater were reviewed and the zero-valent iron nanoparticles coated on Bentonite were selected as an effective and low cost material for removing antimony from wastewater. For the purposes of this study, zero-valent iron nanoparticles of 40-100 nanometers in size were synthesized by dropwise addition of sodium borohydride solution to an Iron (III aqueous solution at  ambient temperature and mixed with nitrogen gas. To avoid particle agglomeration and to enhance the product’s environmentally safe application, the  nanoparticles were coated on Bentonite and characterized by SEM/EDAX and BET. The experiments were carried out by intense mixing of the adsorbent with 10ml of real/synthtic wastewater samples in 20ml bottles.  The effects of pH, contact time, temperature, and adsorbent dosage on antimony removal efficiency were investigated under intense mixing using a magnetic mixer. Finally, the effluents were filtered upon completion of the experiments and used for atomic adsorption analysis. The results of the experiments showed that the adsorption isotherms of the synthesized nanoparticles obeyed the Langmuir and Freundlich models. The experiments carried out on real samples showed that antimony adsorption capacity for B-nZVI was 2.6 mg/g of the adsorbent and that the highest antimony removal efficiency was 99.56%.

  19. Quantitative SPECT reconstruction of iodine-123 data

    International Nuclear Information System (INIS)

    Gilland, D.R.; Jaszczak, R.J.; Greer, K.L.; Coleman, R.E.

    1991-01-01

    Many clinical and research studies in nuclear medicine require quantitation of iodine-123 ( 123 I) distribution for the determination of kinetics or localization. The objective of this study was to implement several reconstruction methods designed for single-photon emission computed tomography (SPECT) using 123 I and to evaluate their performance in terms of quantitative accuracy, image artifacts, and noise. The methods consisted of four attenuation and scatter compensation schemes incorporated into both the filtered backprojection/Chang (FBP) and maximum likelihood-expectation maximization (ML-EM) reconstruction algorithms. The methods were evaluated on data acquired of a phantom containing a hot sphere of 123 I activity in a lower level background 123 I distribution and nonuniform density media. For both reconstruction algorithms, nonuniform attenuation compensation combined with either scatter subtraction or Metz filtering produced images that were quantitatively accurate to within 15% of the true value. The ML-EM algorithm demonstrated quantitative accuracy comparable to FBP and smaller relative noise magnitude for all compensation schemes

  20. Photodegradation of Naphthol green B in the presence of semiconducting antimony trisulphide - SHORT COMMUNICATION

    Directory of Open Access Journals (Sweden)

    RAKSHIT AMETA

    2011-07-01

    Full Text Available Different methods of wastewater treatment are being used for the removal of dyes from their solution, but in most of the cases, either homogeneous catalysts or different adsorbents are used. These methods have their own merits and demerits. In the present work, antimony trisulphide was used as a heterogeneous catalyst. The effects of different parameters on the rate of the reaction were observed, such as pH, concentration of dye, amount of semiconductor and light intensity. A tentative mechanism is proposed in which the role of hydroxyl radical as an active oxidizing species is shown for degradation of Naphthol green B.

  1. Determination of arsenic, selenium and antimony by neutron activation analysis. Application to hair samples

    International Nuclear Information System (INIS)

    Das, H.A.; Hoede, D.; Nieuwendijk, B.J.T.; Sloot, H.A. van der; Teunissen, G.J.A.; Woittiez, J.R.W.

    1983-04-01

    A fast rabbit system for instrumental activation analysis with reactor neutrons is described. Its use in the determination of selenium in hair is discussed. A survey is given of the correction factors which are inherent to the use of short-lived radionuclides. An alternative to INAA is NAA based on the separation of arsenic, selenium and antimony by hydride evaporation and adsorption to active carbon. Data for some Standard Reference Materials are given. This work was done under research contract 2440/RI/RB with the IAEA

  2. Direct Band Gap Gallium Antimony Phosphide (GaSbxP1−x) Alloys

    OpenAIRE

    H. B. Russell; A. N. Andriotis; M. Menon; J. B. Jasinski; A. Martinez-Garcia; M. K. Sunkara

    2016-01-01

    Here, we report direct band gap transition for Gallium Phosphide (GaP) when alloyed with just 1?2 at% antimony (Sb) utilizing both density functional theory based computations and experiments. First principles density functional theory calculations of GaSbxP1?x alloys in a 216 atom supercell configuration indicate that an indirect to direct band gap transition occurs at x?=?0.0092 or higher Sb incorporation into GaSbxP1?x. Furthermore, these calculations indicate band edge straddling of the h...

  3. Targets and special materials

    International Nuclear Information System (INIS)

    Blanc, R.; Bouriant, M.; Richaud, J.P.

    1997-01-01

    The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)

  4. Synthesis, characterization and electrochemical performances of new antimony-containing graphite compounds used as anodes for lithium-ion batteries

    International Nuclear Information System (INIS)

    Dailly, A.; Willmann, P.; Billaud, D.

    2002-01-01

    Graphite intercalation intercalated with metal alloys able to alloy reversibly lithium constitute a large set of new anodic materials for lithium-ion batteries of significantly improved reversible capacities. Especially, graphite intercalated with cesium-antimony alloys can be used as materials for anodes in lithium-ion batteries. Electrochemical insertion of lithium in such chemically modified precursors shows that lithium both intercalates in the empty van der Waals spaces of graphite and alloys reversibly with antimony. The total electrochemical reversible capacities, measured between 0 and 2 V vs Li + /Li, close to 700 mAh g -1 have been currently obtained

  5. The effect of trace amounts of antimony on the structure and properties of aluminum alloy A356. 2

    Energy Technology Data Exchange (ETDEWEB)

    Tuttle, B.L. (Tuttle (B.L.) (USA)); Keslinke, A. (Cast Metals Inst., Des Plaines, IL (USA)); Twarog, D.L. (American Foundrymens' Society, Des Plaines, IL (USA)); Daniels, E.J. (Argonne National Lab., IL (USA))

    1989-01-01

    This investigation was performed to determine the effect of trace amounts of antimony (Sb) on the microstructure, mechanical properties, and casting properties of strontium-modified A356.2 aluminum alloy that was cast in chemically bonded sand molds. The aluminum-silicon alloys were prepared in a high-frequency induction furnace from primary A356.2 ingot of commercial purity. Each melt was grain-refined with aluminum-titanium rod, modified with aluminum-strontium-silicon rod, and degassed with dry nitrogen. Five heats were prepared at each target level of Sb: 0.00, 0.05, 0.10, 0.15 and 0.20 wt %. Significant changes in mechanical and foundry properties resulted from changes in the morphology of the aluminum-silicon eutectic microstructure at the different Sb concentrations. The principle mechanical property affected was elongation (ductility). At an Sb concentration of 0.00%, elongation was 5.3%. At a concentration of 0.06%, elongation decreased to 2.9%. The fluidity of the alloy was also affected. At all three temperatures investigated, fluidity declined approximately 17% at 0.14% Sb relative to alloy containing no Sb. At an Sb content of 0.26%, the fluidity increased approximately 22% (relative to that at 0.14% Sb) to a value slightly higher than that of the Sr-modified alloy containing no Sb. None of the thermal analysis curves for the five levels of Sb addition indicated a cooling curve inflection that could be attributed to the presence of Sb alone. 14 refs., 9 figs., 10 tabs.

  6. Synthesis of 123I-16 iodo estradiol

    International Nuclear Information System (INIS)

    Therain, F.; Gros, J.; Souchu, A.

    1982-01-01

    16α iodo estradiol has been demonstrated to have as good an affinity as estradiol for estrogen-receptors and, labeled with iodine 123, may provide a good scanning agent fot visualisation of tissues containing estrogen-repectors, especially mammary tumors. 123 I-16α iodo estradiol has been synthesized by an halogen exchange of 16ν bromo estradiol according to the procedure described by Hochberg for 125 I-16α iodo estradiol labeling. Radiochemical yields are much lower than with iodine 125 (1 to 30%) and extremely variable. Specific activity range from 1,000 to 2,000 Ci/mmole [fr

  7. Iodine-123 program at the TRIUMF laboratory

    International Nuclear Information System (INIS)

    Vincent, J.S.

    1985-01-01

    A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction

  8. 1,2,3-triazolyl amino acids as AMPA receptor ligands

    DEFF Research Database (Denmark)

    Stanley, Nathan J.; Pedersen, Daniel Sejer; Nielsen, Birgitte

    2010-01-01

    The central nervous system glutamate receptors are an important target for drug discovery. Herein we report initial investigations into the synthesis and glutamate receptor activity of 1,2,3-triazolyl amino acids. Two compounds were found to be selective AMPA receptor ligands, which warrant further...

  9. Structural and optical study on antimony-silicate glasses doped with thulium ions.

    Science.gov (United States)

    Dorosz, D; Zmojda, J; Kochanowicz, M; Miluski, P; Jelen, P; Sitarz, M

    2015-01-05

    Structural, spectroscopic and thermal properties of SiO₂-Al₂O₃-Sb₂O₃-Na₂O glass system doped with 0.2 mol% Tm₂O₃ have been presented. Synthesis of antimony-silicate glasses with relatively low phonon energy (600 cm(-1), which implicates a small non-radiative decay rate) was performed by conventional high-temperature melt-quenching methods. The effect of SiO₂/Sb₂O₃ ratio in fabricated Tm(3+) doped glass on thermal, structural and luminescence properties was investigated. On the basis of structural investigations decomposition of absorption bands in the infrared FTIR region was performed, thus determining that antimony ions are the only glass-forming ions, setting up the lattice of fabricated glasses. Luminescence band at the wavelength of 1.8 μm corresponding to (3)F₄→(3)H₆ transition in thulium ions was obtained under 795 nm laser pumping. It was observed that combination of relatively low phonon energy and greater separation of optically active centers in the fabricated glasses influenced in decreasing the luminescence intensity at 1800 nm. Copyright © 2014 Elsevier B.V. All rights reserved.

  10. Determination of Trace Antimony (III by Adsorption Voltammetry at Carbon Paste Electrode

    Directory of Open Access Journals (Sweden)

    Nongyue He

    2005-05-01

    Full Text Available This work presents a sensitive method for the determination of trace antimonybased on the antimony-pyrogallol red (PGR adsorption at a carbon paste electrode (CPE.The optimal conditions were to use an electrode containing 25% paraffin oil and 75%high purity graphite powder as working electrode, a 0.10 mol/L HCl solution containing3.0×10-5 mol/L PGR as accumulation medium and a 0.20 mol/L HCl solution aselectrolyte with an accumulation time of 150 s and a reduction time of 60 s at -0.50 Vfollowed with a sweep from -0.50 V to 0.20 V. The mechanism of the electrode reactionwas discussed. Interferences of other metal ions were studied as well. The detection limitwas 1×10-9 mol/L. The linear range was from 2.0×10-9 mol/L to 5.0×10-7 mol/L.Application of the proposed method to the determination of antimony in water andhuman hair samples gave good results.

  11. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium

    Directory of Open Access Journals (Sweden)

    Rajmund Michalski

    2012-01-01

    Full Text Available Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemical cycles of chemical compounds, determination of toxicity and ecotoxicity of selected elements, quality control of food products, control of medicines and pharmaceutical products, technological process control, research on the impact of technological installation on the environment, examination of occupational exposure, and clinical analysis. Conventional methods are usually labor intensive, time consuming, and susceptible to interferences. The hyphenated techniques, in which separation method is coupled with multidimensional detectors, have become useful alternatives. The main advantages of those techniques consist in extremely low detection and quantification limits, insignificant interference, influence as well as high precision and repeatability of the determinations. In view of their importance, the present work overviews and discusses different hyphenated techniques used for arsenic, antimony, and thallium species analysis, in different clinical, environmental and food matrices.

  12. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium

    Science.gov (United States)

    Michalski, Rajmund; Szopa, Sebastian; Jabłońska, Magdalena; Łyko, Aleksandra

    2012-01-01

    Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemical cycles of chemical compounds, determination of toxicity and ecotoxicity of selected elements, quality control of food products, control of medicines and pharmaceutical products, technological process control, research on the impact of technological installation on the environment, examination of occupational exposure, and clinical analysis. Conventional methods are usually labor intensive, time consuming, and susceptible to interferences. The hyphenated techniques, in which separation method is coupled with multidimensional detectors, have become useful alternatives. The main advantages of those techniques consist in extremely low detection and quantification limits, insignificant interference, influence as well as high precision and repeatability of the determinations. In view of their importance, the present work overviews and discusses different hyphenated techniques used for arsenic, antimony, and thallium species analysis, in different clinical, environmental and food matrices. PMID:22654649

  13. Migration of antimony from PET containers into regulated EU food simulants.

    Science.gov (United States)

    Sánchez-Martínez, María; Pérez-Corona, Teresa; Cámara, Carmen; Madrid, Yolanda

    2013-11-15

    Antimony migration from polyethylene terephthalate (PET) containers into aqueous (distilled water, 3% acetic acid, 10% and 20% ethanol) and fatty food simulants (vegetable oil), as well as into vinegar, was studied. Test conditions were according to the recent European Regulation 10/2011 (EU, 2011). Sb migration was assayed by ICP-MS and HG-AFS. The results showed that Sb migration values ranged from 0.5 to 1.2μg Sb/l, which are far below the maximum permissible migration value for Sb, 40μg Sb/kg, (EU, Regulation 10/2011). Parameters as temperature and bottle re-use influence were studied. To assess toxicity, antimony speciation was performed by HPLC-ICP-MS and HG-AFS. While Sb(V) was the only species detected in aqueous simulants, an additional species (Sb-acetate complex) was measured in wine vinegar. Unlike most of the studies reported in the literature, migration tests were based on the application of the EU directive, which enables comparison and harmonisation of results. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Antimonial Therapy Induces Circulating Proinflammatory Cytokines in Patients with Cutaneous Leishmaniasis

    Science.gov (United States)

    Kocyigit, Abdurrahim; Gur, Selahaddin; Gurel, Mehmet S.; Bulut, Vedat; Ulukanligil, Mustafa

    2002-01-01

    The objective of this study was to evaluate the association between antimonial therapy and circulating levels of proinflammatory cytokines in patients with cutaneous leishmaniasis (CL). Patients were treated with conventional chemotherapy by using pentavalent antimonium salts (Glucantime) for 3 weeks. Circulating plasma levels of the proinflammatory cytokines interleukin-1β (IL-1β), IL-6, IL-8, and tumor necrosis factor alpha (TNF-α) were determined for CL patients and healthy subjects before and 3 weeks after the treatment was started. Plasma IL-1β, IL-6, IL-8, and TNF-α levels were significantly higher for pretreatment CL patients than for healthy subjects. Proinflammatory cytokines significantly increased after 21 days postinfection compared to levels for the pretreatment patients. These increments were approximately 3-fold for IL-1β and TNF-α levels, 10-fold for IL-6 levels, and 20-fold for IL-8 levels in patients with CL. Taken together these results indicate that circulating proinflammatory cytokine levels were increased in patients with CL as a consequence of host defense strategies, and antimonial therapy may induce these cytokines by affecting the macrophage or other components of the host defense system. PMID:12438329

  15. Meglumine antimoniate is more effective than sodium stibogluconate in the treatment of cutaneous leishmaniasis.

    Science.gov (United States)

    Yesilova, Yavuz; Surucu, Hacer Altın; Ardic, Nurittin; Aksoy, Mustafa; Yesilova, Abdullah; Oghumu, Steve; Satoskar, Abhay R

    2016-01-01

    Sodium stibogluconate (SSG, Pentostam) and meglumine antimoniate (MA, Glucantime) are two antimonials that are widely used to treat cutaneous leishmaniasis (CL), but the relative efficacies of these treatments are not clear. The aim of this study is to compare the efficacy of intralesional SSG with intralesional MA therapy in the treatment of CL. One month after completion of the therapy, 1431 of 1728 patients (82%) who received intralesional MA showed complete clinical cure compared to 1157 of 1728 patients (67%) in the SSG group. Patients who did not respond to the first round of therapy were re-administered the same treatment but with twice weekly injections. Following completion of the second course of therapy, 237 of 297 patients (80%) in the MA group and 407 of 561 patients (72%) in the SSG group healed their lesions by 1-month post-treatment. At both times, the differences in cure rates between MA and SSG groups were statistically significant (p < 0.05). Cure rates in the MA group were always significantly higher than SSG groups irrespective of other parameters including age, gender, lesion site and type of lesion. Intralesional MA is more effective than intralesional SSG in the treatment of CL.

  16. Growth of antimony doped P-type zinc oxide nanowires for optoelectronics

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Zhong Lin; Pradel, Ken

    2016-09-27

    In a method of growing p-type nanowires, a nanowire growth solution of zinc nitrate (Zn(NO.sub.3).sub.2), hexamethylenetetramine (HMTA) and polyethylenemine (800 M.sub.w PEI) is prepared. A dopant solution to the growth solution, the dopant solution including an equal molar ration of sodium hydroxide (NaOH), glycolic acid (C.sub.2H.sub.4O.sub.3) and antimony acetate (Sb(CH.sub.3COO).sub.3) in water is prepared. The dopant solution and the growth solution combine to generate a resulting solution that includes antimony to zinc in a ratio of between 0.2% molar to 2.0% molar, the resulting solution having a top surface. An ammonia solution is added to the resulting solution. A ZnO seed layer is applied to a substrate and the substrate is placed into the top surface of the resulting solution with the ZnO seed layer facing downwardly for a predetermined time until Sb-doped ZnO nanowires having a length of at least 5 .mu.m have grown from the ZnO seed layer.

  17. High levels of antimony in dust from e-waste recycling in southeastern China

    International Nuclear Information System (INIS)

    Bi, Xiangyang; Li, Zhonggen; Zhuang, Xiaochun; Han, Zhixuan; Yang, Wenlin

    2011-01-01

    Environmental contamination due to uncontrolled e-waste recycling is an emerging global issue. Antimony (Sb) is a toxic element used in semiconductor components and flame retardants for circuit board within electronic equipment. When e-waste is recycled, Sb is released and contaminates the surrounding environment; however, few studies have characterized the extent of this problem. In this study, we investigated Sb and arsenic (As) distributions in indoor dust from 13 e-waste recycling villages in Guiyu, Guangdong Province, southeastern China. Results revealed significantly elevated concentrations of Sb (6.1-232 mg/kg) in dust within all villages, which were 3.9-147 times higher than those from the non e-waste sites, indicating e-waste recycling was an important source of Sb pollution. On the contrary, As concentrations (5.4-17.7 mg/kg) in e-waste dusts were similar to reference values from the control sites. Therefore, dusts emitted from e-waste recycling may be characterized by high Sb/As ratios, which may help identify the contamination due to the e-waste recycling activities. - Highlights: → Antimony and arsenic concentrations in dust from e-waste recycling were investigated. → E-waste recycling is an important emerging source of Sb pollution. → Sb/As ratios may help identify the e-waste contamination.

  18. Leaching of the antimony and accompanying of elements Sb2S3 in the alkaline medium

    Directory of Open Access Journals (Sweden)

    Dagmar Remeteiová

    2007-06-01

    Full Text Available This paper presents results of the laboratory investigation of alkaline leaching of stibnite that is an important mineral occuring in the antimony-bearing raw materials. The following components were present in stibnite: Sb2S3, SiO2, ZnS, FeS2. The aim of this study was to establish the effect of composition of the aqueous alkaline leaching medium (1 % NaOH, 1 % NaOH + 1 % Na2S2O3, 1 % NaOH + 1 % Na2S on the recoveries of Sb, Fe, Pb, Zn, Cu, Ni and Hg. The antimony recoveries in the leaching solutions NaOH and NaOH + Na2S2O3 solutions were lower in comparison with the leaching in NaOH + Na2S. The Fe, Pb, Zn recoveries in alkaline solutions were found to decrease in the following order: Fe, Pb, Zn. The mercury recovery in the leaching test with the solution containing 1 % NaOH+1 % Na2S was 3,7 %.

  19. Evaluation of antimony microparticles supported on biochar for application in the voltammetric determination of paraquat.

    Science.gov (United States)

    Gevaerd, Ava; de Oliveira, Paulo R; Mangrich, Antonio S; Bergamini, Márcio F; Marcolino-Junior, Luiz H

    2016-05-01

    This work describes the construction and application of carbon paste electrodes modified with biochar and antimony microparticles (SbBCPE) for voltammetric determination of paraquat using a simple and sensitive procedure based on voltammetric stripping analysis. Some parameters such as amount of biochar and antimony used in the composition of the carbon paste and instrumental parameters were examined in detail. Under optimized conditions, an analytical curve was obtained for paraquat determination employing SbBCPE, which showed a linear response ranging from 0.2 to 2.9 μmol L(-1), with limit of detection and quantification of 34 nmol L(-1) and 113 nmol L(-1), respectively, after paraquat pre-concentration of 120 s. The repeatability study presented a RSD=2.0% for 10 consecutive measurements using the same electrode surface and the reproducibility study showed a RSD=2.7% for measurements with 10 different electrode surfaces. The proposed sensor was successfully applied for paraquat determination in tap water and citric fruit juice spiked samples and good recoveries were obtained without any sample pre-treatment, showing its promising analytical performance. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Determination of antimony in nail and hair by thermal neutron activation analysis

    International Nuclear Information System (INIS)

    Katayama, Yukio; Ishida, Norio

    1987-01-01

    The concentration of antimony in nail and hair was determined by thermal neutron activation analysis. Samples were collected from the workers of an antimony refinery, inhabitants near the refinery, and residents in control area. They were irradiated by Kyoto University 5000 kW Reactor for 1 h, and cooled for 30 to 100 days. After cooling, the concentration of Sb in nail and hair was estimated by measuring the intensity of γ-ray from 124 Sb of the samples, then the samples were washed by 0.1 % aqueous solution of nonionic surface active agent in an ultrasonic cleaner. The γ-ray spectrometry was done again (after washing). The concentration of Sb in nail before washing was 730 ppm for the workers, 2.46 ppm for habitants near the refinery, and 0.19 ppm for the control; after washing, it became 230 ppm for the workers, 0.63 ppm for habitants, and 0.09 ppm for the control. The concentration of Sb in hair before and after washing was 222 ppm and 196 ppm for the workers, and 0.21 ppm and 0.15 ppm for the control, respectively. (author)

  1. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic

    International Nuclear Information System (INIS)

    Jia Nan; Sun Liguang; He Xin; You Kehua; Zhou Xin; Long Nanye

    2012-01-01

    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. - Highlights: ► We examined the distribution of antimony in topsoil and moss in Ny-Ålesund, Arctic. ► The distribution of Sb is associated with traffic and historical mining activities. ► The weathering of coal bed cannot lead to the Sb increase in the surface environment. ► The distribution of Sb in moss could reflect the accumulation of Sb pollution. ► Moss can be a useful tool for monitoring Sb in highly and lightly polluted areas. - The distribution of Sb in Ny-Ålesund is partially associated with traffic and historical mining activities, and moss can be a useful tool for monitoring Sb in both highly and lightly polluted areas.

  2. V123 Beam Synchronous Encoder Module

    International Nuclear Information System (INIS)

    Kerner, T.; Conkling, C. R.; Oerter, B.

    1999-01-01

    The V123 Synchronous Encoder Module transmits events to distributed trigger modules and embedded decoders around the RHIC rings where they are used to provide beam instrumentation triggers [1,2,3]. The RHIC beam synchronous event link hardware is mainly comprised of three VMEbus board designs, the central input modules (V201), and encoder modules (V123), and the distributed trigger modules (V124). Two beam synchronous links, one for each ring, are distributed via fiberoptic and fanned out via twisted wire pair cables. The V123 synchronizes with the RF system clock derived from the beam bucket frequency and a revolution fiducial pulse. The RF system clock is used to create the beam synchronous event link carrier and events are synchronized with the rotation fiducial. A low jitter RF clock is later recovered from this carrier by phase lock loops in the trigger modules. Prioritized hardware and software triggers fill up to 15 beam event code transmission slots per revolution while tracking the ramping RF acceleration frequency and storage frequency. The revolution fiducial event is always the first event transmitted which is used to synchronize the firing of the abort kicker and to locate the first bucket for decoders distributed about the ring

  3. I-123 IMP SPECT in Parkinson's disease

    International Nuclear Information System (INIS)

    Kawabata, Keita; Tachibana, Kyudai; Sugita, Minoru

    1990-01-01

    To examine semiquantitatively regional cerebral blood flow, SPECT with N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) was undertaken in 17 patients with Parkinson's disease. Seven patients with Alzheimer's disease and 9 senile control subjects were also imaged for comparison. Both the Parkinson's disease group and the Alzheimer's disease group had a decreased uptake of I-123 IMP in the frontal lobe, in comparison with the control group. A remarkably decreased uptake was seen in the lateral and parietal lobes in the group of Parkinson's disease associated with dementia, as well as in the Alzheimer's disease group. A significantly decreased uptake was observed in the frontal lobe, lateral lobe, thalamus, and basal ganglia in the Parkinson's disease group, irrespective of the presence or absence of dementia. For Parkinson's disease associated with dementia, there was much more significant decrease in I-123 IMP uptake. The pattern of regional cerebral blood flow in the Alzheimer's disease group was analogous to that in the Parkinson's disease group associated with dementia. This supports the hypothesis that Alzheimer's disease may be somewhat involved in the occurrence of dementia for Parkinson's disease. (N.K.)

  4. Autoradiolytic decomposition and reductant-free sodium sup 124 I- and sup 123 I-iodide

    Energy Technology Data Exchange (ETDEWEB)

    Sajjad, M.; Lambrecht, R.M.; Bakr, S.A. (King Faisal Specialist Hospital and Research Centre, Riyadh (Saudi Arabia). Radionuclide and Cyclotron Operations)

    1990-01-01

    The presence of salts and metal cations in {sup 124}I- and {sup 123}I-sodium iodide solutions separated from {sup 124}Te targets promots autoradiolytic decomposition of iodide to several different iodine species dependent upon the chemical environment. The stabilization of the radioiodine as iodide by removal of trace salts and trace metal cations and in the absence of reducing agents is described. The high specific activity {sup 123}I- and {sup 124}I-iodide is suitable for labeling antibodies, proteins and radiopharmaceuticals. (orig.).

  5. Glass and antimony electrodes for long-term pH monitoring: a dynamic in vitro comparison

    NARCIS (Netherlands)

    Geus, W. P.; Smout, A. J.; Kooiman, J. C.; Lamers, C. B.; Gues, J. W.

    1995-01-01

    OBJECTIVE: To compare the performance of combined glass microelectrodes with monocrystalline and polycrystalline antimony electrodes with external reference in a 24-h dynamic in vitro study. DESIGN AND METHODS: In an artificial stomach, the pH of the contents titrated from pH1-7 and back by NaOH and

  6. Ambulatory oesophageal pH monitoring: a comparison between antimony, ISFET, and glass pH electrodes

    NARCIS (Netherlands)

    Hemmink, Gerrit J. M.; Weusten, Bas L. A. M.; Oors, Jac; Bredenoord, Albert J.; Timmer, Robin; Smout, André J. P. M.

    2010-01-01

    BACKGROUND AND AIM: Ambulatory oesophageal pH-impedance monitoring is a widely used test to evaluate patients with reflux symptoms. Several types of pH electrodes are available: antimony, ion sensitive field effect transistor (ISFET), and glass electrodes. These pH electrodes have not been compared

  7. Health and ecological risk assessment of heavy metals pollution in an antimony mining region: a case study from South China.

    Science.gov (United States)

    Fei, Jiang-Chi; Min, Xiao-Bo; Wang, Zhen-Xing; Pang, Zhi-Hua; Liang, Yan-Jie; Ke, Yong

    2017-12-01

    In recent years, international research on the toxicity of the heavy metal, antimony, has gradually changed focus from early medical and pharmacological toxicology to environmental toxicology and ecotoxicology. However, little research has been conducted for sources identification and risk management of heavy metals pollution by long-term antimony mining activities. In this study, a large number of investigations were conducted on the temporal and spatial distribution of antimony and related heavy metal contaminants (lead, zinc, and arsenic), as well as on the exposure risks for the population for the Yuxi river basin in the Hunan province, China. The scope of the investigations included mine water, waste rock, tailings, agricultural soil, surface water, river sediments, and groundwater sources of drinking water. Health and ecological risks from exposure to heavy metal pollution were evaluated. The main pollution sources of heavy metals in the Yuxi River basin were analyzed. Remediation programs and risk management strategies for heavy metal pollution were consequently proposed. This article provides a scientific basis for the risk assessment and management of heavy metal pollution caused by antimony basin ore mining.

  8. Comparative phytotoxicity of methylated and inorganic arsenic- and antimony species to Lemna minor, Wolffia arrhiza and Selenastrum capricornutum

    NARCIS (Netherlands)

    Duester, L.; van der Geest, H.G.; Moelleken, S.; Hirner, A.V.; Kueppers, K.

    2011-01-01

    The alkylation of metalloids through the transfer of methyl groups is an important factor in the biogeochemical cycling of elements like arsenic and antimony. In the environment, many different organic and inorganic forms of these elements can therefore be found in soils, sediments or organisms.

  9. Effect of Annealing on the Properties of Antimony Telluride Thin Films and Their Applications in CdTe Solar Cells

    Directory of Open Access Journals (Sweden)

    Zhouling Wang

    2014-01-01

    Full Text Available Antimony telluride alloy thin films were deposited at room temperature by using the vacuum coevaporation method. The films were annealed at different temperatures in N2 ambient, and then the compositional, structural, and electrical properties of antimony telluride thin films were characterized by X-ray fluorescence, X-ray diffraction, differential thermal analysis, and Hall measurements. The results indicate that single phase antimony telluride existed when the annealing temperature was higher than 488 K. All thin films exhibited p-type conductivity with high carrier concentrations. Cell performance was greatly improved when the antimony telluride thin films were used as the back contact layer for CdTe thin film solar cells. The dark current voltage and capacitance voltage measurements were performed to investigate the formation of the back contacts for the cells with or without Sb2Te3 buffer layers. CdTe solar cells with the buffer layers can reduce the series resistance and eliminate the reverse junction between CdTe and metal electrodes.

  10. Radiosynthesis and evaluation of two novel 123I-labeled 2-methyl-4-nitroimidazole derivatives as potential infection imaging agents.

    Science.gov (United States)

    Rossouw, Daniel D; Lötter, Mattheus G; du Raan, Hanlie; Jansen, Susara E; Höhn, Alexander; Burger, Ben V

    2005-05-01

    The inflammation- and infection-seeking properties of (131)I-labeled ornidazole, a 5-nitroimidazole derivative, have recently been reported. Whole-body images in rabbits showed a more rapid uptake in inflamed areas compared to (67)Ga. In the present study, two novel (123)I-labeled 2-methyl-4-nitroimidazole derivatives were synthesized and their infection-seeking properties compared with those of (67)Ga and (123)I-labeled ornidazole. Radiolabeling was carried out by means of iodide-for-tosylate, triflate or halogen exchange. Various methods were utilized in order to synthesize the labeling precursors for the (123)I-labeled novel compounds. Serum stability studies on all of the (123)I-labeled tracers were followed by gamma camera imaging studies on rabbits artificially infected with Escherichia coli bacteria. The (123)I-labeled tracers were obtained in moderate to good radiochemical yields (34-80%) and acceptable radiochemical purities (93-99%). In contrast to (123)I-labeled ornidazole, 1-[(1-hydroxy-3-[(123)I]iodoprop-2-yloxy)methyl]-2-methyl-4-nitroimidazole (2) and 1-[(1-[(123)I]iodoprop-2-yloxy)methyl]-2-methyl-4-nitroimidazole (3) showed high serum stability. Compared to noninfected controls, all of the (123)I-labeled tracers showed increased uptake at the area of induced infection after 6 and 24 h, but the uptake was significantly lower than in the case of (67)Ga over the same period. Tracer 3 showed a slightly superior uptake after 6 h than the other (123)I-labeled tracers over the same period. The advantage of the initially slightly faster rate at which nitroimidazole tracers appear to accumulate in the infection area in comparison to (67)Ga might not outweigh the advantage of the eventual higher target to nontarget ratio displayed by (67)Ga.

  11. American cutaneous leishmaniasis caused by Leishmania (Viannia braziliensis resistant to meglumine antimoniate, but with good response to pentamidine: a case report

    Directory of Open Access Journals (Sweden)

    Maria Inês Fernandes Pimentel

    2011-04-01

    Full Text Available This is a case report of a Brazilian soldier with cutaneous leishmaniasis. The lesion relapsed following two systemic treatments with meglumine antimoniate. The patient was treated with amphotericin B, which was interrupted due to poor tolerance. Following isolation of Leishmania sp., six intralesional infiltrations of meglumine antimoniate resulted in no response. Leishmania sp promastigotes were again isolated. The patient was submitted to intramuscular 4mg/kg pentamidine. Parasites from the first and second biopsies were identified as Leishmania (Viannia braziliensis; those isolated from the first biopsy were more sensitive to meglumine antimoniate in vitro than those isolated from the second biopsy. No relapse was observed.

  12. Speciation of Sb(III) and Sb(V) in meglumine antimoniate pharmaceutical formulations by PSA using carbon nanotube electrode.

    Science.gov (United States)

    Santos, Vivian Silva; Santos, Wilney de Jesus Rodrigues; Kubota, Lauro Tatsuo; Tarley, César Ricardo Teixeira

    2009-09-08

    A new and simple electroanalytical method for speciation of Sb(III) and Sb(V) in pharmaceutical formulation by potentiometric stripping analysis (PSA) using a multiwall carbon nanotube paste electrode was developed. All instrumental and chemical parameters influencing the performance of the method were carefully assessed and optimized. Trivalent antimony was determined in acid medium (pH 3.6) under the optimized condition (deposition potential of -0.7 V, deposition time of 180 s, ionic strength of 0.3M and oxidant mercury concentration of 10 mg l(-1)). Total antimony was determined after quantitative reduction of Sb(V) with l-cysteine (1.5%, w/v) and its concentration was calculated from difference between the total antimony and Sb(III). The developed method provided two distinct linear calibration one ranging from 10 up to 50 microg l(-1) and other from 100 up to 800 microg l(-1) with respective correlation coefficient of 0.9978 and 0.9993, presenting a detection limit of 6.2 microg l(-1). Repeatability for the six independent samples expressed in terms of relative standard deviation was found to be 3.01 and 1.39% for 40.0 and 300.0 microg l(-1) antimony concentration, respectively. Results on the effect of foreign substances [Al(III), Mg(II), Fe(III), Cd(II), Zn(II) and meglumine] on analytical signal of antimony showed no interference even using high content of foreign ions in the analyte:interferent ratio up to 1:100. The proposed method was successfully applied for the speciation of Sb(III) and Sb(V) in pharmaceutical formulation and the accuracy was assessed from addition and recovery tests as well as comparing with graphite furnace atomic absorption spectrometry (GF AAS) technique used as reference analytical method.

  13. Synthesis, biological distribution and radiation dosimetry of Te-123m analogues of hexadecenoic acid

    International Nuclear Information System (INIS)

    Basmadjian, G.P.; Ice, R.D.; Mills, S.L.

    1982-01-01

    The synthesis and biological distribution of four Te-123m analogues of hexadecenoic acid in rats, rabbits and dogs were described for use as possible myocardial imaging agents. The heart-to-blood ratios ranged from 0.13 for 3-telluranonadecenoic acid in rats at 5 mins to 6.25 for 18-methyl-17-tellura-9-nonadecenoic acid in dogs at 24 hrs. The biological half-life of the Te-123m labelled fatty acids ranged from 26 to 583 hrs in the hearts of the test animals. These Te-123m fatty acids were retained in the heart longer than radioiodinated fatty acids and have acceptable absorbed doses to the various target organs. (U.K.)

  14. Fused 1,2,3-Dithiazoles: Convenient Synthesis, Structural Characterization, and Electrochemical Properties

    Directory of Open Access Journals (Sweden)

    Lidia S. Konstantinova

    2016-05-01

    Full Text Available A new general protocol for synthesis of fused 1,2,3-dithiazoles by the reaction of cyclic oximes with S2Cl2 and pyridine in acetonitrile has been developed. The target 1,2,3-dithiazoles fused with various carbocycles, such as indene, naphthalenone, cyclohexadienone, cyclopentadiene, and benzoannulene, were selectively obtained in low to high yields. In most cases, the hetero ring-closure was accompanied by chlorination of the carbocyclic moieties. With naphthalenone derivatives, a novel dithiazole rearrangement (15→13 featuring unexpected movement of the dithiazole ring from α- to β-position, with respect to keto group, was discovered. Molecular structure of 4-chloro-5H-naphtho[1,2-d][1,2,3]dithiazol-5-one 13 was confirmed by single-crystal X-ray diffraction. Electrochemical properties of 13 were studied by cyclic voltammetry and a complex behavior was observed, most likely including hydrodechlorination at a low potential.

  15. Lithium-antimony-lead liquid metal battery for grid-level energy storage.

    Science.gov (United States)

    Wang, Kangli; Jiang, Kai; Chung, Brice; Ouchi, Takanari; Burke, Paul J; Boysen, Dane A; Bradwell, David J; Kim, Hojong; Muecke, Ulrich; Sadoway, Donald R

    2014-10-16

    The ability to store energy on the electric grid would greatly improve its efficiency and reliability while enabling the integration of intermittent renewable energy technologies (such as wind and solar) into baseload supply. Batteries have long been considered strong candidate solutions owing to their small spatial footprint, mechanical simplicity and flexibility in siting. However, the barrier to widespread adoption of batteries is their high cost. Here we describe a lithium-antimony-lead liquid metal battery that potentially meets the performance specifications for stationary energy storage applications. This Li||Sb-Pb battery comprises a liquid lithium negative electrode, a molten salt electrolyte, and a liquid antimony-lead alloy positive electrode, which self-segregate by density into three distinct layers owing to the immiscibility of the contiguous salt and metal phases. The all-liquid construction confers the advantages of higher current density, longer cycle life and simpler manufacturing of large-scale storage systems (because no membranes or separators are involved) relative to those of conventional batteries. At charge-discharge current densities of 275 milliamperes per square centimetre, the cells cycled at 450 degrees Celsius with 98 per cent Coulombic efficiency and 73 per cent round-trip energy efficiency. To provide evidence of their high power capability, the cells were discharged and charged at current densities as high as 1,000 milliamperes per square centimetre. Measured capacity loss after operation for 1,800 hours (more than 450 charge-discharge cycles at 100 per cent depth of discharge) projects retention of over 85 per cent of initial capacity after ten years of daily cycling. Our results demonstrate that alloying a high-melting-point, high-voltage metal (antimony) with a low-melting-point, low-cost metal (lead) advantageously decreases the operating temperature while maintaining a high cell voltage. Apart from the fact that this

  16. Dosimetry of iodine-123 for newborn and infant

    International Nuclear Information System (INIS)

    Guilhem, M.T.; Therain, F.

    1987-01-01

    Iodine-123 ( 123 I) is a radionuclide of choice of neonatal hypothyroidism diagnosis. It is important to know infant main organs adsorbed doses during a thyroid scan with 123 I. Absorbed doses are already available for adults: for infants, they must be transformed taking account of organs sizes and inter-organs distances. Calculations are done for commercially available 123 I(p,2n) and 123 I(p,5n). Important contamination of 124 I in 123 I(p,2n) increases considerably the absorbed-dose during thyroid scan of a newborn (the ratio 124 I/ 123 I doubles every 15h). For routinely used activities, thyroid absorbed dose, 24 h after end of production, is fifteen times higher with 123 I(p,5n) than with 99m Tc: for one month old child; total body absorbed dose is of the same order of magnitude [fr

  17. Synthesis, estrogen receptor binding, and tissue distribution of a new iodovinylestradiol derivative (17α,20E)-21-[123I]iodo-11β-nitrato-19-norpregna-1,3,5(10),20-tetraene-3,17 -diol (E-[123I]NIVE)

    International Nuclear Information System (INIS)

    Rijks, Leonie J.M.; Bos, Jan C. van den; Doremalen, Peter A.P.M. van; Boer, Gerard J.; Bruin, Kora de; Doornbos, Tamme; Vekemans, Jozef A.J.M.; Posthumus, Maarten A.; Janssen, Anton G.M.; Royen, Eric A. van

    1998-01-01

    We have synthesized and evaluated E-11β-nitrato-17α-iodovinylestradiol (E-NIVE; E-3c) and its 123 I-labelled form, as a new potential radioligand for imaging of estrogen receptor (ER)-positive human breast tumors. E-[ 123 I]NIVE was prepared by stereospecific iododestannylation of the E-tri-n-butylstannylvinyl precursor (E-2c), obtained from reaction of 11β-nitrato-estrone (8) with E-tributylstannylvinyllithium. In competitive binding studies, E-NIVE proved to have high binding affinity for both the rat and the human ER (K i 280-730 pM), without significant binding to human sex hormone binding globulin. Distribution studies in normal and mammary tumor-bearing rats showed specific ER-mediated uptake of E-[ 123 I]NIVE in the estrogen target tissues, i.e., uterus, ovaries, pituitary, and hypothalamus, but not in the mammary tumors. Selective retention in these target tissues, including tumor tissue, resulted in significant increases over time for the target tissue-to-muscle uptake ratios, but not for the target tissue-to-fat uptake ratios. The tumor-to-fat uptake ratio even appeared constantly below 1. In the primary estrogen target tissues, E-[ 123 I]NIVE displayed high specific ER-mediated uptake and retention, which resulted in moderate target-to-nontarget tissue uptake ratios. In contrast, in tumor tissue, E-[ 123 I]NIVE uptake appeared to be rather low and not ER-specific. As a consequence, E-[ 123 I]NIVE appears to be a less favorable radioligand for ER imaging in breast cancer than the previously studied stereoisomers of 11β-methoxy-17α-[ 123 I]iodovinylestradiol (E- and Z-[ 123 I]MIVE; [ 123 I]E- and [ 123 I]Z-3b).

  18. Synthesis, estrogen receptor binding, and tissue distribution of a new iodovinylestradiol derivative (17{alpha},20E)-21-[{sup 123}I]iodo-11{beta}-nitrato-19-norpregna-1,3,5(10),20-te= traene-3,17 -diol (E-[{sup 123}I]NIVE)

    Energy Technology Data Exchange (ETDEWEB)

    Rijks, Leonie J.M.; Bos, Jan C. van den; Doremalen, Peter A.P.M. van; Boer, Gerard J.; Bruin, Kora de; Doornbos, Tamme; Vekemans, Jozef A.J.M.; Posthumus, Maarten A.; Janssen, Anton G.M.; Royen, Eric A. van

    1998-05-01

    We have synthesized and evaluated E-11{beta}-nitrato-17{alpha}-iodovinylestradiol (E-NIVE; E-3c) and its {sup 123}I-labelled form, as a new potential radioligand for imaging of estrogen receptor (ER)-positive human breast tumors. E-[{sup 123}I]NIVE was prepared by stereospecific iododestannylation of the E-tri-n-butylstannylvinyl precursor (E-2c), obtained from reaction of 11{beta}-nitrato-estrone (8) with E-tributylstannylvinyllithium. In competitive binding studies, E-NIVE proved to have high binding affinity for both the rat and the human ER (K{sub i} 280-730 pM), without significant binding to human sex hormone binding globulin. Distribution studies in normal and mammary tumor-bearing rats showed specific ER-mediated uptake of E-[{sup 123}I]NIVE in the estrogen target tissues, i.e., uterus, ovaries, pituitary, and hypothalamus, but not in the mammary tumors. Selective retention in these target tissues, including tumor tissue, resulted in significant increases over time for the target tissue-to-muscle uptake ratios, but not for the target tissue-to-fat uptake ratios. The tumor-to-fat uptake ratio even appeared constantly below 1. In the primary estrogen target tissues, E-[{sup 123}I]NIVE displayed high specific ER-mediated uptake and retention, which resulted in moderate target-to-nontarget tissue uptake ratios. In contrast, in tumor tissue, E-[{sup 123}I]NIVE uptake appeared to be rather low and not ER-specific. As a consequence, E-[{sup 123}I]NIVE appears to be a less favorable radioligand for ER imaging in breast cancer than the previously studied stereoisomers of 11{beta}-methoxy-17{alpha}-[{sup 123}I]iodovinylestradiol (E- and Z-[{sup 123}I]MIVE; [{sup 123}I]E- and [{sup 123}I]Z-3b)

  19. 19 CFR 123.31 - Merchandise in transit.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.31 Section 123.31... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.31 Merchandise in transit. (a) From one contiguous country to another. Merchandise may be transported in transit...

  20. 19 CFR 123.21 - Merchandise in transit.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.21 Section 123.21... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.21 Merchandise in transit. (a) Status. Merchandise may be transported from one port to another in the United...

  1. 29 CFR 780.123 - Raising of bees.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Raising of bees. 780.123 Section 780.123 Labor Regulations... Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.123 Raising of bees. The term “raising of * * * bees” refers to all of those activities customarily performed in connection with the...

  2. 17 CFR 256.123 - Investment in associate companies.

    Science.gov (United States)

    2010-04-01

    ... UTILITY HOLDING COMPANY ACT OF 1935 2. Investments § 256.123 Investment in associate companies. This... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment in associate companies. 256.123 Section 256.123 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  3. 12 CFR 225.123 - Activities closely related to banking.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities closely related to banking. 225.123 Section 225.123 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... Holding Companies Interpretations § 225.123 Activities closely related to banking. (a) Effective June 15...

  4. 40 CFR 123.3 - Coordination with other programs.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination with other programs. 123.3 Section 123.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS STATE PROGRAM REQUIREMENTS General § 123.3 Coordination with other programs. Issuance of State permits...

  5. Opening of the 123rd Council session

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    The CERN Council held its 123rd session on 13 December 2002 under the chairmanship of Professor Maurice Bourquin. The election of the next Director General, the Baseline Plan for 2003-2010 and a new status for non-European states were among the items agreed. Photo 01: (left to right) Director-General Prof. Luciano Maiani, President of Council Prof. Maurice Bourquin, and Director of administration Jan van der Boon.

  6. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Directory of Open Access Journals (Sweden)

    Zhimeng Liu

    2016-05-01

    Full Text Available A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2/carbon aerogel (CA for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  7. Synthesis and optical properties of antimony oxide glasses doped with holmium trioxide

    Energy Technology Data Exchange (ETDEWEB)

    Raghunatha, S.; Eraiah, B., E-mail: eraiah@rediffmail.com [Department of physics, Bangalore University, Bengaluru – 560 056. India (India)

    2016-05-06

    Holmium doped lithium-antimony-lead borate glasses having 1 mol% AgNO{sub 3} with composition 50B{sub 2}O{sub 3}-20PbO-25Sb{sub 2}O{sub 3}-5Li{sub 2}O have been prepared using single step melt quenching technique. The XRD spectrum confirms amorphous nature of glasses. The optical absorbance studies were carried out on these glasses. The optical direct band gap energies were found to be in the range of 3.10 eV to 3.31 eV and indirect band gap energies were found to be in the range of 2.28 eV to 3.00 eV. The refractive indexes have been calculated by using Lorentz-Lorenz formula and the calculated values in the range of 2.31 to 2.37.

  8. Mid-infrared optical properties of chalcogenide glasses within tin-antimony-selenium ternary system.

    Science.gov (United States)

    Lin, Ruiqiang; Chen, Feifei; Zhang, Xiaoyu; Huang, Yicong; Song, Baoan; Dai, Shixun; Zhang, Xianghua; Ji, Wei

    2017-10-16

    In this work, we investigated the mid-infrared (MIR) optical properties of selenide (Se-based) chalcogenide glasses (ChGs) within an As- and Ge-free system, namely the environment-friendly and low-cost tin-antimony-selenium (Sn-Sb-Se, SSS) ternary system, which has not been systematically studied to the best of our knowledge. As compared to ChGs within those conventional Se-based systems, SSS ChGs were found to exhibit extended infrared transmittance range as well as larger linear refractive index (n 0 ). Femtosecond Z-scan measurements show the presence of evident three-photon absorption from Urbach absorption of the SSS ChGs at MIR wavelength, which resonantly enhanced the nonlinear refractive behavior and resulted in large nonlinear refractive index (n 2 ).

  9. Microbial diversity and community structure in an antimony-rich tailings dump.

    Science.gov (United States)

    Xiao, Enzong; Krumins, Valdis; Dong, Yiran; Xiao, Tangfu; Ning, Zengping; Xiao, Qingxiang; Sun, Weimin

    2016-09-01

    To assess the impact of antimony (Sb) on microbial community structure, 12 samples were taken from an Sb tailings pile in Guizhou Province, Southwest China. All 12 samples exhibited elevated Sb concentrations, but the mobile and bioaccessible fractions were small in comparison to total Sb concentrations. Besides the geochemical analyses, microbial communities inhabiting the tailing samples were characterized to investigate the interplay between the microorganisms and environmental factors in mine tailings. In all samples, Proteobacteria and Actinobacteria were the most dominant phyla. At the genus level, Thiobacillus, Limnobacter, Nocardioides, Lysobacter, Phormidium, and Kaistobacter demonstrated relatively high abundances. The two most abundant genera, Thiobacillus and Limnobacter, are characterized as sulfur-oxidizing bacteria and thiosulfate-oxidizing bacteria, respectively, while the genus Lysobacter contains arsenic (As)-resistant bacteria. Canonical correspondence analysis (CCA) indicates that TOC and the sulfate to sulfide ratio strongly shaped the microbial communities, suggesting the influence of the environmental factors in the indigenous microbial communities.

  10. Melt processing of Yb-123 tapes

    International Nuclear Information System (INIS)

    Athur, S. P.; Balachandran, U.; Salama, K.

    2000-01-01

    The innovation of a simple, scalable process for manufacturing long-length conductors of HTS is essential to potential commercial applications such as power cables, magnets, and transformers. In this paper the authors demonstrate that melt processing of Yb-123 tapes made by the PIT route is an alternative to the coated conductor and Bi-2223 PIT tape fabrication techniques. Ag-clad Yb-123 tapes were fabricated by groove rolling and subsequently, melt processed in different oxygen partial pressures in a zone-melting furnace with a gradient of 140 C/cm. The transition temperatures measured were found to be around 81 K undermost processing conditions. EPMA of the tapes processed under different conditions show the 123 phase to be Ba deficient and Cu and Yb rich. Critical current was measured at various temperatures from 77 K to 4.2 K. The J c increased with decrease in pO 2 . The highest I c obtained was 52 A at 4.2 K

  11. The electronic structure of the antimony chalcogenide series: Prospects for optoelectronic applications

    International Nuclear Information System (INIS)

    Carey, John J.; Allen, Jeremy P.; Scanlon, David O.; Watson, Graeme W.

    2014-01-01

    In this study, density functional theory is used to evaluate the electronic structure of the antimony chalcogenide series. Analysis of the electronic density of states and charge density shows that asymmetric density, or ‘lone pairs’, forms on the Sb III cations in the distorted oxide, sulphide and selenide materials. The asymmetric density progressively weakens down the series, due to the increase in energy of valence p states from O to Te, and is absent for Sb 2 Te 3 . The fundamental and optical band gaps were calculated and Sb 2 O 3 , Sb 2 S 3 and Sb 2 Se 3 have indirect band gaps, while Sb 2 Te 3 was calculated to have a direct band gap at Γ. The band gaps are also seen to reduce from Sb 2 O 3 to Sb 2 Te 3 . The optical band gap for Sb 2 O 3 makes it a candidate as a transparent conducting oxide, while Sb 2 S 3 and Sb 2 Se 3 have suitable band gaps for thin film solar cell absorbers. - Graphical abstract: A schematic illustrating the interaction between the Sb III cations and the chalcogenide anions and the change in their respective energy levels down the series. - Highlights: • The electronic structure of the antimony chalcogenide series is modelled using DFT. • Asymmetric density is present on distorted systems and absent on the symmetric telluride system. • Asymmetric density is formed from the mixing of Sb 5s and anion p states, where the anti-bonding combination is stabilised by the Sb 5p states. • The asymmetric density weakens down the series due to the increase in energy of chalcogenide p states. • The increase in energy of the anion p states reduces the fundamental and optical band gaps

  12. Successful treatment of feline leishmaniosis using a combination of allopurinol and N-methyl-glucamine antimoniate

    Directory of Open Access Journals (Sweden)

    Maria Alexandra Basso

    2016-02-01

    Full Text Available Case summary This work describes the diagnosis and successful treatment of a 2-year-old domestic cat infected with Leishmania species and presenting fever, and ulcerative and nodular skin lesions after being treated for pyodermatitis for 1 year without clinical improvement. After anamnesis the cat was submitted to a complete clinical examination. Blood was collected for determination of haematological and biochemical parameters, detection of feline leukaemia virus (FeLV, feline immunodeficiency virus (FIV, feline coronavirus (FCoV and Leishmania amastigotes. Fine-needle aspiration puncture from the skin nodules was also performed. After definitive diagnosis the animal was treated and followed up over a 2 year period. The animal tested negative for FIV-specific antibodies, FeLV antigen and feline coronavirus RNA. Leishmania amastigotes in the skin nodules were confirmed by cytology and molecular diagnosis. Treatment was initiated with allopurinol, resulting in a slight clinical improvement. Thus, N-methyl-glucamine antimoniate was added and administered for 30 days, with complete closure of the ulcerative lesions in the hindlimbs requiring a surgical approach. Close monitoring of the patient in the following 24 months indicated that combined therapy was safe and clinical cure was achieved without further relapses or side effects. Relevance and novel information Considering the increasing number of feline leishmaniosis cases and the inconsistent results of most therapeutic protocols described in the literature, the use of new approaches, especially in refractory cases, is essential. Although the use of allopurinol and N-methyl-glucamine antimoniate is off-label in cats, in this case the combination treatment was followed by an extensive analytical monitoring, supporting their safety and effectiveness.

  13. Toxicity Assessments of Antimony, Barium, Beryllium, and Manganese for Development of Ecological Soil Screening Levels (ECO-SSL) Using Earthworm (Eisenia Fetida) Benchmark Values

    National Research Council Canada - National Science Library

    Simini, Michael

    2002-01-01

    ... soil that supports relatively high bioavailability of barium (Ba), beryllium (Be), manganese (Mn), and antimony (Sb). For the metals tested, cocoon production was a more sensitive endpoint than was survival...

  14. Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism

    International Nuclear Information System (INIS)

    Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro

    1999-01-01

    Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method (μ=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)

  15. Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism

    Energy Technology Data Exchange (ETDEWEB)

    Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro [Kagoshima Univ. (Japan). Faculty of Medicine

    1999-12-01

    Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method ({mu}=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)

  16. Differential pulse polarographic determination of trace antimony in standard biological samples after preconcentration using 2-nitroso-1-naphthol-4-sulfonic acid

    International Nuclear Information System (INIS)

    Taher, M. A.

    2003-01-01

    A highly selective, rapid and economical differential polarographic method has been developed for the determination of trace amounts of antimony in various standard alloys and biological samples after of its 2-naphthol-4 sulfonic acid tetradecyl dimethylbenzylammonium chloride on microcrystalline naphthalene in the ph range of 7.5-11.0. After filtration, the solid mass is shaken with 8-10 ml of 1 M hydrochloric acid (with preconcentration factor of 10) and antimony is determined by differential pulse polarography. Antimony can alternatively be quantitatively absorbed on 2-nitroso-1-naphthol-4-sulfonic acid tetradecyl dimethylbenzylammonium-naphthalene absorbed packed in a column (with preconcentration factor of 30) and determined similarly. In this case, 1.5 μg of antimony can be concentrated in a column from 300 ml of aqueous sample, where its concentration is as low as 5 ng/ml. Characterization of the electro active process included an examination of the degree of reversibility. The results show that the irreversibility of antimony. Various parameters such as the effect of ph, volume of aqueous phase, HCl concentration, reagent concentration, naphthalene concentration, shaking time and interference of a number of metal ions on the determination of antimony have been studied in detail to optimize the conditions for determination in standard alloys and standard biological samples

  17. Remediation of antimony-rich mine waters: Assessment of antimony removal and shifts in the microbial community of an onsite field-scale bioreactor.

    Science.gov (United States)

    Sun, Weimin; Xiao, Enzong; Kalin, Margarete; Krumins, Valdis; Dong, Yiran; Ning, Zengping; Liu, Tong; Sun, Min; Zhao, Yanlong; Wu, Shiliang; Mao, Jianzhong; Xiao, Tangfu

    2016-08-01

    An on-site field-scale bioreactor for passive treatment of antimony (Sb) contamination was installed downstream of an active Sb mine in Southwest China, and operated for one year (including a six month monitoring period). This bioreactor consisted of five treatment units, including one pre-aerobic cell, two aerobic cells, and two microaerobic cells. With the aerobic cells inoculated with indigenous mine water microflora, the bioreactor removed more than 90% of total soluble Sb and 80% of soluble antimonite (Sb(III)). An increase in pH and decrease of oxidation-reduction potential (Eh) was also observed along the flow direction. High-throughput sequencing of the small subunit ribosomal RNA (SSU rRNA) gene variable (V4) region revealed that taxonomically diverse microbial communities developed in the bioreactor. Metal (loid)-oxidizing bacteria including Ferrovum, Thiomonas, Gallionella, and Leptospirillum, were highly enriched in the bioreactor cells where the highest total Sb and Sb(III) removal occurred. Canonical correspondence analysis (CCA) indicated that a suite of in situ physicochemical parameters including pH and Eh were substantially correlated with the overall microbial communities. Based on an UPGMA (Unweighted Pair Group Method with Arithmetic Mean) tree and PCoA (Principal Coordinates Analysis), the microbial composition of each cell was distinct, indicating these in situ physicochemical parameters had an effect in shaping the indigenous microbial communities. Overall, this study was the first to employ a field-scale bioreactor to treat Sb-rich mine water onsite and, moreover, the findings suggest the feasibility of the bioreactor in removing elevated Sb from mine waters. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. A Flow Method for Chemiluminescence Determination of Antimony(III) and Antimony(V) Using a Rhodamine B-Cetyltrimethylammonium Chloride Reversed Micelle System Following On-Line Extraction.

    Science.gov (United States)

    Hasanin, Tamer H A; Yamamoto, Tomoyuki; Okamoto, Yasuaki; Ishizaka, Shoji; Fujiwara, Terufumi

    2016-01-01

    A rapid and sensitive flow method, based on the combination of on-line solvent extraction with reversed micellar mediated chemiluminescence (CL) detection using rhodamine B (RB), was developed for the determination of antimony(III) and antimony(V) in aqueous samples. The on-line extraction procedure involved ion-pair formation of the antimony(V) chloro-complex anion with the protonated RBH(+) ion and its extraction from an aqueous hydrochloric acid solution into toluene, followed by phase separation using a microporous membrane. When in a flow cell of a detector, the ion-pair in the extract driven was mixed with the reversed micellar solution of cetyltrimethylammonium chloride in 1-hexanol-cyclohexane/water (0.60 mol dm(-3) H2SO4) containing cerium(IV), its uptake by the reversed micelles and the subsequent CL oxidation of RB with Ce(IV) occurred easily, then the produced CL signal was measured. Using the proposed flow method under the optimized experimental conditions, a detection limit (DL) of 0.35 μmol dm(-3) and a linear calibration graph with a dynamic range from DL to 16 μmol dm(-3) were obtained for Sb(V) with a precision of 1.4% relative standard deviation (n = 5) at the Sb(V) concentration of 8.2 μmol dm(-3). The present method was successfully applied to the determination of Sb(V) in water samples and to the differential determination of Sb(III) and Sb(V) in copper electrolyte industrial samples, where total antimony Sb(III) + Sb(V) was determined after oxidation of Sb(III) to Sb(V) with Ce(IV) and Sb(III) was calculated by difference, for which the DL was almost the same as that for Sb(V).

  19. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    International Nuclear Information System (INIS)

    Sehmel, G.A.

    1989-05-01

    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ΔG/sub f,298//sup o/, ΔH/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (ΔH/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs

  20. First report of the use of meglumine antimoniate for treatment of canine leishmaniasis in a pregnant dog.

    Science.gov (United States)

    Spada, Eva; Proverbio, Daniela; Groppetti, Debora; Perego, Roberta; Grieco, Valeria; Ferro, Elisabetta

    2011-01-01

    Canine leishmaniasis during pregnancy is rarely reported, even in countries where the infection in dogs is endemic. The authors report a case of a 4 yr old bitch with leishmaniasis treated with meglumine antimoniate during pregnancy. The pregnancy and delivery were normal and the bitch presented improvement of the infection during treatment. Three puppies died within 2 days of birth and tested negative via real-time PCR for L. infantum. The two surviving puppies were followed clinically, serologically, and by real-time PCR until 1 yr of age with no evidence of congenital leishmaniasis. L. infantum DNA was detected with real-time PCR analysis of uterine tissue from the bitch at the time of ovariohysterectomy. PCR analysis was performed after an ovariohysterectomy of the bitch that was performed two months after parturition. Meglumine antimoniate use in the pregnant bitch may have prevented vertical transmission of leishmaniasis.

  1. Distribution and levels of cell surface expression of CD33 and CD123 in acute myeloid leukemia

    Science.gov (United States)

    Ehninger, A; Kramer, M; Röllig, C; Thiede, C; Bornhäuser, M; von Bonin, M; Wermke, M; Feldmann, A; Bachmann, M; Ehninger, G; Oelschlägel, U

    2014-01-01

    Owing to the more recent positive results with the anti-CD33 immunotoxin gemtuzumab ozogamicin, therapy against acute myeloid leukemias (AMLs) targeting CD33 holds many promises. Here, CD33 and CD123 expression on AML blasts was studied by flow cytometry in a cohort of 319 patients with detailed information on French–American–British/World Health Organization (FAB/WHO) classification, cytogenetics and molecular aberrations. AMLs of 87.8% express CD33 and would therefore be targetable with anti-CD33 therapies. Additionally, 9.4% of AMLs express CD123 without concomitant CD33 expression. Thus, nearly all AMLs could be either targeted via CD33 or CD123. Simultaneous presence of both antigens was observed in 69.5% of patients. Most importantly, even AMLs with adverse cytogenetics express CD33 and CD123 levels comparable to those with favorable and intermediate subtypes. Some patient groups with unfavorable alterations, such as FMS-related tyrosine kinase 3-internal tandem duplication (FLT3-ITD) mutations, high FLT3-ITD mutant/wild-type ratios and monosomy 5 are even characterized by high expression of CD33 and CD123. In addition, blasts of patients with mutant nucleophosmin (NPM1) revealed significantly higher CD33 and CD123 expression pointing toward the possibility of minimal residual disease-guided interventions in mutated NPM1-positive AMLs. These results stimulate the development of novel concepts to redirect immune effector cells toward CD33- and CD123-expressing blasts using bi-specific antibodies or engineered T cells expressing chimeric antigen receptors. PMID:24927407

  2. Microstructure and Electrical Properties of Antimony Telluride Thin Films Deposited by RF Magnetron Sputtering on Flexible Substrate Using Different Sputtering Pressures

    Science.gov (United States)

    Khumtong, T.; Sukwisute, P.; Sakulkalavek, A.; Sakdanuphab, R.

    2017-05-01

    The microstructural, electrical, and thermoelectric properties of antimony telluride (Sb2Te3) thin films have been investigated for thermoelectric applications. Sb2Te3 thin films were deposited on flexible substrate (polyimide) by radiofrequency (RF) magnetron sputtering from a Sb2Te3 target using different sputtering pressures in the range from 4 × 10-3 mbar to 1.2 × 10-2 mbar. The crystal structure, [Sb]:[Te] ratio, and electrical and thermoelectric properties of the films were analyzed by grazing-incidence x-ray diffraction (XRD) analysis, energy-dispersive x-ray spectroscopy (EDS), and Hall effect and Seebeck measurements, respectively. The XRD spectra of the films demonstrated polycrystalline structure with preferred orientation of (015), (110), and (1010). A high-intensity spectrum was found for the film deposited at lower sputtering pressure. EDS analysis of the films revealed the effects of the sputtering pressure on the [Sb]:[Te] atomic ratio, with nearly stoichiometric films being obtained at higher sputtering pressure. The stoichiometric Sb2Te3 films showed p-type characteristics with electrical conductivity, carrier concentration, and mobility of 35.7 S cm-1, 6.38 × 1019 cm-3, and 3.67 cm2 V-1 s-1, respectively. The maximum power factor of 1.07 × 10-4 W m-1 K-2 was achieved for the film deposited at sputtering pressure of 1.0 × 10-2 mbar.

  3. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate

    OpenAIRE

    Perez-Franco, Jairo E.; Cruz-Barrera, M?nica L.; Robayo, Marta L.; Lopez, Myriam C.; Daza, Carlos D.; Bedoya, Angela; Mari?o, Maria L.; Saavedra, Carlos H.; Echeverry, Maria C.

    2016-01-01

    Background American cutaneous leishmaniasis (ACL) is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate) under systemic administration. According to different authors, pentavalent antim...

  4. Synthesis of Chiral 1,4-Disubstituted-1,2,3-Triazole Derivatives from Amino Acids

    Directory of Open Access Journals (Sweden)

    Morten Grøtli

    2009-12-01

    Full Text Available A versatile method for the synthesis of chiral 1,4-disubstituted-1,2,3-triazole derivatives starting from easily accessible naturally occurring D-or L-amino acids as chiral synthons is described. The amino acids were converted into azido alcohols, followed by copper catalyzed [3+2] cycloaddition reactions between the azido alcohols and methyl propiolate and subsequent ester aminolysis with primary and secondary amines furnished the target compounds, which were obtained in excellent yields with no racemization. Docking of selected target compounds shows that the chiral 1,4-disubstituted-1,2,3-triazoles derivatives has the potential of mimicking the binding mode of known purine analogues.

  5. Migration of antimony from PET bottles into beverages: determination of the activation energy of diffusion and migration modelling compared with literature data.

    Science.gov (United States)

    Welle, F; Franz, R

    2011-01-01

    Plastics bottles made from polyethylene terephthalate (PET) are increasingly used for soft drinks, mineral water, juices and beer. In this study a literature review is presented concerning antimony levels found both in PET materials as well as in foods and food simulants. On the other hand, 67 PET samples from the European bottle market were investigated for their residual antimony concentrations. A mean value of 224 ± 32 mg kg(-1) was found, the median was 220 mg kg(-1). Diffusion coefficients for antimony in PET bottle materials were experimentally determined at different temperature between 105 and 150°C. From these data, the activation energy of diffusion for antimony species from the PET bottle wall into beverages and food simulants was calculated. The obtained value of 189 kJ mol(-1) was found to be in good agreement with published data on PET microwave trays (184 kJ mol(-1)). Based on these results, the migration of antimony into beverages was predicted by mathematical migration modelling for different surface/volume ratios and antimony bottle wall concentrations. The results were compared with literature data as well as international legal limits and guidelines values for drinking water and the migration limit set from food packaging legislation. It was concluded that antimony levels in beverages due to migration from PET bottles manufactured according to the state of the art can never reach or exceed the European-specific migration limit of 40 microg kg(-1). Maximum migration levels caused by room-temperature storage even after 3 years will never be essentially higher than 2.5 microg kg(-1) and in any case will be below the European limit of 5 microg kg(-1) for drinking water. The results of this study confirm that the exposure of the consumer by antimony migration from PET bottles into beverages and even into edible oils reaches approximately 1% of the current tolerable daily intake (TDI) established by World Health Organisation (WHO). Having

  6. Impact of mediastinal, liver and lung (123)I-metaiodobenzylguanidine ( (123)I-MIBG) washout on calculated (123)I-MIBG myocardial washout

    NARCIS (Netherlands)

    Verberne, Hein J.; Somsen, G. Aernout; Povinec, Pavol; van Eck-Smit, Berthe L. F.; Jacobson, Arnold F.

    2009-01-01

    PURPOSE: In planar (123)I-metaiodobenzylguanidine ((123)I-MIBG) myocardial imaging mediastinum (M) activity is often used as a background correction in calculating "washout" (WO). However, the most likely sources for counts that might produce errors in estimating myocardial (Myo) activity are lung

  7. PANCREATIC TOXICITY AS AN ADVERSE EFFECT INDUCED BY MEGLUMINE ANTIMONIATE THERAPY IN A CLINICAL TRIAL FOR CUTANEOUS LEISHMANIASIS

    Directory of Open Access Journals (Sweden)

    Marcelo Rosandiski LYRA

    Full Text Available SUMMARY American tegumentary leishmaniasis is an infectious disease caused by a protozoan of the genus Leishmania. Pentavalent antimonials are the first choice drugs for cutaneous leishmaniasis (CL, although doses are controversial. In a clinical trial for CL we investigated the occurrence of pancreatic toxicity with different schedules of treatment with meglumine antimoniate (MA. Seventy-two patients were allocated in two different therapeutic groups: 20 or 5 mg of pentavalent antimony (Sb5+/kg/day for 20 or 30 days, respectively. Looking for adverse effects, patients were asked about abdominal pain, nausea, vomiting or anorexia in each medical visit. We performed physical examinations and collected blood to evaluate serum amylase and lipase in the pre-treatment period, and every 10 days during treatment and one month post-treatment. Hyperlipasemia occurred in 54.8% and hyperamylasemia in 19.4% patients. Patients treated with MA 20 mg Sb5+ presented a higher risk of hyperlipasemia (p = 0.023. Besides, higher MA doses were associated with a 2.05 higher risk ratio (p = 0.003 of developing more serious (moderate to severe hyperlipasemia. The attributable fraction was 51% in this group. Thirty-six patients presented abdominal pain, nausea, vomiting or anorexia but only 47.2% of those had hyperlipasemia and/ or hyperamylasemia. These findings suggest the importance of the search for less toxic therapeutic regimens for the treatment of CL.

  8. Antimony speciation analysis in sediment reference materials using high-performance liquid chromatography coupled to hydride generation atomic fluorescence spectrometry

    International Nuclear Information System (INIS)

    Potin-Gautier, M.; Pannier, F.; Quiroz, W.; Pinochet, H.; Gregori, I. de

    2005-01-01

    This work presents the development of suitable methodologies for determination of the speciation of antimony in sediment reference samples. Liquid chromatography with a post-column photo-oxidation step and hydride generation atomic fluorescence spectrometry as detection system is applied to the separation and determination of Sb(III), Sb(V) and trimethylantimony species. Post-column decomposition and hydride generation steps were studied for sensitive detection with the AFS detector. This method was applied to investigate the conditions under which speciation analysis of antimony in sediment samples can be carried out. Stability studies of Sb species during the extraction processes of solid matrices, using different reagents solutions, were performed. Results demonstrate that for the extraction yield and the stability of Sb species in different marine sediment extracts, citric acid in ascorbic acid medium was the best extracting solution for antimony speciation analysis in this matrix (between 55% and 65% of total Sb was recovered from CRMs, Sb(III) being the predominant species). The developed method allows the separation of the three compounds within 6 min with detection limits of 30 ng g -1 for Sb(III) and TMSbCl2 and 40 ng g -1 for Sb(V) in sediment samples

  9. Antimony speciation analysis in sediment reference materials using high-performance liquid chromatography coupled to hydride generation atomic fluorescence spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Potin-Gautier, M. [Laboratoire de Chimie Analytique, BioInorganique et Environnement LCABIE (UMR CNRS 3054), Universite de Pau et des pays de l' Adour, 64000 Pau (France); Pannier, F. [Laboratoire de Chimie Analytique, BioInorganique et Environnement LCABIE (UMR CNRS 3054), Universite de Pau et des pays de l' Adour, 64000 Pau (France)]. E-mail: Florence.pannier@univ-pau.fr; Quiroz, W. [Laboratoire de Chimie Analytique, BioInorganique et Environnement LCABIE (UMR CNRS 3054), Universite de Pau et des pays de l' Adour, 64000 Pau (France); Laboratorio de Quimica Analitica y Ambiental, Instituto de Quimica, Pontificia Universidad catolica de Valparaiso (Chile); Pinochet, H. [Laboratorio de Quimica Analitica y Ambiental, Instituto de Quimica, Pontificia Universidad catolica de Valparaiso (Chile); Gregori, I. de [Laboratorio de Quimica Analitica y Ambiental, Instituto de Quimica, Pontificia Universidad catolica de Valparaiso (Chile)

    2005-11-30

    This work presents the development of suitable methodologies for determination of the speciation of antimony in sediment reference samples. Liquid chromatography with a post-column photo-oxidation step and hydride generation atomic fluorescence spectrometry as detection system is applied to the separation and determination of Sb(III), Sb(V) and trimethylantimony species. Post-column decomposition and hydride generation steps were studied for sensitive detection with the AFS detector. This method was applied to investigate the conditions under which speciation analysis of antimony in sediment samples can be carried out. Stability studies of Sb species during the extraction processes of solid matrices, using different reagents solutions, were performed. Results demonstrate that for the extraction yield and the stability of Sb species in different marine sediment extracts, citric acid in ascorbic acid medium was the best extracting solution for antimony speciation analysis in this matrix (between 55% and 65% of total Sb was recovered from CRMs, Sb(III) being the predominant species). The developed method allows the separation of the three compounds within 6 min with detection limits of 30 ng g{sup -1} for Sb(III) and TMSbCl2 and 40 ng g{sup -1} for Sb(V) in sediment samples.

  10. Evaluation of potential dietary toxicity of heavy metals in some common Nigerian beverages: A look at antimony, tin and mercury

    Directory of Open Access Journals (Sweden)

    I.I. Roberts

    2011-11-01

    Full Text Available There is currently little information on the composition of heavy metals in beverages imported and locally produced in Nigeria. The study quantitatively determined the composition of antimony (Sb, tin (Sn and mercury (Hg in 50 different beverage samples and evaluated the extent of violation of guideline values. Analysis of the beverage samples for the presence of Sb, Sn, and Hg was carried out using an atomic absorption spectrophotometer (AAS 929. The mean values detected for mercury, tin and antimony (±SE in fruit juices and soft drinks were 2.39±0.25, 3.66±0.22 and 0.49±0.048 μg/l; 2.93±0.34, 3.60±0.46 and 0.49±0.10 μg/l in dairy drinks and 0.94±0.02, 4.34±0.48 and 0.48±0.05 μg/l in bottled water samples respectively. While antimony detected in all products was below guideline values, mercury and tin were above the acceptable levels established by the World Health Organization, United States Environmental Protection Agency and European Union in most samples tested.

  11. [99mTc]/[123I] Simultaneous dual-isotope brain striatum phantom SPECT study: preparing for simultaneous [99mTc]TRODAT-1/[123I]-IBZM pre- and post-synaptic dopamine imaging

    International Nuclear Information System (INIS)

    Kao, PF; Hsu, HT; Tzen, KY; Wey, SP

    2004-01-01

    Introduction: The brain dopamine transporters (DAT) and dopamine D2 receptors are implicated in all kinds of movement disorders. Both sites are also targets for drug treatment, Therefore, brain dopamine system is important in both basic and clinical neurological researches. Kung HF et al. developed [ 99m Tc]TRODAT-l for DAT and [ 123 I]IBZM for D2 receptor SPECT imaging in living human brain. In this work, the possibility of doing [ 99m Tc]TRODAT-1/[ 123 I]IBZM simultaneous dual-isotope SPECT for both DAT/D2 receptor imaging was studied. The SPECT acquisition protocol, the percent of 99m Tc/ 123 I energy cross contamination, and the reproducibility of striatal /background ratios were studied with a striatal phantom to confirm the accuracy of 99m Tc/ 123 I dual-isotope simultaneous SPECT technique. Materials and Methods: In each set of experiment, the 4 striatum (target) chambers and the rest of the brain (background) were filled with solutions containing 99m Tc only, 123 I only, and both isotopes. Several sets of experiment with different target/background ratios were tested. For SPECT image acquisition, a triple-head gamma camera equipp with high resolution fan-beam collimators (Siemens Multi-SPECT3). Energy window settings of a 15% centered window at 140KeV for 99m Tc and a 10% asymmetric window with a lower bound at 159KeV for 123 I were used. After filtered backprojection and Chang's attenuation correction, regions of interest were defined at the bilateral basal ganglia and occipital areas. The reproducibility of counting activity and the different target/background ratios from each isotope were observed. Results: The results of the study revealed that the energy crossed contaminations from I-123 into Tc- 99m and vice verse were 22±12.4 % and 0.4±1.0 %, respectively. The correlation of striatum/background ratios between single isotope and simultaneous was excellent (R2 = 0.99). The success of this simultaneous dual-isotope SPECT technique is suggestive of the

  12. Production of high specific activity 123I for protein iodination for medical use

    International Nuclear Information System (INIS)

    Legoux, Y.; Cieur, M.; Crouzel, C.; Syrota, A.

    1985-01-01

    Iodine-123 is produced via xenon-133 by irradiation of a sodium iodide target with 108 MeV deuterons from the synchrocyclotron of IPN. The on-line production method is described. The specific activity of the iodine is determined by neutron activation analysis and by a radioimmunological method. The conditions labelling different proteins (insulin, angiotensin) are given and also the purification method to obtain a product ready for injection to patients. (author)

  13. Superconductors beyond 1-2-3

    International Nuclear Information System (INIS)

    Cava, R.J.

    1990-01-01

    In 1986 physicists K. Alex Mueller and J. Georg Bednorz of the IBM Zuerich Research Laboratory realized that La-Ba-Cu ceramics were the key to developing a new class of high-temperature superconductors that would revitalize superconductivity research and technology. Their discovery began one of the most startling revolutions in solid-state physics. In February, 1987, Maw-Kuen Wu of the University of Alabama, Ching-Wu (Paul) Chu of the University of Houston and their co-workers replaced lanthanum in the Bednorz-Mueller compound with yttrium--a smaller rare-earth element--to form a superconductor whose transition temperature was 90 kelvins. Soon after, R.Bruce van Dover, Bertram Batlogg and the author at AT ampersand T Bell Laboratories were the first to determine that the superconductor was the chemical compound now known as 1-2-3 because of the ratio of yttrium to barium to copper atoms. The 1-2-3 material was the first superconductor with a transition temperature above 77 kelvins and therefore could be cooled easily and inexpensively in a bath of liquid nitrogen. During the past four years the efforts of thousands of investigators around the world have produced about a dozen superconductors that have transition temperatures above 40 kelvins as well as a handful above 77 kelvins. So far the highest transition temperature--which was achieved in a compound composed of thallium, barium, calcium, copper and oxygen--is an astounding 125 kelvins

  14. Binding Affinity, Cellular Uptake, and Subsequent Intracellular Trafficking of the Nano-Gene Vector P123-PEI-R13

    Directory of Open Access Journals (Sweden)

    Yaguang Zhang

    2016-01-01

    Full Text Available A nano-gene vector PEI-P123-R13 was synthesized by cross-linking low molecular weight PEI with P123 and further coupling bifunctional peptide R13 to the polymer for targeting tumor and increasing cellular uptake. The binding assessment of R13 to αvβ3 positive cells was performed by HRP labeling. The internalization pathways of P123-PEI-R13/DNA complexes were investigated based on the effect of specific endocytic inhibitors on transfection efficiency. The mechanism of intracellular trafficking was investigated based on the effect of endosome-lysosome acidification inhibitors, cytoskeleton, and dynein inhibitors on transfection efficiency. The results indicated that the bifunctional peptide R13 had the ability of binding to αvβ3 positive cells in vitro. The modification of P123-PEI-R13 with R13 made it display new property of internalization. P123-PEI-R13/DNA complexes were conducted simultaneously via clathrin-mediated endocytosis, caveolin-mediated endocytosis, macropinocytosis, and possible energy-independent route. After internalization, P123-PEI-R13/DNA complexes could escape from the endosome-lysosome system because of its acidification and further took microtubule as the track and dynein as the dynamic source to be transported toward the microtubule (+ end, to wit nucleus, under the action of microfilament, and with the aid of intermediate filament.

  15. Functioning of antimony film electrode in acid media under cyclic and anodic stripping voltammetry conditions.

    Science.gov (United States)

    Sebez, Bine; Ogorevc, Bozidar; Hocevar, Samo B; Veber, Marjan

    2013-06-27

    New insights into the functioning, i.e. electrochemical behaviour and analytical performance, of in situ prepared antimony film electrodes (SbFEs) under square-wave anodic stripping (SW-ASV) and cyclic (CV) voltammetry conditions are presented by studying several key operational parameters using Pb(II), Cd(II) and Zn(II) as model analyte ions. Five different carbon- and metal-based substrate transducer electrodes revealed a clear advantage of the former ones while the concentration of the precursor Sb(III) ion exhibited a distinct influence on the ASV functioning of the SbFE. Among six acids examined as potential supporting electrolytes the HNO3 was demonstrated to yield nearly identical results in conducting ASV experiments with SbFE as so far almost exclusively used HCl. This is extremely important as HNO3 is commonly employed acidifying agent in trace metal analysis, especially in elemental mass spectrometry measurements. By carrying out a systematic CV and ASV investigation using a medium exchange protocol, we confirmed the formation of poorly soluble oxidized Sb species at the substrate electrode surface at the end of each stripping step, i.e. at the potentials beyond the anodic dissolution of the antimony film. Hence, the significance of the cleaning and initializing the surface of a substrate electrode after accomplishing a stripping step was thoroughly studied in order to find conditions for a complete removal of the adhered Sb-oxides and thus to assure a memory-free functioning of the in situ prepared SbFE. Finally, the practical analytical application of the proposed ASV method was successfully tested and evaluated by measuring the three metal analytes in ground (tap) and surface (river) water samples acidified with HNO3. Our results approved the appropriateness of the SbFE and the proposed method for measuring low μg L(-1) levels of some toxic metals, particularly taking into account the possibility of on-field testing and the use of low cost

  16. Comparative study of hematological responses to platinum group metals, antimony and silver nanoparticles in animal models.

    Science.gov (United States)

    Newkirk, Catherine E; Gagnon, Zofia E; Pavel Sizemore, Ioana E

    2014-01-01

    Research was conducted to examine the hematological effects of heavy metals (platinum (Pt ((IV))), palladium (Pd ((II))), rhodium (Rh ((III))), antimony (Sb ((III)) and Sb ((V))), and silver nanoparticles (AgNPs)) on white blood cells in mammalian (rat) and avian (chick embryo) models. These metals are used in many everyday products and are accumulating in our environment. Six-week old Sprague-Dawley female rats were treated daily by gavage and six-day old, fertile, specific pathogen-free white leghorn strain chick embryos' eggs were injected on days 7 and 14 of incubation with 0.0, 1.0, 5.0 or 10.0 ppm concentrations of Pt ((IV)) and a platinum group metal (PGM) mix of Pt ((IV)), Pd ((II)) and Rh ((III)). Chick embryos were also tested with 1.0 or 5.0 ppm of antimony compounds (Sb ((III)) and Sb ((V))) and 0.0, 15.0, 30.0, 60.0, or 100.0 ppm of silver nanoparticles (AgNPs). After 8 weeks of treatment, blood was obtained from the rats by jugular cut down and from chick embryos on day 20 of incubation by heart puncture. Blood smears were made and stained and a differential white cell count was performed on each. Examination of the smears revealed unconventional dose responses, stimulation of the immune response, and decreases in leukocyte production with various metals and concentrations. Chick embryos responded differently than rats to Pt and the PGM mix; suggesting that species differences and/or stage of development are important components of response to heavy metals. Route of administration of the metals might also influence the response. All of the heavy metals tested affected the immune responses of the tested animals as demonstrated by changes in the types and numbers of leukocytes. Our findings warrant further research to determine the mechanism of these effects and to understand and prevent toxicological effects in humans and other living organisms.

  17. The chimeric monoclonal antibody MHCSZ-123 against human von Willebrand factor A3 domain inhibits high-shear arterial thrombosis in a Rhesus monkey model.

    Science.gov (United States)

    Ji, Shundong; Jiang, Miao; Yan, Bin; Shen, Fei; He, Yang; Wan, Aini; Xia, Lijun; Ruan, Changgeng; Zhao, Yiming

    2017-05-19

    SZ-123, a murine monoclonal antibody that targets the human von Willebrand factor (VWF) A3 domain and blocks the binding of collagen, is a powerful antithrombotic. In a Rhesus monkey model of thrombosis, SZ-123 had no side effects, such as bleeding or thrombocytopenia. The mouse/human chimeric version of SZ-123, MHCSZ-123, was developed and maintained inhibitory capacities in vitro and ex vivo after injection into monkeys. CHO-S cells were selected for stable expression of MHCSZ-123. Cell clones with high levels of MHCSZ-123 expression were screened with G418 then adapted to serum-free suspension culture. The antithrombotic effect of MHCSZ-123 on acute platelet-mediated thrombosis was studied in monkeys where thrombus formation was induced by injury and stenosis of the femoral artery, which allowed for cyclic flow reductions (CFRs). CFRs were measured in the femoral artery of anesthetized Rhesus monkeys before and after intravenous administration of MHCSZ-123. Ex vivo VWF binding to collagen, platelet aggregation, platelet counts, and template bleeding time were used as measurements of antithrombotic activity. In addition, plasma VWF and VWF occupancy were measured by ELISA. Injection of 0.1, 0.3, and 0.6 mg/kg MHCSZ-123 significantly reduced CFRs by 29.4%, 57.9%, and 73.1%, respectively. When 0.3 and 0.6 mg/kg MHCSZ-123 were administered, 46.6%-65.8% inhibition of ristocetin-induced platelet aggregation was observed between 15 and 30 min after injection. We observed minimal effects on bleeding time, minimal blood loss, and no spontaneous bleeding or thrombocytopenia. The VWF-A3 inhibitor MHCSZ-123 significantly reduced thrombosis in Rhesus monkeys and appeared to be safe and well tolerated.

  18. The chimeric monoclonal antibody MHCSZ-123 against human von Willebrand factor A3 domain inhibits high-shear arterial thrombosis in a Rhesus monkey model

    Directory of Open Access Journals (Sweden)

    Shundong Ji

    2017-05-01

    Full Text Available Abstract Background SZ-123, a murine monoclonal antibody that targets the human von Willebrand factor (VWF A3 domain and blocks the binding of collagen, is a powerful antithrombotic. In a Rhesus monkey model of thrombosis, SZ-123 had no side effects, such as bleeding or thrombocytopenia. Methods The mouse/human chimeric version of SZ-123, MHCSZ-123, was developed and maintained inhibitory capacities in vitro and ex vivo after injection into monkeys. CHO-S cells were selected for stable expression of MHCSZ-123. Cell clones with high levels of MHCSZ-123 expression were screened with G418 then adapted to serum-free suspension culture. The antithrombotic effect of MHCSZ-123 on acute platelet-mediated thrombosis was studied in monkeys where thrombus formation was induced by injury and stenosis of the femoral artery, which allowed for cyclic flow reductions (CFRs. CFRs were measured in the femoral artery of anesthetized Rhesus monkeys before and after intravenous administration of MHCSZ-123. Ex vivo VWF binding to collagen, platelet aggregation, platelet counts, and template bleeding time were used as measurements of antithrombotic activity. In addition, plasma VWF and VWF occupancy were measured by ELISA. Results Injection of 0.1, 0.3, and 0.6 mg/kg MHCSZ-123 significantly reduced CFRs by 29.4%, 57.9%, and 73.1%, respectively. When 0.3 and 0.6 mg/kg MHCSZ-123 were administered, 46.6%–65.8% inhibition of ristocetin-induced platelet aggregation was observed between 15 and 30 min after injection. We observed minimal effects on bleeding time, minimal blood loss, and no spontaneous bleeding or thrombocytopenia. Conclusions The VWF-A3 inhibitor MHCSZ-123 significantly reduced thrombosis in Rhesus monkeys and appeared to be safe and well tolerated.

  19. Disposition of intravenous {sup 123}iodopentamidine in man

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Simon H. L.; Page, Christopher J.; Blower, Philip J.; Chowienczyk, Philip; Ward, Alan; Kamali, Farhad; Bradbeer, Caroline S.; Bateman, Nigel T.; O' Doherty, Michael J

    1997-05-01

    This study compared the disposition of the radiopharmaceutical [{sup 123}I]iodopentamidine with that of pentamidine after intravenous infusion by measuring plasma concentrations of each using scintilation counting and high-performance liquid chromatography (HPLC), respectively. There was rapid hepatic uptake and biliary excretion of the {sup 123}I label. Distribution kinetics of the {sup 123}I label were similar to those of pentamidine, but its elimination half-life (41 {+-} 27 h) was longer than that of pentamidine measured by HPLC (11 {+-} 8 h). [{sup 123}I]iodopentamidine distribution reflects that of pentamidine, but elimination of the radiopharmaceutical appears slower.

  20. Recent developments in the field of 123I-radiopharmaceuticals

    International Nuclear Information System (INIS)

    Machulla, H.J.; Knust, E.J.

    1984-01-01

    Due to its advantageous nuclear physical properties iodine-123 is an excellent label for radiopharmaceuticals very well suited for measurements by γ-cameras and single-photon emission tomography. The development of 123 I-radiopharmaceuticals should be based on a clear biochemical concept, reliable labelling procedures and careful pharmacokinetic studies in order to evaluate the physiological behaviour of the radioiodinated compounds being analogues of metabolic substrates. The development of 123 I-labelled fatty acids and biogenic amines clearly proved the successful use of 123 I for labelling compounds applied in medical diagnosis. (orig.) [de

  1. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, J.T. [Department of Geological Sciences, The University of Texas, Austin, TX 78759 (United States); Bennett, P.C., E-mail: pbennett@mail.utexas.edu [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States); Engel, A.S. [Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803 (United States); Alsina, M.A.; Pasten, P.A. [Departamento de Ingenieria Hidraulica y Ambiental, Pontificia Universidad Catolica de Chile, Santiago (Chile); Milliken, K. [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States)

    2009-04-15

    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with {approx}0.45 and 0.021 mmol L{sup -1} total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb{sub 2}O{sub 3}. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  2. Retardation of grain boundary self-diffusion in nickel doped with antimony and tin

    International Nuclear Information System (INIS)

    Padgett, R.A.; White, C.L.

    1984-01-01

    Many important metallurgical phenomena are strongly influenced or controlled by grain boundary mass transport. There is also much evidence that the composition of grain boundaries is often significantly different from the overall composition of metals and alloys, owing to strong segregation of residual (and often undetected) impurities. This segregation, which does not always advertise its presence through grain boundary brittleness, may vary markedly from heat to heat, and occasionally from specimen to specimen within a given heat. Unfortunately, there are relatively few experimental observations of how such segregation affects grain boundary mass transport, and even less fundamental understanding of how these effects occur. In this paper we present autoradiographic results on self-diffusion of 63 Ni in nickel and nickel doped with antimony and tin. While these results do not permit a quantitative evaluation of the grain boundary diffusivity, D, they qualitatively illustrate the dramatic effect that these solute elements have on the ability of nickel grain boundaries to act as preferential paths for mass transport

  3. Synthesis of Water-Soluble Antimony Sulfide Quantum Dots and Their Photoelectric Properties

    Science.gov (United States)

    Zhu, Jiang; Yan, Xuelian; Cheng, Jiang

    2018-01-01

    Antimony sulfide (Sb2S3) has been applied in photoelectric devices for a long time. However, there was lack of information about Sb2S3 quantum dots (QDs) because of the synthesis difficulties. To fill this vacancy, water-soluble Sb2S3 QDs were prepared by hot injection using hexadecyltrimethylammonium bromide (CTAB) and sodium dodecyl sulfate (SDS) mixture as anionic-cationic surfactant, alkanol amide (DEA) as stabilizer, and ethylenediaminetetraacetic acid (EDTA) as dispersant. Photoelectric properties including absorbing and emission were characterized by UV-Vis-IR spectrophotometer and photoluminescence (PL) spectroscopic technique. An intensive PL emission at 880 nm was found, indicating Sb2S3 QDs have good prospects in near-infrared LED and near-infrared laser application. Sb2S3 QD thin films were prepared by self-assembly growth and then annealed in argon or selenium vapor. Their band gaps ( E g s) were calculated according to transmittance spectra. The E g of Sb2S3 QD thin film has been found to be tunable from 1.82 to 1.09 eV via annealing or selenylation, demonstrating the good prospects in photovoltaic application.

  4. Synthesis and evaluation of lead telluride/bismuth antimony telluride nanocomposites for thermoelectric applications

    Science.gov (United States)

    Ganguly, Shreyashi; Zhou, Chen; Morelli, Donald; Sakamoto, Jeffrey; Uher, Ctirad; Brock, Stephanie L.

    2011-12-01

    Heterogeneous nanocomposites of p-type bismuth antimony telluride (Bi 2- xSb xTe 3) with lead telluride (PbTe) nanoinclusions have been prepared by an incipient wetness impregnation approach. The Seebeck coefficient, electrical resistivity, thermal conductivity and Hall coefficient were measured from 80 to 380 K in order to investigate the influence of PbTe nanoparticles on the thermoelectric performance of nanocomposites. The Seebeck coefficients and electrical resistivities of nanocomposites decrease with increasing PbTe nanoparticle concentration due to an increased hole concentration. The lattice thermal conductivity decreases with the addition of PbTe nanoparticles but the total thermal conductivity increases due to the increased electronic thermal conductivity. We conclude that the presence of nanosized PbTe in the bulk Bi 2- xSb xTe 3 matrix results in a collateral doping effect, which dominates transport properties. This study underscores the need for immiscible systems to achieve the decreased thermal transport properties possible from nanostructuring without compromising the electronic properties.

  5. Phase diagram of antimony up to 31 GPa and 835 K

    Science.gov (United States)

    Coleman, A. L.; Stevenson, M.; McMahon, M. I.; Macleod, S. G.

    2018-04-01

    X-ray powder diffraction experiments using resistively heated diamond anvil cells have been conducted in order to establish the phase behavior of antimony up to 31 GPa and 835 K. The dip in the melting curve at 5.7 GPa and 840 K is identified as the triple point between the Sb-I, incommensurate Sb-II, and liquid phases. No evidence of the previously reported simple cubic phase was observed. Determination of the phase boundary between Sb-II and Sb-III suggests the existence of a second triple point in the region of 13 GPa and 1200 K. The incommensurate composite structure of Sb-II was found to remain ordered to the highest temperatures studies—no evidence of disordering of the guest-atom chains was observed. Indeed, the modulation reflections that arise from interactions between the host and guest subsystems were found to be present to the highest temperatures, suggesting such interactions remain relatively strong in Sb even in the presence of increased thermal motion. Finally, we show that the incommensurately modulated structure recently reported as giving an improved fit to diffraction data from incommensurate Ba-IV can be rejected as the structure of Sb-II using a simple density argument.

  6. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells.

    Science.gov (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya

    2015-08-17

    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells.

  7. Determination of antimony by using a quartz atom trap and electrochemical hydride generation atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Menemenlioglu, Ipek; Korkmaz, Deniz [Department of Chemistry, Middle East Technical University, 06531 Ankara (Turkey); Ataman, O. Yavuz [Department of Chemistry, Middle East Technical University, 06531 Ankara (Turkey)], E-mail: ataman@metu.edu.tr

    2007-01-15

    The analytical performance of a miniature quartz trap coupled with electrochemical hydride generator for antimony determination is described. A portion of the inlet arm of the conventional quartz tube atomizer was used as an integrated trap medium for on-line preconcentration of electrochemically generated hydrides. This configuration minimizes transfer lines and connections. A thin-layer of electrochemical flow through cell was constructed. Lead and platinum foils were employed as cathode and anode materials, respectively. Experimental operation conditions for hydride generation as well as the collection and revolatilization conditions for the generated hydrides in the inlet arm of the quartz tube atomizer were optimized. Interferences of copper, nickel, iron, cobalt, arsenic, selenium, lead and tin were examined both with and without the trap. 3{sigma} limit of detection was estimated as 0.053 {mu}g l{sup -1} for a sample size of 6.0 ml collected in 120 s. The trap has provided 18 fold sensitivity improvement as compared to electrochemical hydride generation alone. The accuracy of the proposed technique was evaluated with two standard reference materials; Trace Metals in Drinking Water, Cat CRM-TMDW and Metals on Soil/Sediment 4, IRM-008.

  8. Determination of antimony by using a quartz atom trap and electrochemical hydride generation atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Menemenlioglu, Ipek; Korkmaz, Deniz; Ataman, O. Yavuz

    2007-01-01

    The analytical performance of a miniature quartz trap coupled with electrochemical hydride generator for antimony determination is described. A portion of the inlet arm of the conventional quartz tube atomizer was used as an integrated trap medium for on-line preconcentration of electrochemically generated hydrides. This configuration minimizes transfer lines and connections. A thin-layer of electrochemical flow through cell was constructed. Lead and platinum foils were employed as cathode and anode materials, respectively. Experimental operation conditions for hydride generation as well as the collection and revolatilization conditions for the generated hydrides in the inlet arm of the quartz tube atomizer were optimized. Interferences of copper, nickel, iron, cobalt, arsenic, selenium, lead and tin were examined both with and without the trap. 3σ limit of detection was estimated as 0.053 μg l -1 for a sample size of 6.0 ml collected in 120 s. The trap has provided 18 fold sensitivity improvement as compared to electrochemical hydride generation alone. The accuracy of the proposed technique was evaluated with two standard reference materials; Trace Metals in Drinking Water, Cat CRM-TMDW and Metals on Soil/Sediment 4, IRM-008

  9. 90Y-labeled antimony trisulfide colloid as promising therapeutic agent: Physicochemical characterization and biological evaluation

    Directory of Open Access Journals (Sweden)

    Janković Drina Lj.

    2014-01-01

    Full Text Available Introduction The suitability of 90Y-labeled antimony trisulfide colloid (ATC for the preparation of therapeutic radiopharmaceutical was studied taking into accounts its physicochemical properties and biological behavior in rats. Material and methods The labeling efficiency of 90Y- and 99mTc-labeled colloid particles was investigated by ITLC-SG and paper chromatography, the in vitro stability of the colloid was tested in human serum, while in vivo experiments were performed on healthy Wistar rats. Analysis of the particles enclosed the size (TEM, determination of the zeta potential (Zetasizer Nano as well as radioactivity particle size distribution (filtration analysis. Results 90Y-labeled ATC can be prepared in high yield under investigated conditions Labeling efficiency was >95% and filtration analysis showed that more than 90% of radioactive particles were smaller than 20 nm. The particles with the size range of 6-22 nm were achieved by using polyvinyipyrrolidone (mol wt ~44,000. The 90Y-ATC was quite stable in vitro in human serum. Tissue distribution studies in rats confirmed that the liver and spleen uptake of 90Y-labeled colloid was three-fold lower in comparison with 99mTc-ATC, although the bone uptake was five-fold higher at 20 min post injection. Conclusions 90Y-labeled ATC showed high labeling efficiency and good stability, and might be well suited for therapeutic application in nuclear medicine.

  10. Carbon nanotubes modified with antimony nanoparticles: A novel material for electrochemical sensing

    International Nuclear Information System (INIS)

    Moraes, Fernando C.; Cesarino, Ivana; Cesarino, Vivian; Mascaro, Lucia H.; Machado, Sergio A.S.

    2012-01-01

    Highlights: ► A novel material for the electrochemical sensing was developed. ► Sensor based CNTs modified with Sb-nanoparticles was characterised and applied. ► The proposed sensor was suitable and sensitive for the determination of bisphenol A. - Abstract: In this study, a novel material for the electrochemical determination of bisphenol A using a nanocomposite based on multi-walled carbon nanotubes modified with antimony nanoparticles has been investigated. The morphology, structure, and electrochemical performance of the nanocomposite electrodes were characterised by field emission gun scanning electron microscopy, energy-dispersive X-ray spectroscopy, and cyclic voltammetry. A scan rate study and electrochemical impedance spectroscopy showed that the bisphenol A oxidation product is adsorbed on nanocomposite electrode surface. Differential pulse voltammetry in phosphate buffer solution at pH 6, allowed the development of a method to determine bisphenol A levels in the range of 0.5–5.0 μmol L −1 , with a detection limit of 5.24 nmol L −1 (1.19 μg L −1 ).

  11. Leaching of Antimony (Sb)from Municipal Solid Waste Incineration (MSWI) Residues

    Energy Technology Data Exchange (ETDEWEB)

    Herrmann, Inga

    2004-07-01

    The mobility of antimony (Sb) in municipal solid waste incineration (MSWI) residues often exceeds the limit values stipulated by the European Union. As an ash treatment by washing is conceivable, this work investigated the Sb release from Swedish bottom ash and fly ash when mixed with water. The leaching experiments revealed the factors significantly (a = 0.05) affecting Sb release from the ashes. The following factors were investigated: Liquid to solid ratio (L/S), time, pH, carbonation (treatment with CO{sub 2}), ultrasonics and temperature. The data were evaluated using multiple linear regression (MLR). The impact of the factors could be quantified. The maximum Sb release calculated was 13 mg/kg DM for bottom ash and 51 mg/kg DM for fly ash. The derived models explained the observed data well. Nevertheless, the calculated values were subject to a high uncertainty. For bottom ash, a lowering of the Sb total content of approximately 22% could be achieved. If this also involves a sufficient lowering of the Sb mobility to meet EU limit values could not yet be assessed. Chemical equilibrium calculations were performed to explain the empirical results. However, no solid phases controlling Sb release from the ashes could be identified.

  12. Synthesis and characterization of copper antimony tin sulphide thin films for solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Ali, N., E-mail: nisar.ali@utm.my [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Department of Physics, Govt. Post Graduate Jehanzeb College Saidu Sharif, Swat, 19200 (Pakistan); Hussain, A. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Ahmed, R., E-mail: rashidahmed@utm.my [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Wan Shamsuri, W.N. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Fu, Y.Q., E-mail: richard.fu@northumbria.ac.uk [Department of Physics and Electrical Engineering, Faculty of Engineering & Environment, University of Northumbria, Newcastle upon Tyne, NE1 8ST (United Kingdom)

    2016-12-30

    Highlights: • A new and novel material for solar cell applications is demonstrated as a replacement for toxic and expansive compounds. • The materials used in this compound are abundant and low cost. • Compound exhibit unusual optical and electrical properties. • The band gap was found to be comparable with that of GaAs. - Abstract: Low price thin film modules based on Copper antimony tin sulphide (CATS) are introduced for solar harvesting to compete for the already developed compound semiconductors. Here, CATS thin films were deposited on soda lime glass by thermal evaporation technique followed by a rapid thermal annealing in an argon atmosphere. From Our XRD analysis, it was revealed that the annealed samples were poly-crystalline and their crystallinity was improved with increasing annealing temperature. The constituent elements and their corresponding chemical states were identified using X-ray photoelectron spectroscopy. The obtained optical band gap of 1.4 eV for CATS thin film is found nearly equal to GaAs – one of the highly efficient thin film material for solar cell technology. Furthermore, our observed good optical absorbance and low transmittance for the annealed CATS thin films in the visible region of light spectrum assured the aptness of the CATS thin films for solar cell applications.

  13. Capacity extended bismuth-antimony cathode for high-performance liquid metal battery

    Science.gov (United States)

    Dai, Tao; Zhao, Yue; Ning, Xiao-Hui; Lakshmi Narayan, R.; Li, Ju; Shan, Zhi-wei

    2018-03-01

    Li-Bi based liquid metal batteries (LMBs) have attracted interest due to their potential for solving grid scale energy storage problems. In this study, the feasibility of replacing the bismuth cathode with a bismuth-antimony alloy cathode in lithium based LMBs is investigated. The influence of the Bi:Sb ratio on voltage characteristics is evaluated via the constant current discharge method and electrochemical titration. On observing the cross section of the electrode at various stages of discharge, it is determined that both Sb and Bi form solid intermetallics with Li on the cathode. Additionally, the addition of Bi not only reduces the melting temperature of the Bi:Sb intermetallic but also actively contributes to the electrode capacity. Thereafter, a Li|LiCl-LiF|Sb-Bi liquid metal battery with 3 A h nameplate capacity, assembled and cycled at 1 C rate, is found to possess a stable capacity for over 160 cycles. The overall performance of this battery is discussed in the context of cost effectiveness, energy and coulombic efficiencies.

  14. Effects of antimony trisulfide (Sb2S3) on sliding friction of automotive brake friction materials

    Science.gov (United States)

    Lee, Wan Kyu; Rhee, Tae Hee; Kim, Hyun Seong; Jang, Ho

    2013-09-01

    The effect of antimony trisulfide (Sb2S3) on the tribological properties of automotive brake friction materials was investigated using a Krauss type tribometer and a 1/5 scale dynamometer with a rigid caliper. Results showed that Sb2S3 improved fade resistance by developing transfer films on the disc surface at elevated temperatures. On the other hand, the rubbing surfaces of the friction material exhibited contact plateaus with a broader height distribution when it contained Sb2S3, indicating fewer contact junctions compared to the friction material with graphite. The friction material with Sb2S3 also exhibited a lower stick-slip propensity than the friction material with graphite. The improved fade resistance with Sb2S3 is attributed to its lubricating capability sustained at high temperatures, while the lower stick-slip propensity of the friction material with Sb2S3 is associated with the slight difference between its static and kinetic coefficients of friction and high normal stiffness.

  15. Assessment and distribution of antimony in soils around three coal mines, Anhui, China

    Science.gov (United States)

    Qi, C.; Liu, Gaisheng; Kang, Y.; Lam, P.K.S.; Chou, C.

    2011-01-01

    Thirty-three soil samples were collected from the Luling, Liuer, and Zhangji coal mines in the Huaibei and Huainan areas of Anhui Province, China. The samples were analyzed for antimony (Sb) by inductively coupled plasmaoptical emission spectrometry (ICP-OES) method. The average Sb content in the 33 samples was 4 mg kg-1, which is lower than in coals from this region (6.2 mg kg-1). More than 75% of the soils sampled showed a significant degree of Sb pollution (enrichment factors [EFs] 5-20). The soils collected near the gob pile and coal preparation plant were higher in Sb content than those collected from residential areas near the mines. The gob pile and tailings from the preparation plant were high in mineral matter content and high in Sb. They are the sources of Sb pollution in surface soils in the vicinity of coal mines. The spatial dispersion of Sb in surface soil in the mine region shows that Sb pollution could reach out as far as 350 m into the local environment conditions. Crops in rice paddies may adsorb some Sb and reduce the Sb content in soils from paddyfields. Vertical distribution of Sb in two soil profiles indicates that Sb is normally relatively immobile in soils. ?? 2011 Air & Waste Management Association.

  16. Adsorption of Antimony by Bagasse Fly Ash: Chemical Modification and Adsorption Mechanism.

    Science.gov (United States)

    Leechart, Piyawan; Inthorn, Duangrat; Thiravetyan, Paitip

      Modification of bagasse fly ash (BFA) and the adsorption mechanism of antimony (Sb) by modified BFA were studied. It was found that BFA grafted with acrylic acid (BFAG) and BFA treated with hydrochloric acid (BFA/HCl) led to a decrease in the pH of the zero point of charge (pH zpc ) of the adsorbents. The pH zpc of BFA, BFAG, BFA/HCl and activated carbon (AC) were 8.3, 6.4, 6.2 and 8.2, respectively. The maximum adsorption capacities (Q max ) of Sb by BFA, BFAG, BFA/HCl and AC were 0.14, 0.34, 0.38 and 0.29 mg Sb/g adsorbent, respectively. Modified BFA had Q max higher than AC although the BET surface area of AC was the highest. This was due to the system pH of BFAG and BFA/HCl was 5.20-6.00 and the pH zpc of BFAG and BFA/HCl accounted for 6.4 and 6.2, respectively. Therefore, the adsorbent surface had a positive charge, resulting in increasing adsorption of Sb.

  17. Speciation of very low amounts of antimony in waters using magnetic core-modified silver nanoparticles and electrothermal atomic absorption spectrometry.

    Science.gov (United States)

    López-García, Ignacio; Rengevicova, Silvia; Muñoz-Sandoval, María J; Hernández-Córdoba, Manuel

    2017-01-01

    A micro-solid phase extraction procedure for the separation and preconcentration of antimony based in the use of magnetic particles covered with silver nanoparticles functionalized with the sodium salt of 2-mercaptoethane-sulphonate (MESNa) is discussed. After separation by means of a magnetic field, the solid phase is directly introduced into an electrothermal atomizer for antimony determination. Alternatively, the solid can be slurried and then injected into the atomizer. In all cases, palladium nitrate is used as a chemical modifier. The preconcentration factors are close to 205 and 325, with detection limits of 0.02 and 0.03µgL -1 antimony, for the slurry and solid sampling procedures, respectively. Speciation of Sb(III) and Sb(V) is achieved by means of two extractions carried out at different acidity. The results for total antimony are verified using certified reference materials. Water samples are analyzed for antimony speciation. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Cos-Seq for high-throughput identification of drug target and resistance mechanisms in the protozoan parasite Leishmania.

    Science.gov (United States)

    Gazanion, Élodie; Fernández-Prada, Christopher; Papadopoulou, Barbara; Leprohon, Philippe; Ouellette, Marc

    2016-05-24

    Innovative strategies are needed to accelerate the identification of antimicrobial drug targets and resistance mechanisms. Here we develop a sensitive method, which we term Cosmid Sequencing (or "Cos-Seq"), based on functional cloning coupled to next-generation sequencing. Cos-Seq identified >60 loci in the Leishmania genome that were enriched via drug selection with methotrexate and five major antileishmanials (antimony, miltefosine, paromomycin, amphotericin B, and pentamidine). Functional validation highlighted both known and previously unidentified drug targets and resistance genes, including novel roles for phosphatases in resistance to methotrexate and antimony, for ergosterol and phospholipid metabolism genes in resistance to miltefosine, and for hypothetical proteins in resistance to paromomycin, amphothericin B, and pentamidine. Several genes/loci were also found to confer resistance to two or more antileishmanials. This screening method will expedite the discovery of drug targets and resistance mechanisms and is easily adaptable to other microorganisms.

  19. Effects of anesthetic agents on cellular {sup 123}I-MIBG transport and in vivo {sup 123}I-MIBG biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Bong-Ho; Paik, Jin-Young; Jung, Kyung-Ho; Bae, Jun-Sang; Lee, Eun Jung; Choe, Yearn Seong; Kim, Byung-Tae; Lee, Kyung-Han [Sungkyunkwan University School of Medicine, Department of Nuclear Medicine, Samsung Medical Center, Seoul (Korea)

    2008-03-15

    Small animal imaging with meta-iodobenzylguanidine (MIBG) allows characterization of animal models, optimization of tumor treatment strategies, and monitoring of gene expression. Anesthetic agents, however, can affect norepinephrine (NE) transport and systemic sympathetic activity. We thus elucidated the effects of anesthetic agents on MIBG transport and biodistribution. SK-N-SH neuroblastoma and PC-12 pheochromocytoma cells were measured for {sup 123}I-MIBG uptake after treatment with ketamine (Ke), xylazine (Xy), Ke/Xy, or pentobarbital (Pb). NE transporters were assessed by Western blots. Normal ICR mice and PC-12 tumor-bearing mice were injected with {sup 123}I-MIBG 10 min after anesthesia with Ke/Xy, Ke, Xy, or Pb. Plasma NE levels and MIBG biodistribution were assessed. Cellular {sup 123}I-MIBG uptake was dose-dependently inhibited by Ke and Xy but not by Pb. Treatment for 2 h with 300 {mu}M Ke, Xy, and Ke/Xy decreased uptake to 46.0 {+-} 1.6, 24.8 {+-} 1.5, and 18.3 {+-} 1.6% of controls. This effect was completely reversed by fresh media, and there was no change in NE transporter levels. In contrast, mice anesthetized with Ke/Xy showed no decrease of MIBG uptake in target organs. Instead, uptakes and organ-to-blood ratios were increased in the heart, lung, liver, and adrenals. Plasma NE was notably reduced in the animals with corresponding decreases in blood MIBG, which partly contributed to the increase in target organ uptake. In spite of their inhibitory effect at the transporter level, Ke/Xy anesthesia is a satisfactory method for MIBG imaging that allows favorable target tissue uptake and contrast by reducing circulating NE and MIBG. (orig.)

  20. Failure of both azithromycin and antimony to treat cutaneous leishmaniasis in Manaus, AM, Brazil Falha da azitromicina e do antimonial no tratamento da leishmaniose cutânea em Manaus, AM, Brasil

    Directory of Open Access Journals (Sweden)

    Alan César Teixeira

    2008-06-01

    Full Text Available A non-randomized controlled clinical trial was carried outin order to evaluate both azithromycin and antimony efficacy in cutaneous leishmaniasis in Manaus, AM, Brazil. Forty nine patients from both genders, aged 14 to 70, with cutaneous ulcers for less than three months and a positive imprint for Leishmania spp. amastigotes were recruited into two groups. Group I (26 patients received a daily-single oral dose of 500 mg of azithromycin for 20 days and Group II (23 patients received a daily-single intramuscular dose of 20 mg/kg of meglumine antimony, also for 20 days. Azithromycin cured three of 24 (12.5% patients on days 60, 90 and 120 respectively whereas therapeutic failure was considered in 21 of 24 (87.5% cases. In group II, antimony cured eight of 19 (42.1% cases as follows: three on day 30, one each on day 60 and day 90, and three on day 120. Therapeutic failure occurred in 11 of 19 (57.9% individuals. The efficacy of antimony for leishmaniasis was better than azithromycin but analysis for the intention-to-treat response rate did not show statistical difference between them. Although azithromycin was better tolerated, it showed a very low efficacy to treat cutaneous leishmaniasis in Manaus.Com o objetivo de avaliar a eficácia da azitromicina no tratamento da leishmaniose cutânea, foi realizado ensaio comparativo, em Manaus. Foram recrutados 49 pacientes de ambos os sexos, com idades entre 14 e 70 anos que apresentassem úlceras cutâneas com menos de três meses de evolução e que tivessem exame direto positivo para amastigotas de leishmânia. Estes pacientes foram alocados em dois grupos assim: Grupo I (26 recebeu uma dose diária de 500 mg de azitromicina pela via oral durante 20 dias e o Grupo II, recebeu uma dose diária de 20 mg/kg de antimoniato de meglumina por via intramuscular, durante 20 dias. Do grupo da azitromicina, três (12,5% de 24 pacientes curaram 60, 90 e 120 dias, respectivamente, enquanto, em 21 (87,5% de 24 houve

  1. Comparison of modification with strontium and the refining with antimony in A 356 aluminium alloys; Comparacao entre a modificacao com estroncio e o refino com antimonio em ligas de aluminio a 356

    Energy Technology Data Exchange (ETDEWEB)

    Fuoco, Ricardo; Correa, Edison Roberto; Correa, Alzira V.O.; Bocalini Junior, Mario

    1992-12-31

    Strontium and Antimony treated A356 aluminium alloy samples were metallographically characterized in the as cast and solution and aged conditions. Antimony treated alloy has shown slower spheroidizing kinetics of the Silicon particles during solution treatment, lower porosity level and higher tensile strength and elongation than Strontium treated one. (author) 26 refs., 13 figs., 2 tabs.

  2. 22 CFR 123.20 - Nuclear related controls.

    Science.gov (United States)

    2010-04-01

    ... of nuclear weapons, or other non-nuclear parts of nuclear weapons systems involving Restricted Data... amended. The technical data or defense services relating to nuclear weapons, nuclear weapons systems or... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Nuclear related controls. 123.20 Section 123.20...

  3. 50 CFR 14.123 - Care in transit.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Care in transit. 14.123 Section 14.123 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... transit. (a) A primate shall be observed for signs of distress and given food and water according to the...

  4. 19 CFR 123.41 - Truck shipments transiting Canada.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Truck shipments transiting Canada. 123.41 Section... OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO United States and Canada In-Transit Truck Procedures § 123.41 Truck shipments transiting Canada. (a) Manifest required. Trucks with merchandise...

  5. 47 CFR 80.123 - Service to stations on land.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Service to stations on land. 80.123 Section 80... STATIONS IN THE MARITIME SERVICES Operating Requirements and Procedures Special Procedures-Public Coast Stations § 80.123 Service to stations on land. Marine VHF public coast stations, including AMTS coast...

  6. 49 CFR 37.123 - ADA paratransit eligibility: Standards.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Standards. 37.123... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.123 ADA... complementary paratransit service shall provide the service to the ADA paratransit eligible individuals...

  7. Clinical Applications of [123I]FP-CIT SPECT Imaging

    NARCIS (Netherlands)

    Booij, J.; Tijssen, M.A.J.; Berendse, H.W.; Dierckx, R.A.J.O.; Otte, A.; de Vries, E.F.J.; van Waarde, A.; Leenders, K.L.

    2014-01-01

    Dopamine transporter (DAT) imaging with [ 123 I] N -ù-fl uoropropyl-2â- carbomethoxy- 3â-(4-iodophenyl)nortropane ([ 123 I]FP-CIT) SPECT is commonly used in routine clinical studies to exclude or detect a loss of striatal DATs in individual patients with a movement disorder or dementia. In this

  8. 40 CFR 1.23 - Office of the Administrator.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Office of the Administrator. 1.23... AND GENERAL INFORMATION Headquarters § 1.23 Office of the Administrator. The Environmental Protection Agency is headed by an Administrator who is appointed by the President, by and with the consent of the...

  9. 9 CFR 113.123 - Salmonella Dublin Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...

  10. 5 CFR 610.123 - Travel on official time.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel on official time. 610.123 Section... DUTY Weekly and Daily Scheduling of Work Work Schedules § 610.123 Travel on official time. Insofar as practicable travel during nonduty hours shall not be required of an employee. When it is essential that this...

  11. 40 CFR 96.123 - CAIR permit contents and term.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 96.123 Section 96.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... necessary to facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal...

  12. 40 CFR 97.123 - CAIR permit contents and term.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.123 Section 97.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal of the CAIR NOX...

  13. 17 CFR 12.3 - Business address; hours.

    Science.gov (United States)

    2010-04-01

    ... REPARATIONS General Information and Preliminary Consideration of Pleadings § 12.3 Business address; hours. The... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Business address; hours. 12.3..., DC 20581. It is open each day, except Saturdays, Sundays, and legal public holidays, from 8:15 a.m...

  14. Medical necessity for shorter lived radionuclides, specifically pure Iodine-123

    International Nuclear Information System (INIS)

    DeNardo, G.L.; DeNardo, S.J.; Hines, H.H.; Lagunas-Solar, M.C.; Jungerman, J.A.

    1985-01-01

    Iodine-123 has physical and radiochemical characteristics ideal for most tracer procedures performed in patients. Its use is generally preferable to the use of 131 I for diagnosis. The potential for 123 I can be realized only if a radiopharmaceutical of lesser radionuclide contamination is generally and economically available. Iodine-123 produced by direct methods has significant disadvantages relative to quality of procedure and radiation dosimetry. Our experience with 123 I(p,5n) during the past 12 years causes us to vigorously encourage general availability of an 123 I radiopharmaceutical of this quality. Using this product, the authors have prepared radiopharmaceuticals for use in the study of cancer, coagulation, and renal and thyroid diseases

  15. Clinical uses of I-123 produced by 127I(p, 5n)123Xe to 123I reaction in NIRS

    International Nuclear Information System (INIS)

    Saegusa, Kenji; Arimizu, Noboru; Uchiyama, Guio; Tateno, Yukio; Rikitake, Tomoyuki.

    1978-01-01

    123 I capsules produced by NIRS which are believed to be uncontaminated by radioactive impurities other than 125 I were compared with commercial 123 I capsules regarding gamma-ray spectra, thyroid phantoms and clinical scintigrams. Absorbed radiation doses of 123 I contaminated with nuclides other than 123 I to thyroid and whole body were also estimated. Regarding gamma-ray spectra, any nuclides other than 125 I(0.53%) did not contaminate in 123 I produced by NIRS, and it was superior to commercial capsules. Regarding phantoms and clinical scintigrams, background counts around the thyroid gland seemed to be slightly higher in commercial capsules than that produced by NIRS because of contamination with other nuclides. Exposed doses in thyroid and whole body were counted. Ratios in thyroid and whole body were increased by 30% and 9%, respectively in 123 I produced by NIRS because of contamination with 0.53% of 125 I in the event that the intake ratio of thyroid was determined as 25%. In commercial capsules the doses in thyroid and whole body were increased by 500% and 150%, respectively. Doses of commercial capsules and NIRS capsules were 7.87 rad and 1.72 rad, respectively per 100 μCi in thyroid. The ratio of NIRS capsules to commercial capsules in thyroid was 1/4.6, and that in the whole body was less than 1/2. (Ichikawa, K.)

  16. Changes induced by gamma radiation in nanocomposites based on copper II and antimony sulfides in commercial poly(methyl methacrylate) matrix

    International Nuclear Information System (INIS)

    Albuquerque, M.C.C. de; Garcia, O.P.; Aquino, K.A.S.; Araujo, E.S.

    2010-01-01

    Poly (methyl methacrylate) (PMMA) is a polymer with wide application in the manufacture of medical devices that is exposed to gamma irradiation. Currently the use of composite materials has been disseminated and PMMA is an excellent polymer matrix to package various materials. This study aimed to analyze the changes induced by gamma irradiation (25 kGy) on the properties of PMMA nanocomposites with nanoparticles of copper II sulfide (250nm-900nm) and antimony sulfite (300-500 nm). The nanoparticles were added to the polymer in different concentrations and synthesized by ultrasonic irradiation from the corresponding chlorides with thioacetamide. Viscometric results showed a good radioprotective effect of nanoparticles of copper and antimony. It was found a good protection of nanoparticles on PMMA matrix in the concentration of 0.3% wt. The protections of 75% and 50% were calculated for nanoparticles of antimony and copper II, respectively. (author)

  17. Nuclear resonance scattering study of iridates, iridium and antimony based pyrochlores

    Energy Technology Data Exchange (ETDEWEB)

    Alexeev, P.

    2017-04-15

    on Ir nucleus have been determined for these compounds. In order to broaden the perspectives of NRS with the 73 keV resonance the first room temperature NRS on iridium metal is carried out. The results demonstrate NRS as a powerful research tool for the studies of iridium physics due to the high energy of the resonant photons and the high natural abundance of the {sup 193}Ir isotope under study, paving the way for studies of magnetism and electronic properties under extreme conditions. The second part of this work is dedicated to vibrational spectroscopy with Nuclear Inelastic Scattering (NIS). A sapphire backscattering monochromator was designed, installed and tested at the beamline. It provides high energy resolution due to the sub-mK temperature control, though the resolution is limited from theoretically proposed sub-meV to meV by the quality of currently available sapphire crystals. With this device the energy resolution of 1.3(1) meV at 23.88 keV and of 3.2(4) meV at 37.13 keV was achieved. Following this development, the vibrational spectra of antimony in defect pyrochlore Ag-Sb-O compounds have been measured by means of NIS at 37.13 keV. Density of phonon states for the Sb(III) and for the Sb(V) site has been unambiguously revealed. The difference in site-specific antimony modes illustrates the importance of lattice dynamics for the engineering of these compounds.

  18. Nuclear resonance scattering study of iridates, iridium and antimony based pyrochlores

    International Nuclear Information System (INIS)

    Alexeev, P.

    2017-04-01

    these compounds. In order to broaden the perspectives of NRS with the 73 keV resonance the first room temperature NRS on iridium metal is carried out. The results demonstrate NRS as a powerful research tool for the studies of iridium physics due to the high energy of the resonant photons and the high natural abundance of the 193 Ir isotope under study, paving the way for studies of magnetism and electronic properties under extreme conditions. The second part of this work is dedicated to vibrational spectroscopy with Nuclear Inelastic Scattering (NIS). A sapphire backscattering monochromator was designed, installed and tested at the beamline. It provides high energy resolution due to the sub-mK temperature control, though the resolution is limited from theoretically proposed sub-meV to meV by the quality of currently available sapphire crystals. With this device the energy resolution of 1.3(1) meV at 23.88 keV and of 3.2(4) meV at 37.13 keV was achieved. Following this development, the vibrational spectra of antimony in defect pyrochlore Ag-Sb-O compounds have been measured by means of NIS at 37.13 keV. Density of phonon states for the Sb(III) and for the Sb(V) site has been unambiguously revealed. The difference in site-specific antimony modes illustrates the importance of lattice dynamics for the engineering of these compounds.

  19. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate.

    Directory of Open Access Journals (Sweden)

    Jairo E Perez-Franco

    2016-05-01

    Full Text Available American cutaneous leishmaniasis (ACL is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate under systemic administration. According to different authors, pentavalent antimonial derivatives as treatment for ACL show a healing rate of about 75% and reasons for treatment failure are not well known.In order to characterise the clinical and parasitological features of patients with ACL that did not respond to Glucantime, a cross-sectional observational study was carried out in a cohort of 43 patients recruited in three of the Colombian Army National reference centers for complicated ACL. Clinical and paraclinical examination, and epidemiological and geographic information were recorded for each patient. Parasitological, histopathological and PCR infection confirmation were performed. Glucantime IC50 and in vitro infectivity for the isolated parasites were estimated.Predominant infecting Leishmania species corresponds to L. braziliensis (95.4% and 35% of the parasites isolated showed a significant decrease in in vitro Glucanatime susceptibility associated with previous administration of the medicament. Lesion size and in vitro infectivity of the parasite are negatively correlated with decline in Glucantime susceptibility (Spearman: r = (-0,548 and r = (-0,726; respectively.A negative correlation between lesion size and parasite resistance is documented. L. braziliensis was found as the main parasite species associated to lesion of patients that underwent treatment failure or relapse. The indication of a second round of treatment in therapeutic failure of ACL, produced by L. braziliensis, with pentavalent antimonial derivatives is discussable.

  20. First-line therapy for human cutaneous leishmaniasis in Peru using the TLR7 agonist imiquimod in combination with pentavalent antimony.

    Directory of Open Access Journals (Sweden)

    Cesar Miranda-Verastegui

    2009-07-01

    Full Text Available Current therapies for cutaneous leishmaniasis are limited by poor efficacy, long-term course of treatment, and the development of resistance. We evaluated if pentavalent antimony (an anti-parasitic drug combined with imiquimod (an immunomodulator was more effective than pentavalent antimony alone in patients who had not previously been treated.A randomized double-blind clinical trial involving 80 cutaneous leishmaniasis patients was conducted in Peru. The study subjects were recruited in Lima and Cusco (20 experimental and 20 control subjects at each site. Experimental arm: Standard dose of pentavalent antimony plus 5% imiquimod cream applied to each lesion three times per week for 20 days. Control arm: Standard dose of pentavalent antimony plus placebo (vehicle cream applied as above. The primary outcome was cure defined as complete re-epithelization with no inflammation assessed during the 12 months post-treatment period.Of the 80 subjects enrolled, 75 completed the study. The overall cure rate at the 12-month follow-up for the intention-to-treat analysis was 75% (30/40 in the experimental arm and 58% (23/40 in the control arm (p = 0.098. Subgroup analyses suggested that combination treatment benefits were most often observed at the Cusco site, where L. braziliensis is the prevalent species. Over the study period, only one adverse event (rash was recorded, in the experimental arm.The combination treatment of imiquimod plus pentavalent antimony performed better than placebo plus pentavalent antimony, but the difference was not statistically significant.Clinical Trials.gov NCT00257530.

  1. Synthesis and evaluation of lead telluride/bismuth antimony telluride nanocomposites for thermoelectric applications

    International Nuclear Information System (INIS)

    Ganguly, Shreyashi; Zhou Chen; Morelli, Donald; Sakamoto, Jeffrey; Uher, Ctirad; Brock, Stephanie L.

    2011-01-01

    Heterogeneous nanocomposites of p-type bismuth antimony telluride (Bi 2−x Sb x Te 3 ) with lead telluride (PbTe) nanoinclusions have been prepared by an incipient wetness impregnation approach. The Seebeck coefficient, electrical resistivity, thermal conductivity and Hall coefficient were measured from 80 to 380 K in order to investigate the influence of PbTe nanoparticles on the thermoelectric performance of nanocomposites. The Seebeck coefficients and electrical resistivities of nanocomposites decrease with increasing PbTe nanoparticle concentration due to an increased hole concentration. The lattice thermal conductivity decreases with the addition of PbTe nanoparticles but the total thermal conductivity increases due to the increased electronic thermal conductivity. We conclude that the presence of nanosized PbTe in the bulk Bi 2−x Sb x Te 3 matrix results in a collateral doping effect, which dominates transport properties. This study underscores the need for immiscible systems to achieve the decreased thermal transport properties possible from nanostructuring without compromising the electronic properties. - Graphical abstract: PbTe nanoparticles introduced into p-type Bi 2 Te 3 by incipient wetness results in decreased lattice thermal conductivity, but also acts as an electronic dopant, resulting in an overall decrease in thermoelectric performance. Highlights: ► Composites of PbTe nanoparticles in Bi 2−x Sb x Te 3 were formed by incipient wetness. ► PbTe nanoparticles leads to decreased κ l , consistent with phonon scattering. ► PbTe nanoparticles lead to decreased S and ρ, due to increased carriers. ► Collateral doping from PbTe leads to decreased ZT with increasing concentration. ► Immiscible systems are preferred for improved ZT.

  2. Antimony and arsenic leaching from secondary lead smelter air-pollution-control residues.

    Science.gov (United States)

    Ettler, Vojtech; Mihaljevic, Martin; Sebek, Ondrej

    2010-07-01

    Environments in the vicinity of the lead (Pb) smelters are contaminated by emissions containing high concentrations of antimony (Sb) and arsenic (As). Air-pollution-control (APC) residues from bag-type filters from a secondary Pb smelter were subjected to leaching experiments to elucidate the controlling mechanisms of Sb and As release. Kinetic batch leaching tests at a liquid-to-solid (L/S) ratio of 10 L kg(- 1) within the time frame of 720 hours and batch leaching at various L/S ratios (ranging from 1 to 1000 L kg(-1)) were performed. In contrast to other inorganic contaminants (Pb, Cd, Zn), less than 1% of the total Sb and As content was leached from the residues. At a L/S ratio of 10, the As and Sb concentrations in the leachates exceeded the EU limit values for non-hazardous waste (0.2 and 0.07 mg L(-1) ). According to PHREEQC-2 calculations, the concentrations of As and Sb are controlled by the precipitation of complex arsenates and antimonates mainly at low L/S ratios. The washing and related chemical/mineralogical transformation of APC residues was suggested as a technological pre-treatment process before their re-smelting in a blast furnace. The Ferrox-like processing of the resulting contaminated process water/leachate was simulated using the PHREEQC-2 code. Significant reduction was obtained in the concentration of some key contaminants (As, Cu, Pb, Zn) related to sorption on newly formed hydrous ferric oxides, whereas Sb and Cd exhibited only limited attenuation.

  3. Deposition efficiency in the preparation of ozone-producing nickel and antimony doped tin oxide anodes

    Directory of Open Access Journals (Sweden)

    Staffan Sandin

    2017-03-01

    Full Text Available The influence of precursor salts in the synthesis of nickel and antimony doped tin oxide (NATO electrodes using thermal decomposition from dissolved chloride salts was investigated. The salts investigated were SnCl4×5H2O, SnCl2×2H2O, SbCl3 and NiCl2×6H2O. It was shown that the use of SnCl4×5H20 in the preparation process leads to a tin loss of more than 85 %. The loss of Sb can be as high as 90 % while no indications of Ni loss was observed. As a consequence, the concentration of Ni in the NATO coating will be much higher than in the precursor solution. This high and uncontrolled loss of precursors during the preparation process will lead to an unpredictable composition in the NATO coating and will have negative economic and environmental effects. It was found that using SnCl2×2H20 instead of SnCl4×5H2O can reduce the tin loss to less than 50 %. This tin loss occurs at higher temperatures than when using SnCl4×5H2O where the tin loss occurs from 56 – 147 °C causing the composition to change both during the drying (80 – 110 °C and calcination (460 -550 °C steps of the preparation process. Electrodes coated with NATO based on the two different tin salts were investigated for morphology, composition, structure, and ozone electrocatalytic properties.

  4. Intralesional Infiltration with Meglumine Antimoniate for the Treatment of Leishmaniasis Recidiva Cutis in Ecuador.

    Science.gov (United States)

    Calvopiña, Manuel; Cevallos, William; Paredes, Yolanda; Puebla, Edison; Flores, Jessica; Loor, Richard; Padilla, José

    2017-11-01

    Meglumine Antimoniate (MA), administered intramuscularly for 21 continuous days is the recommended treatment of leishmaniases in Ecuador. However, because of its toxicity and requirement for intramuscular injections, treatment is frequently abandoned before completion. In addition, therapeutic failure and reactivation are not uncommon. Here we evaluate the efficacy and safety of MA administered intralesionally (IL) in leishmaniasis recidiva cutis (LRC). LRC is a special clinical variant of cutaneous leishmaniasis, characterized by reactivation at the edges of a primary cured lesion, presenting with active papules around the scar. Twenty-one patients were included in the study. All were diagnosed parasitologically by one of three diagnostic methods (smear, culture, and Leishmanin skin test). Each patient received MA intralesionally weekly for 4 weeks. Each papule was infiltrated until complete saturation. On average, patients received 1 mL of MA per administration. The criterion of cure was the complete resolution of the papules. Follow up was performed at 30, 90, and 180 days after treatment. At day 30 after treatment, 19 (90.5%) of 21 patients were clinically cured. The two patients, who did not heal by the fourth application, were cured on the seventh and eighth dose, achieving a clinical cure of 100% without subsequent reactivation. Mild to moderate local pain during infiltration was the only adverse reaction experienced by 81% of patients. In one case, subsequent infiltrations were discontinued because of a local allergic reaction. Complete compliance of patients to treatment and the small volume of drug administered make this method of administering MA an effective, safe, and inexpensive alternative. Consequently, IL could replace intramuscular administration in the treatment of LRC in Ecuador.

  5. TiO(2) crystal facet-dependent antimony adsorption and photocatalytic oxidation.

    Science.gov (United States)

    Song, Jiaying; Yan, Li; Duan, Jinming; Jing, Chuanyong

    2017-06-15

    Anatase TiO 2 crystal facets are garnering increasing attention due to their unique surface property. However, no specific linear relationship had been derived between the facet exposed on TiO 2 and the surface adsorption capacity as well as photocatalytic performance. This study systematically explored the facet effects on antimony (Sb) adsorption and photocatalytic oxidation using high-index {201} and low-index {101}, {001}, and {100} TiO 2 . The results suggest that high-index {201} TiO 2 exhibits the best Sb(III) adsorption and photocatalytic activity compared to the low-index TiO 2 . Both the Sb(III) adsorption density and the amount of OH and O 2 - generated in solution were correlated to the magnitude of surface energy on TiO 2 facets. Photocatalytically generated OH and O 2 - were responsible for Sb(III) photooxidation as evidenced by radical-trapping experiments. The great contribution of OH was observed only on {201}, not on low-index TiO 2 . This phenomenon was found to be attributable to the high surface energy on {201}, which enables the generation of a large amount of photogeneration OH to compensate for the fast rate of OH dissipation. Therefore, the predominant participation of OH in Sb(III) photooxidation was only possible on high-index {201} TiO 2 , which resulted in an enhanced photocatalytic rate. On the other hand, O 2 - dominated the Sb(III) photocatalytic oxidation on low-index TiO 2 . The intrinsic facet-dependent adsorption and photocatalytic mechanism obtained from this study would be useful for developing TiO 2 -based environmental technologies. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Evaluation of some medicinal plants effect on Rhodamine 123 accumulation and efflux in Caco-2 cell line by flowcytometry

    Directory of Open Access Journals (Sweden)

    S.N. Sadati Lamardi*

    2017-11-01

    Full Text Available Background and objectives: In review of traditional Persian medicine (TPM literature concerning multi drug therapy, a group of medicinal plants that are called "convoy drugs", agents which penetrate fast into whole or specific part of the body and accelerate delivery of drugs into specific target has been mentioned. In this study, the inhibitory effect of the aqueous extracts of some selected medicinal plants on P-glycoprotein (P-gp was assessed in order to determine the possibility of herb-drug interactions. Methods: P-gp inhibitory effect of aqueous extracts (250 µg/mL from some medicinal plants and verapamile (5 µg/mL was measured using flow cytometry by Rhodamine 123 (Rh123 in Caco2 cell line. Inhibition percent of each sample (% was compared with a control group (Caco-2 cell with Rh 123. Results: According to the results pennyroyal, aniseed (p

  7. Multicomponent Synthesis and Evaluation of New 1,2,3-Triazole Derivatives of Dihydropyrimidinones as Acidic Corrosion Inhibitors for Steel.

    Science.gov (United States)

    González-Olvera, Rodrigo; Román-Rodríguez, Viridiana; Negrón-Silva, Guillermo E; Espinoza-Vázquez, Araceli; Rodríguez-Gómez, Francisco Javier; Santillan, Rosa

    2016-02-22

    An efficient one-pot synthesis of 1,2,3-triazole derivatives of dihydropyrimidinones has been developed using two multicomponent reactions. The aldehyde-1,2,3-triazoles were obtained in good yields from in situ-generated organic azides and O-propargylbenzaldehyde. The target heterocycles were synthesized through the Biginelli reaction in which the aldehyde-1,2,3-triazoles reacted with ethyl acetoacetate and urea in the presence of Ce(OTf)₃ as the catalyst. The corrosion inhibition of steel grade API 5 L X52 in 1 M HCl by the synthesized compounds was investigated using the electrochemical impedance spectroscopy technique. The measurements revealed that these heterocycles are promising candidates to inhibit acidic corrosion of steel.

  8. Multicomponent Synthesis and Evaluation of New 1,2,3-Triazole Derivatives of Dihydropyrimidinones as Acidic Corrosion Inhibitors for Steel

    Directory of Open Access Journals (Sweden)

    Rodrigo González-Olvera

    2016-02-01

    Full Text Available An efficient one-pot synthesis of 1,2,3-triazole derivatives of dihydropyrimidinones has been developed using two multicomponent reactions. The aldehyde-1,2,3-triazoles were obtained in good yields from in situ-generated organic azides and O-propargylbenzaldehyde. The target heterocycles were synthesized through the Biginelli reaction in which the aldehyde-1,2,3-triazoles reacted with ethyl acetoacetate and urea in the presence of Ce(OTf3 as the catalyst. The corrosion inhibition of steel grade API 5 L X52 in 1 M HCl by the synthesized compounds was investigated using the electrochemical impedance spectroscopy technique. The measurements revealed that these heterocycles are promising candidates to inhibit acidic corrosion of steel.

  9. A Novel Framework Antimony (III) Phosphate: Synthesis and Structure of NaSb 3O 2(PO 4) 2

    Science.gov (United States)

    Adair, Brian A.; de Delgado, Graciela Díaz; Miguel Delgado, J.; Cheetham, Anthony K.

    2000-04-01

    The antimony (III) phosphate, NaSb3O2(PO4)2, is a framework structure built from SbIII and PV centers; orthorhombic, space group Pca21 (No. 29), a=13.944(3), b=6.6822(13), c=20.886(4) Å, V=1946.1(7) Å3, Z=8. Stereochemically active lone pairs of electrons associated with SbIIIO5 and SbIIIO4 polyhedra point into eight-ring channels, approximately 5×7 Å2, which dominate the architecture of the title compound. Charge-compensating sodium cations occupy the remaining space in the channels.

  10. Photochemical properties of mono-, tri-, and penta-cationic antimony(V) metalloporphyrin derivatives on a clay layer surface.

    Science.gov (United States)

    Tsukamoto, Takamasa; Shimada, Tetsuya; Takagi, Shinsuke

    2013-08-22

    Three types of mono-, tri-, and penta-cationic antimony(V) porphyrin derivatives (Sb(V)Pors) were synthesized, and their photochemical properties on the anionic clay were systematically investigated. Sb(V)Por derivatives are dihydroxo(5,10,15,20-tetraphenylporphyrinato)antimony(V) chloride ([Sb(V)(TPP)(OH)2](+)Cl(-)), dihydroxo[5,10-diphenyl-15,20-di(N-methyl-pyridinium-4-yl)porphyrinato]antimony(V) trichloride ([Sb(V)(DMPyP)(OH)2](3+)3Cl(-)), and dihydroxo[5,10,15,20-tetrakis(N-methyl-pyridinium-4-yl)porphyrinato]antimony(V) pentachloride ([Sb(V)(TMPyP)(OH)2](5+)5Cl(-)). The photochemical behaviors of three cationic Sb(V)Pors with and without clay were examined in aqueous solution. For all Sb(V)Por, aggregation behaviors were not observed in the clay complexes even at high density adsorption conditions. The transition probabilities and fluorescence quantum yields of Sb(V)Por showed a tendency to be increased by the complex formation with clay. The less cationic Sb(V)Por/clay complex showed the larger fluorescence quantum yield. The more cationic Sb(V)Por/clay complex showed the longer fluorescence lifetime. These effects of complex formation with clay on the photochemical properties of Sb(V)Pors were discussed using the molecular potential energy curves of the porphyrin ground state and excited state. It is concluded that two types of effects work in the Sb(V)Por/clay system: effect i (structure resembling effect) is that the most stable structure becomes relatively similar between the ground and excited states, mainly by hydrophobic interactions between the porphyrin molecule and the clay surface, and effect ii (structure fixing effect) is that sharpened potential energy curves of clay complexes can lead to the increase of activation energy for the internal conversion from excited state to a high vibration level of ground state, mainly by electrostatic interactions between cationic porphyrin and anionic clay. Like this, the unique effects of the clay surface on

  11. Influence of zirconium ions on the uptake of carrier-free antimony (III) (125Sb) by various sorbents

    International Nuclear Information System (INIS)

    Friedmann, Ch.; Schoenfeld, T.; Vienna Univ.

    1975-01-01

    Sorption of carrier-free radioantimony ( 125 Sb) from acid aqueous solutions is strongly influenced by the presence of zirconium. For some sorbents (diatomaceous earth, clay minerals, activated charcoal) small amounts of dissolved zirconium salts increase 125 Sb sorption strongly. Larger amounts of zirconium reduce sorption again, sometimes below the uptake occurring in the absence of zirconium. With aluminium oxide only a reduction in uptake of 125 Sb results from the presence of Zr. These effects can be attributed to the formation of soluble complex species of zirconium with antimony (polynuclear cohydrolysis products) and to their sorption behaviour. (F.G.)

  12. Striatal uptake of I-123-β-CIT and I-123-IBZM in patients with extrapyramidal symptoms

    International Nuclear Information System (INIS)

    Bettin, S.; Kaempfer, I.; Seese, A.; Schaefer, A.; Reuter, M.; Loessner, J.; Dietrich, J.; Wagner, A.; Knapp, W.H.

    1997-01-01

    Aim: This pilot study deals with the question whether characteristic changes in local cerebral dopamine transporter function and D 2 -receptor binding capacity can be shown with SPET, in idiopathic Parkinson syndrome (IPS) and secondary Parkinson syndrome (SPS). Methods: In 16 patients (6 with IPS, 6 with SPS except Wilsons's disease, and 4 with Wilson's disease) SPET studies were performed using I-123-β-CIT and I-123-IBZM and a dual-head gamma camera. Images were obtained 20-24 h and 2 h post injection, respectively. For semiquantitative analysis count density ratios of basal ganglia (BG) and cerebellum (CER) were determined for I-123-β-CIT and ratios between BG and medial frontal cortex (MFC) for I-123-IBZM. Results: The BG/CER ratio in the I-123-β-CIT studies averaged 3.04±0.83 in IPS and 7.73±3.28 in SPS (p [de

  13. N-isopropyl-p-[I123] iodoamphetamine single photon emission computed tomography (I123-IMP SPECT) and child neurology

    International Nuclear Information System (INIS)

    Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko

    1992-01-01

    We studied the clinical usefulness of I 123 -IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I 123 -IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p 123 -IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I 123 -IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I 123 -IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I 123 -IMP SPECT showed larger abnormalities in CT scanning. By using I 123 -IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I 123 -IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I 123 -IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I 123 -IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author)

  14. Role of Pr/Ba disorder in Pr123 superconductor

    International Nuclear Information System (INIS)

    Khosroabadi, H.; Modarreszadeh, M.; Taheri, P.; Akhavan, M.

    2004-01-01

    Polycrystalline (Pr 1-x Ba x )Ba 2 Cu 3 O 7-δ samples (0.0≤x≤0.6) is prepared by the standard solid state reaction technique. X-ray measurements confirm the formation of the 123 phase for x≤0.3, but for 0.4≤x≤0.6, due to the solubility limit, the 123 phase is not a dominant phase. Resistivity measurements show the increasing of resistivity with the increase of Ba-doping up to about x=0.08, and then decreases in the 123 phase up to x=0.3. There is no observation of superconducting state in our samples, but we observe the sharp decrease of resistivity for x>0.1, which is related to possible superconductivity in Pr123 system by Ba-doping. It is concluded that the Pr/Ba disorder has important effect in the transport electrical properties, specially occuring a superconducting state in Pr123. It is also suggested that extra Ba concentration in Pr123 system can create superconducting state such as in Ca-doped Pr123. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  15. Dicty_cDB: SFC123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

  16. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment

    Directory of Open Access Journals (Sweden)

    Miguel Guzman-Rivero

    2014-11-01

    Full Text Available Background: The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. Objective: To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Design: Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. Results: The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. Conclusions: It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  17. Antimony Anchored with Nitrogen-Doping Porous Carbon as a High-Performance Anode Material for Na-Ion Batteries.

    Science.gov (United States)

    Wu, Tianjing; Hou, Hongshuai; Zhang, Chenyang; Ge, Peng; Huang, Zhaodong; Jing, Mingjun; Qiu, Xiaoqing; Ji, Xiaobo

    2017-08-09

    Antimony represents a class of unique functional materials in sodium-ion batteries with high theoretical capacity (660 mA h g -1 ). The utilization of carbonaceous materials as a buffer layer has been considered an effective approach to alleviate rapid capacity fading. Herein, the antimony/nitrogen-doping porous carbon (Sb/NPC) composite with polyaniline nanosheets as a carbon source has been successfully achieved. In addition, our strategy involves three processes, a tunable organic polyreaction, a thermal annealing process, and a cost-effective reduction reaction. The as-prepared Sb/NPC electrode demonstrates a great reversible capacity of 529.6 mA h g -1 and an outstanding cycling stability with 97.2% capacity retention after 100 cycles at 100 mA g -1 . Even at 1600 mA g -1 , a superior rate capacity of 357 mA h g -1 can be retained. Those remarkable electrochemical performances can be ascribed to the introduction of a hierarchical porous NPC material to which tiny Sb nanoparticles of about 30 nm were well-wrapped to buffer volume expansion and improve conductivity.

  18. Treatment of air pollution control residues with iron rich waste sulfuric acid: does it work for antimony (Sb)?

    Science.gov (United States)

    Okkenhaug, Gudny; Breedveld, Gijs D; Kirkeng, Terje; Lægreid, Marit; Mæhlum, Trond; Mulder, Jan

    2013-03-15

    Antimony (Sb) in air pollution control (APC) residues from municipal solid waste incineration has gained increased focus due to strict Sb leaching limits set by the EU landfill directive. Here we study the chemical speciation and solubility of Sb at the APC treatment facility NOAH Langøya (Norway), where iron (Fe)-rich sulfuric acid (∼3.6M, 2.3% Fe(II)), a waste product from the industrial extraction of ilmenite, is used for neutralization. Antimony in water extracts of untreated APC residues occurred exclusively as pentavalent antimonate, even at low pH and Eh values. The Sb solubility increased substantially at pH<10, possibly due to the dissolution of ettringite (at alkaline pH) or calcium (Ca)-antimonate. Treated APC residues, stored anoxically in the laboratory, simulating the conditions at the NOAH Langøya landfill, gave rise to decreasing concentrations of Sb in porewater, occurring exclusively as Sb(V). Concentrations of Sb decreased from 87-918μgL(-1) (day 3) to 18-69μgL(-1) (day 600). We hypothesize that an initial sorption of Sb to Fe(II)-Fe(III) hydroxides (green rust) and eventually precipitation of Ca- and Fe-antimonates (tripuhyite; FeSbO4) occurred. We conclude that Fe-rich, sulfuric acid waste is efficient to immobilize Sb in APC residues from waste incineration. Copyright © 2013 Elsevier B.V. All rights reserved.

  19. Arsenic, Antimony, Chromium, and Thallium Speciation in Water and Sediment Samples with the LC-ICP-MS Technique

    Directory of Open Access Journals (Sweden)

    Magdalena Jabłońska-Czapla

    2015-01-01

    Full Text Available Chemical speciation is a very important subject in the environmental protection, toxicology, and chemical analytics due to the fact that toxicity, availability, and reactivity of trace elements depend on the chemical forms in which these elements occur. Research on low analyte levels, particularly in complex matrix samples, requires more and more advanced and sophisticated analytical methods and techniques. The latest trends in this field concern the so-called hyphenated techniques. Arsenic, antimony, chromium, and (underestimated thallium attract the closest attention of toxicologists and analysts. The properties of those elements depend on the oxidation state in which they occur. The aim of the following paper is to answer the question why the speciation analytics is so important. The paper also provides numerous examples of the hyphenated technique usage (e.g., the LC-ICP-MS application in the speciation analysis of chromium, antimony, arsenic, or thallium in water and bottom sediment samples. An important issue addressed is the preparation of environmental samples for speciation analysis.

  20. Complement activation-related pseudoallergy in dogs following intravenous administration of a liposomal formulation of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro

    2013-08-01

    Full Text Available The increasing use of nanotechnologies in advanced therapies has allowed the observation of specific adverse reactions related to nanostructures. The toxicity of a novel liposome formulation of meglumine antimoniate in dogs with visceral leishmaniasis after single dose has been investigated. Groups of 12 animals received by the intravenous route a single dose of liposomal meglumine antimoniate (group I [GI], 6.5 mg Sb/kg, empty liposomes (GII or isotonic saline (GIII. Evaluation of hematological and biochemical parameters showed no significant changes 4 days after administration. No undesired effects were registered in the GIII. However, adverse reactions were observed in 67.7% of dogs from both groups that received liposomal formulations. The side effects began moments after bolus administration and disappeared during the first 15 minutes after treatment. Prostation, sialorrhea and defecation were the most frequent clinical signs, registered in 33.3% and 41.6 % of animals from the groups GI and GII, respectively. Tachypnea, mydriasis, miosis, vomiting and cyanosis were also registered in both groups. The adverse reactions observed in this study were attributed to the activation of the complement system by lipid vesicles in a phenomenon known as Complement Activation-Related Pseudoallergy (CARPA. The influence of the physical-chemical characteristics of liposomal formulation in the triggering of CARPA is discussed.

  1. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment.

    Science.gov (United States)

    Guzman-Rivero, Miguel; Rojas, Ernesto; Verduguez-Orellana, Aleida; Pardo, Henry; Torrico, Mary Cruz; Cloetens, Lieselotte; Akesson, Björn; Sejas, Edgar

    2014-01-01

    The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  2. Arsenic, Antimony, Chromium, and Thallium Speciation in Water and Sediment Samples with the LC-ICP-MS Technique

    Science.gov (United States)

    Jabłońska-Czapla, Magdalena

    2015-01-01

    Chemical speciation is a very important subject in the environmental protection, toxicology, and chemical analytics due to the fact that toxicity, availability, and reactivity of trace elements depend on the chemical forms in which these elements occur. Research on low analyte levels, particularly in complex matrix samples, requires more and more advanced and sophisticated analytical methods and techniques. The latest trends in this field concern the so-called hyphenated techniques. Arsenic, antimony, chromium, and (underestimated) thallium attract the closest attention of toxicologists and analysts. The properties of those elements depend on the oxidation state in which they occur. The aim of the following paper is to answer the question why the speciation analytics is so important. The paper also provides numerous examples of the hyphenated technique usage (e.g., the LC-ICP-MS application in the speciation analysis of chromium, antimony, arsenic, or thallium in water and bottom sediment samples). An important issue addressed is the preparation of environmental samples for speciation analysis. PMID:25873962

  3. Detection of pathogenic bacteria in skin lesions of patients with chiclero's ulcer: reluctant response to antimonial treatment

    Directory of Open Access Journals (Sweden)

    Isaac-Márquez Angélica Patricia

    2003-01-01

    Full Text Available We investigated the bacterial flora present in skin lesions of patients with chiclero's ulcer from the Yucatan peninsula of Mexico using conventional culture methods (11 patients, and an immunocolorimetric detection of pathogenic Streptococcus pyogenes (15 patients. Prevalence of bacteria isolated by culture methods was 90.9% (10/11. We cultured, from chiclero's ulcers (60%, pathogenic bacterial such as Staphylococcus aureus (20%, S. pyogenes (1.6%, Pseudomonas aeruginosa (1.6%, Morganella morganii (1.6%, and opportunist pathogenic bacteria such as Klebsiella spp. (20.0%, Enterobacter spp. (20%, and Enterococcus spp. (20%. We also cultured coagulase-negative staphylococci in 40% (4/10 of the remaining patients. Micrococcus spp. and coagulase-negative staphylococci constituted the bacterial genuses more frequently isolated in the normal skin of patients with chiclero's ulcer and healthy individuals used as controls. We also undertook another study to find out the presence of S. pyogenes by an immunocolorimetric assay. This study indicated that 60% (9/15 of the ulcerated lesions, but not normal controls, were contaminated with S. pyogenes. Importantly, individuals with purulent secretion and holding concomitant infections with S. pyogenes, S. aureus, P. aeruginosa, M. morganii, and E. durans took longer to heal Leishmania (L. mexicana infections treated with antimonial drugs. Our results suggest the need to eliminate bacterial purulent infections, by antibiotic treatment, before starting antimonial administration to patients with chiclero's ulcer.

  4. Cytotoxicity and In Vitro Antileishmanial Activity of Antimony (V), Bismuth (V), and Tin (IV) Complexes of Lapachol.

    Science.gov (United States)

    Rocha, Marcele Neves; Nogueira, Paula Monalisa; Demicheli, Cynthia; de Oliveira, Ludmila Gonçalvez; da Silva, Meiriane Mariano; Frézard, Frédéric; Melo, Maria Norma; Soares, Rodrigo Pedro

    2013-01-01

    Leishmania amazonensis is the etiologic agent of the cutaneous and diffuse leishmaniasis often associated with drug resistance. Lapachol [2-hydroxy-3-(3'-methyl-2-butenyl)-1,4-naphthoquinone] displays a wide range of antimicrobial properties against many pathogens. In this study, using the classic microscopic in vitro model, we have analyzed the effects of a series of lapachol and chlorides complexes with antimony (V), bismuth (V), and tin (IV) against L. amazonensis. All seven compounds exhibited antileishmanial activity, but most of the antimony (V) and bismuth (V) complexes were toxic against human HepG2 cells and murine macrophages. The best IC50 values (0.17 ± 0.03 and 0.10 ± 0.11 μg/mL) were observed for Tin (IV) complexes (3) [(Lp)(Ph3Sn)] and (6) (Ph3SnCl2), respectively. Their selective indexes (SIs) were 70.65 and 120.35 for HepG2 cells, respectively. However, while analyzing murine macrophages, the SI decreased. Those compounds were moderately toxic for HepG2 cells and toxic for murine macrophages, still underlying the need of chemical modification in this class of compounds.

  5. Determination of Antimony (III in Real Samples by Anodic Stripping Voltammetry Using a Mercury Film Screen-Printed Electrode

    Directory of Open Access Journals (Sweden)

    Olga Domínguez-Renedo

    2009-01-01

    Full Text Available This paper describes a procedure for the determination of antimony (III by differential pulse anodic stripping voltammetry using a mercury film screen-printed electrode as the working electrode. The procedure has been optimized using experimental design methodology. Under these conditions, in terms of Residual Standard Deviation (RSD, the repeatability (3.81 % and the reproducibility (5.07 % of the constructed electrodes were both analyzed. The detection limit for Sb (III was calculated at a value of 1.27×10–8 M. The linear range obtained was between 0.99 × 10–8 – 8.26 × 10–8 M. An analysis of possible effects due to the presence of foreign ions in the solution was performed and the procedure was successfully applied to the determination of antimony levels in pharmaceutical preparations and sea water samples.

  6. Evaluation of the Content of Antimony, Arsenic, Bismuth, Selenium, Tellurium and Their Inorganic Forms in Commercially Baby Foods.

    Science.gov (United States)

    Ruiz-de-Cenzano, M; Rochina-Marco, A; Cervera, M L; de la Guardia, M

    2017-12-01

    Baby foods, from the Spanish market and prepared from meat, fish, vegetables, cereals, legumes, and fruits, were analyzed to obtain the concentration of antimony (Sb), arsenic (As), bismuth (Bi), and tellurium (Te) as toxic elements and selenium (Se) as essential element. An analytical procedure was employed based on atomic fluorescence spectroscopy which allowed to obtain accurate data at low levels of concentration. Values of 14 commercial samples, expressed in nanograms per gram fresh weight, ranged for Sb 0.66-6.9, As 4.5-242, Te 1.35-2.94, Bi 2.18-4.79, and Se 5.4-109. Additionally, speciation studies were performed based on data from a non-chromatographic screening method. It was concluded that tellurium and bismuth were mainly present as inorganic forms and selenium as organic form, and antimony and arsenic species depend on the ingredients of each baby food. Risk assessment considerations were made by comparing dietary intake of the aforementioned elements through the consumption of one baby food portion a day and recommended or tolerable guideline values.

  7. Effect of antimony-oxide on the shielding properties of some sodium-boro-silicate glasses.

    Science.gov (United States)

    Zoulfakar, A M; Abdel-Ghany, A M; Abou-Elnasr, T Z; Mostafa, A G; Salem, S M; El-Bahnaswy, H H

    2017-09-01

    Some sodium-silicate-boro-antimonate glasses having the molecular composition [(20) Na 2 O - (20) SiO 2 - (60-x) B 2 O 3 - (x) Sb 2 O 3 (where x takes the values 0, 5 … or 20)] have been prepared by the melt quenching method. The melting and annealing temperatures were 1500 and 650K respectively. The amorphous nature of the prepared samples was confirmed by using X-ray diffraction analysis. Both the experimental and empirical density and molar volume values showed gradual increase with increasing Sb 2 O 3 content. The empirical densities showed higher values than those obtained experimentally, while the empirical molar volume values appeared lower than those obtained experimentally, which confirm the amorphous nature and randomness character of the studied samples. The experimentally obtained shielding parameters were approximately coincident with those obtained theoretically by applying WinXCom program. At low gamma-ray energies (0.356 and 0.662MeV) Sb 2 O 3 has approximately no effect on the total Mass Attenuation Coefficient, while at high energies it acts to increase the total Mass Attenuation Coefficient gradually. The obtained Half Value Layer and Mean Free Path values showed gradual decrease as Sb 2 O 3 was gradually increased. Also, the Total Mass Attenuation Coefficient values obtained between about 0.8 and 3.0MeV gamma-ray energy showed a slight decrease, as gamma-ray photon energy increased. This may be due to the differences between the Attenuation Coefficients of both antimony and boron oxides at various gamma-ray photon energies. However, it can be stated that the addition of Sb 2 O 3 into sodium-boro-silicate glasses increases the gamma-ray Attenuation Coefficient and the best sample is that contains 20 mol% of Sb 2 O 3 , which is operating well at 0.356 and 0.662MeV gamma-ray. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Effect of antimony segregation on the electronic properties of InAs/InAsSb superlattices

    Science.gov (United States)

    Haugan, H. J.; Szmulowicz, F.; Hudgins, J. J.; Cordonnier, L. E.; Brown, G. J.

    2017-08-01

    There has been great progress in recent years in advancing the state-of-the-art of Ga-free InAs/InAsSb superlattice (SL) materials for infrared detector applications, spurred by the observation of long minority carrier lifetimes in this material system. However, compositional and dimensional changes through antimony (Sb) segregation alter the detector properties from those originally designed. For this reason, in this work, the authors explore epitaxial conditions that can mitigate this segregation in order to produce high-quality SL materials for optimum detector performance. A nominal SL structure of 7.7 nm InAs/3.5 nm InAs0.7 Sb0.3 tailored for an approximately six-micron response at 5 K was used to optimize the epitaxial parameters. Since the growth of mixed AsSb alloys is complicated by the potential reaction of As with Sb surfaces, the authors vary the substrate temperature (Ts) in order to control the As surface reaction on a Sb surface. Experimental results indicate that the SL sample grown at the lowest investigated Ts produces the highest Sb-mole fraction x of 0.3 in InAs1-x Sbx layers, which then decreases by 21 % as the Ts increases from 395 to 440 °C. This reduction causes an approximately 30 meV blueshift in the position of the excitonic photoluminescence (PL) peak. This finding differs from the results obtained from the Ga-containing InAs/GaSb SL equivalents, where the PL peak position remains constant at about 220 meV, regardless of Ts. The Ga-free SLs generally generate a broader PL linewidth than the corresponding Ga-containing SLs due to the higher spatial Sb distribution at the hetero-interfaces engendered by Sb segregation. In order for this newly proposed Ga-free SL materials to be viable for detector applications, the material problem associated with Sb segregation needs to be adequately controlled and further mitigated.

  9. Experimental and theoretical investigation of the chromium-vanadium-antimony system

    Energy Technology Data Exchange (ETDEWEB)

    Regus, Matthias; Bensch, Wolfgang [Kiel Univ. (Germany). Inst. of Inorganic Chemistry; Polesya, Svitlana; Kuhn, Gerhard; Mankovsky, Sergiy; Ebert, Hubert [Muenchen Univ. (Germany). Dept. of Chemistry; Bauers, Sage R.; Johnson, David C. [Oregon Univ., Eugene, OR (United States). Dept. of Chemistry

    2017-03-01

    The binary compound V{sub 3}Sb (V{sub 2.64}Sb, V{sub 3}Sb and V{sub 3.24}Sb) was synthesized as thin multilayered films with varying V:Sb ratios. The V-content determines the crystallization temperature and it is highest for the film with the lowest amount of V. Ternary chromium-vanadium-antimony (Cr-V-Sb) films were prepared containing Cr from 10 to 51 at-% with the Sb content fixed to yield M{sub 3}Sb (M=Cr, V). In the as-deposited state the layers are already interdiffused which is most likely caused by the very low repeating unit thickness between 0.29 and 0.68 nm investigated by X-ray diffraction experiments. All ternary compounds crystallized from the amorphous state with crystallization temperatures depending more on the repeating unit thickness than on chemical composition. For most samples the simultaneous crystallization of the two phases M{sub 3}Sb (A15 structure type) and MSb is observed. The crystalline A15 compounds are only stable in a limited temperature range and decompose at elevated temperatures. Compared to the binary Cr-Sb system crystallization of the hexagonal phase MSb (M=Cr, V) occurs at remarkably higher temperatures, i.e. in the ternary system nucleation and crystallization of this phase is hindered. The chemical composition requires short-range composition fluctuations to nucleate the binary phase. The first principles total energy calculations using the spin-polarized relativistic Korringa-Kohn-Rostoker (SPR-KKR) method confirm the experimental observations concerning the concentration-dependent stability of different phases of the Cr-V-Sb system. For the ratio M:Sb=3:1 the system is preferably stabilized in the A15 crystal structure for all possible Cr and V concentrations, while an increase of Sb content up to M:Sb=2:1 results in the stabilization of the Ni{sub 2}In structure for almost all Cr concentrations. Only in the V-rich regime of the system the Heusler Ni{sub 2}MnAl-type structure was found to be energetically more preferable.

  10. Correlation models between environmental factors and bacterial resistance to antimony and copper.

    Directory of Open Access Journals (Sweden)

    Zunji Shi

    Full Text Available Antimony (Sb and copper (Cu are toxic heavy metals that are associated with a wide variety of minerals. Sb(III-oxidizing bacteria that convert the toxic Sb(III to the less toxic Sb(V are potentially useful for environmental Sb bioremediation. A total of 125 culturable Sb(III/Cu(II-resistant bacteria from 11 different types of mining soils were isolated. Four strains identified as Arthrobacter, Acinetobacter and Janibacter exhibited notably high minimum inhibitory concentrations (MICs for Sb(III (>10 mM,making them the most highly Sb(III-resistant bacteria to date. Thirty-six strains were able to oxidize Sb(III, including Pseudomonas-, Comamonas-, Acinetobacter-, Sphingopyxis-, Paracoccus- Aminobacter-, Arthrobacter-, Bacillus-, Janibacter- and Variovorax-like isolates. Canonical correspondence analysis (CCA revealed that the soil concentrations of Sb and Cu were the most obvious environmental factors affecting the culturable bacterial population structures. Stepwise linear regression was used to create two predictive models for the correlation between soil characteristics and the bacterial Sb(III or Cu(II resistance. The concentrations of Sb and Cu in the soil was the significant factors affecting the bacterial Sb(III resistance, whereas the concentrations of S and P in the soil greatly affected the bacterial Cu(II resistance. The two stepwise linear regression models that we derived are as follows: MIC(Sb(III=606.605+0.14533 x C(Sb+0.4128 x C(Cu and MIC((Cu(II=58.3844+0.02119 x C(S+0.00199 x CP [where the MIC(Sb(III and MIC(Cu(II represent the average bacterial MIC for the metal of each soil (μM, and the C(Sb, C(Cu, C(S and C(P represent concentrations for Sb, Cu, S and P (mg/kg in soil, respectively, p<0.01]. The stepwise linear regression models we developed suggest that metals as well as other soil physicochemical parameters can contribute to bacterial resistance to metals.

  11. Technical Fact Sheet – 1,2,3-Trichloropropane (TCP)

    Science.gov (United States)

    This fact sheet, developed by the U.S. Environmental Protection Agency (EPA) Federal Facilities Restoration and Reuse Office (FFRRO), provides a brief summary of the contaminant 1,2,3-trichloropropane (TCP), including physical and chemical properties;

  12. 19 CFR 123.72 - Written agreement requirement.

    Science.gov (United States)

    2010-04-01

    ... THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Land Border Carrier Initiative Program § 123.72... lading of illegal drugs while the conveyance is en route to the United States; (c) To conduct, to the...

  13. Real-world emission factors for antimony and other brake wear related trace elements: size-segregated values for light and heavy duty vehicles.

    Science.gov (United States)

    Bukowiecki, Nicolas; Lienemann, Peter; Hill, Matthias; Figi, Renato; Richard, Agnes; Furger, Markus; Rickers, Karen; Falkenberg, Gerald; Zhao, Yongjing; Cliff, Steven S; Prevot, Andre S H; Baltensperger, Urs; Buchmann, Brigitte; Gehrig, Robert

    2009-11-01

    Hourly trace element measurements were performed in an urban street canyon and next to an interurban freeway in Switzerland during more than one month each, deploying a rotating drum impactor (RDI) and subsequent sample analysis by synchrotron radiation X-ray fluorescence spectrometry (SR-XRF). Antimony and other brake wear associated elements were detected in three particle size ranges (2.5-10, 1-2.5, and 0.1-1 microm). The hourly measurements revealed that the effect of resuspended road dust has to be taken into account for the calculation of vehicle emission factors. Individual values for light and heavy duty vehicles were obtained for stop-and-go traffic in the urban street canyon. Mass based brake wear emissions were predominantly found in the coarse particle fraction. For antimony, determined emission factors were 11 +/- 7 and 86 +/- 42 microg km(-1) vehicle(-1) for light and heavy duty vehicles, respectively. Antimony emissions along the interurban freeway with free-flowing traffic were significantly lower. Relative patterns for brake wear related elements were very similar for both considered locations. Beside vehicle type specific brake wear emissions, road dust resuspension was found to be a dominant contributor of antimony in the street canyon.

  14. Treatment of visceral leishmaniasis in a patient with AIDS with antimony and gamma-interferon: remission and prevention of relapse by maintenance therapy with weekly pentamidine

    NARCIS (Netherlands)

    Lustig, V.; Kager, P. A.; Meenhorst, P. L.

    1995-01-01

    A 41-year-old AIDS patient with fever, nightly perspiration, diarrhoea, anaemia and leukopenia was diagnosed as having visceral leishmaniasis (VL). After 8 weeks of antimony treatment combined with gamma-interferon, given in 2 courses of 3 and 5 weeks, 12 weeks apart, the bone marrow revealed no

  15. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    DEFF Research Database (Denmark)

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt

    2011-01-01

    of low chromatographic recoveries. A combination of HPLC-ICP-MS, AFFF-ICP-MS and spinfiltration was applied for analysis of model compounds and biological samples. Quantitative chromatographic Sb redox speciation analysis was possible by acidic hydrolysis of the antimony polymers prior to analysis...

  16. Syntheses, crystal structures and antimicrobial activities of 6-coordinate antimony(III) complexes with tridentate 2-acetylpyridine thiosemicarbazone, bis(thiosemicarbazone) and semicarbazone ligands.

    Science.gov (United States)

    Kasuga, Noriko Chikaraishi; Onodera, Kuniaki; Nakano, Saori; Hayashi, Kunihiko; Nomiya, Kenji

    2006-07-01

    Five novel antimony(III) complexes with the mono- and bis(thiosemicarbazone) ligands of 2N1S or 4N2S donor atoms, N'-[1-(2-pyridyl)ethylidene]morpholine-4-carbothiohydrazide (Hmtsc, L1) and bis[N'-[1-(2-pyridyl)ethylidene

  17. Biodistribution study of [I-123] ADAM in mice brain using quantitative autoradiography

    International Nuclear Information System (INIS)

    Lin, K.J.; Yen, T.C.; Tzen, K.Y.; Ye, X.X.; Hwang, J.J.; Wey, S.P.; Ting, G.

    2002-01-01

    Aim: Autoradiography with radioluminography is a delicate method to characterize newly developed radiotracers and to apply them to pharmacological studies. Herein, we reported a biodistribution result of [I-123] ADAM (2-((2-((dimethylamino)methyl)phenyl)thio)-5- iodophenylamine) in mice brain quantitatively using imaging plates. Materials and Methods: 1mCi [I-123] ADAM was injected into male ICR mice through tail veins. Brains were removed at sequential time points ranging from 0.5hr to 4hr after injection. The whole brain was cut into 14mm thick coronal sections using a cyrotome. The sections were thaw-mounted on glass plate and apposed placed on an imaging plate with filter paper standards for 24 hours. Imaging reading was done by a Fuji FLA5000 device. Regions of interest were placed on the globus pallidus, hypothalamus, substantia nigra, raphe nuclei and cerebellum corresponding to the sterotaxic atlas, and the PSL/mm 2 values were measured. The specific binding was expressed as the ratios of (targets - cerebellum) to cerebellum. Results: Autoradiography study of brain showed that the [I-123] ADAM was accumulated at serotonin transporter rich sites, including the olfactory tubercle, globus pallidus, thalamus nuclei, hypothalamus, substantia nigra, interpeduncular nucleus, amygdala and raphe nuclei. Biodistribution of [I-123] ADAM in mice brain using quantitative autoradiography method showed a high specific binding in the substantia nigra and hypothalamus and the time-activity curve peaked at 120 min post-injection. Compatible specific binding result was achieved in the region of hypothalamus as compared with previous study by other group using conventional tissue micro-dissection method (Synapse 38:403-412, 2000). However, higher specific binding was observed in certain small brain regions including substantia nigra, raphe nuclei due to improved spatial resolution of the quantitative autoradiography technique. Conclusion: Our result showed that the

  18. Monitoring of copper, arsenic and antimony levels in agricultural soils impacted and non-impacted by mining activities, from three regions in Chile.

    Science.gov (United States)

    De Gregori, Ida; Fuentes, Edwar; Rojas, Mariela; Pinochet, Hugo; Potin-Gautier, Martine

    2003-04-01

    This paper reports a comparative study of the concentration of three important environmental elements that are often found together in mineral deposits and then associated with mining activities; copper, arsenic and antimony. These elements were determined in 26 different agricultural soils from regions I, II and V in Chile, zones where the most important and biggest copper industries of this country are located. As background levels of these elements in soils have not been well established, in this study, both, impacted and non-impacted agricultural soils from different regions were considered. The relationships between the concentrations of these elements in soils were also examined. The concentration ranges for copper, arsenic and antimony were 11-530; 2.7-202 and 0.42-11 mg kg(-1) respectively. The copper concentrations in non-polluted soils from the north and central zone of Chile were similar. However, three sites from the north region have copper concentration as higher as 100 mg kg(-1), values that exceed the critical concentration for copper in soils. The concentration of arsenic and antimony in the north soils were higher than in non-impacted ones and, in the case of arsenic, greatly exceeded the world average concentration reported for this element in soils. The highest arsenic and antimony concentrations were found in Calama and Quillagua soils, two different sites in the Loa valley. The arsenic/antimony concentration ratio was higher in Quillagua soil. The high concentrations of three elements determined in impacted soils from region V (Puchuncaví and Catemu valleys) clearly shows the impact produced in this zone by the industrial and mining activities developed in their proximities. At Puchuncaví valley a clear decrease was observed in copper, arsenic and antimony concentrations in soils on the function of the distance from the industrial complex "Las Ventanas", and all concentrations exceeded the reported critical values for this matrix. Instead at

  19. Technical meeting of project counterparts on 'Cyclotron production of Iodine-123'. Report

    International Nuclear Information System (INIS)

    2002-01-01

    Several cyclotron laboratory facilities are very much interested in the production of Iodine-123 for medical applications in view of its optimal physical and chemical properties. Some of these countries have in the past used the solid target technology based on utilization of enriched Tellurium targets and are currently involved in the development of enriched Xenon-124 gas targets to improved radionuclidic purity as required by the needs of modern nuclear medicine. With the purpose of discussing the advances in the later route of production and to foster mutual co-operation among the developing countries interested in this technology, a meeting was convened with the participation of scientists from Argentina, Brazil, Iran, Korea and Syria. A scientist from the United States was also invited as an expert to provide advise on particular aspects of the technology. This publication contains as an annex technical reports from the participating institutions. All of these reports have been separately indexed and provided with abstracts

  20. Imaging active lymphocytic infiltration in coeliac disease with iodine-123-interleukin-2 and the response to diet

    International Nuclear Information System (INIS)

    Signore, A.; Chianelli, M.; Annovazzi, A.; Rossi, M.; Greco, M.; Ronga, G.; Picarelli, A.; Maiuri, L.; Britton, K.E.

    2000-01-01

    Coeliac disease is diagnosed by the presence of specific antibodies and a jejunal biopsy showing mucosal atrophy and mononuclear cell infiltration. Mucosal cell-mediated immune response is considered the central event in the pathogenesis of coeliac disease, and untreated coeliac patients show specific features of T-cell activation in the small intestine. Here we describe the use of iodine-123-interleukin-2 scintigraphy in coeliac patients as a non-invasive tool for detection of lymphocytic infiltration in the small bowel and its use for therapy follow-up, and we demonstrate the specificity of binding of labelled-IL2 to activated lymphocytes by ex-vivo autoradiography of jejunal biopsies. 123 I-IL2 was administered i.v. [74 MBq (2 mCi)], and gamma camera images were acquired after 1 h. Ten patients were studied with 123 I-IL2 scintigraphy at diagnosis and seven were also investigated after 12-19 months of gluten-free diet. Results were expressed as target-to-background radioactivity ratios in six different bowel regions before and after the diet. At the time of diagnosis all patients showed a significantly higher bowel uptake of 123 I-IL2 than normal subjects (P 2 =0.66; P=0.008). Autoradiography of jejunal biopsies confirmed that labelled-IL2 only binds to activated T-lymphocytes infiltrating the gut mucosa. After 1 year of the diet, bowel uptake of 123 I-IL2 significantly decreased in five out of six regions (P 123 I-IL2 scintigraphy is a sensitive non-invasive technique for assessing in vivo the presence of activated mononuclear cells in the bowel of patients affected by coeliac disease. Unlike jejunal biopsy, this method provides information from the whole intestine and gives a non-invasive measure of the effectiveness of the gluten-free diet. (orig.)

  1. Determination of concentration levels of arsenic, gold and antimony in particle-size fractions of gold ore using Neutron Activation Analysis

    International Nuclear Information System (INIS)

    Nyarku, M.

    2009-02-01

    Instrumental Neutron Activation Analysis (INAA) has been used to quantify the concentrations of arsenic, gold and antimony in particle-size fractions of a gold ore. The ore, which was taken from the Ahafo project site of Newmont Ghana Gold Ltd, was first fractionated into fourteen (14) particle-size fractions using state-of-the-art analytical sieve machine. The minimum sieve mesh size used was 36 microns and grains >2000 microns were not considered for analysis. Results of the sieving were analysed with easysieve software. The < 36 microns sub fraction was found to be the optimum, hosting bulk of all three elements. For arsenic, the element was found to be highly concentrated in < 36 to +100 microns size fractions and erratically distributed from +150 microns fraction and above. For gold, in exception of the sub fraction <36 which had exceptionally high concentration, the element is distributed in all the size fractions but slightly 'plays out' in the +150 to +400 microns fractions. Antimony occurrence in the sample was relatively high in <36 microns size fraction followed by 600 - 800, 800 - 1000, 400 - 600 and 36 - 40 microns size fractions in that order. Gold content in the sample was far higher than that of arsenic and antimony. Gold concentration in the composite sample was in the range 564 - 8420 ppm. Arsenic levels were higher as compared to antimony. The range of arsenic concentration in the composite sample was 14.33 - 186.92 ppm. Antimony concentration was in the range 1.09 - 9.48 ppm. (au)

  2. Extractable copper, arsenic and antimony by EDTA solution from agricultural Chilean soils and its transfer to alfalfa plants (Medicago sativa L.).

    Science.gov (United States)

    De Gregori, Ida; Fuentes, Edwar; Olivares, David; Pinochet, Hugo

    2004-01-01

    Following our research on copper, arsenic and antimony in Chilean ecosystems, a study to understand the mobility and transport of these elements from soil to plants was carried out. So, the aim of this study, which follows on from the previous work, was to demonstrate if the total concentrations of these elements or their fractions extracted by 0.05 M EDTA pH 7 from different Chilean soils correlate with the respective total concentrations in the edible tissue of alfalfa plants collected simultaneously from 20 different sites affected or unaffected by mining activities. The highest copper fractions extracted by EDTA solutions were obtained in contaminated soils from the central region (41-69%); however the northern soils presented the highest extractable fractions of arsenic (9-34%). The antimony fraction was low in all soils (0.4-8.0%). Alfalfa plants from all contaminated sites presented high copper, arsenic and antimony concentrations (19-126 mg kg(-1), 5.7-16.3 mg kg(-1) and 0.16-1.7 mg kg(-1), respectively). Statistically significant correlations were obtained between the total contents of copper and arsenic and their respective extractable fractions in soils. Good correlations were found between elements in alfalfa plants. Correlations were also obtained between the total concentrations of three elements in soils and in alfalfa plants. However, excepting for antimony in the northern samples, higher correlation coefficients were evaluated when the extractable fractions were considered. Samples from the north region presented the highest copper transfer factor and the lowest for arsenic, in spite of the high concentration of this metalloid extracted by EDTA solution in these soils. There was not a clear trend on the transfer factor for antimony, probably due to the low content of this element in alfalfa plants and/or the low recovery obtained for this element by EDTA.

  3. Scintimetric detection of choroidal malignant melanoma with [123I]-5-iodo-2-thiouracil

    NARCIS (Netherlands)

    Franken, N. A.; van Delft, J. L.; van Langevelde, A.; Bleeker, J. C.; de Wolff-Rouendaal, D.; van Best, J. A.; Bouwhuis-Hoogerwerf, M. L.; Oosterhuis, J. A.; Pauwels, E. K.

    1986-01-01

    [123I]-5-iodo-2-thiouracil (123I-ITU) was evaluated as a radiopharmaceutical for tumor detection in 10 patients with proven choroidal melanoma. Uptake of 123I-ITU was measured with a specially designed single eye probe collimator, 24 h after administration of 123I-ITU. Increased uptake in the

  4. Study of important parameters on the irradiation of {sup 124}Xe, to improve the production of {sup 123}I with high purity using the Cyclone-30 cyclotron at IPEN-CNEN/SP; Estudo de parametros relevantes na irradiacao de {sup 124}Xe, visando a otimizacao na obtencao de {sup 123}I ultra puro no ciclotron Cyclone-30 do IPEN-CNEN/SP

    Energy Technology Data Exchange (ETDEWEB)

    Sumiya, Luiz Carlos do Amaral

    2006-07-01

    The development of diagnosis equipment and therapy procedures in nuclear medicine depends on the availability of commercial radioisotopes. IPEN is the most important institution that provides radioisotopes for national market. In order to achieve this function, IPEN had invested in the acquisition of a 30 MeV Cyclone-30 cyclotron to produce mainly {sup 18}F, {sup 67}Ga, {sup 201}Tl and {sup 123}I. The {sup 123}I production is the aim of the present work. With the {sup 123}I routine production data obtained by proton irradiation of Xe targets with an enrichment greater than 99.8%, it was possible to identify the important parameters that have direct influence on the production yield of high purity degree {sup 123}I. Even though the methodology for the commercial production of {sup 123}I, there are an scarcity of operational parameters data for this task. In this work the evaluated parameters were: {sup 124}Xe pressure, proton beam quality, irradiation time, operational temperature of the irradiation system under irradiation, waiting time to obtain {sup 123}I, temperature of washing solution and the impact of the internal Ni coating in the target. With the obtained results it was possible to modify the operational conditions for routine production and increasing the efficiency in about 30%. (author)

  5. In vivo quantification by SPECT of [{sup 123}I] ADAM bound to serotonin transporters in the brains of rabbits

    Energy Technology Data Exchange (ETDEWEB)

    Ye, X.-X. [Institute of Radiological Sciences, National Yang-Ming University, Taipei 112, Taiwan (China); Hwang, J.-J. [Institute of Radiological Sciences, National Yang-Ming University, Taipei 112, Taiwan (China); Hsieh, J.-F. [Department of Nuclear Medicine, Chi-Mei Foundation Medical Center, Yungkang City 710, Taiwan (China); Chen, J.-C. [Institute of Radiological Sciences, National Yang-Ming University, Taipei 112, Taiwan (China)]. E-mail: jcchen@ym.edu.tw; Chou, Y.-T. [Institute of Physiology, National Yang-Ming University, Taipei 112, Taiwan (China); Tu, K.-Y. [Department of Nuclear Medicine, Mackey Memorial Hospital, Taipei, Taiwan 104 (China); Wey, S.-P. [Department of Medical Imaging and Radiological Sciences, Chang-Gung University, Taoyuan, Taiwan 333 (China); Ting Gann [Institute of Nuclear Energy Research, Tao- Yuan 335, Taiwan (China)

    2004-11-01

    Background: A novel radioiodine ligand [{sup 123}I] ADAM (2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine) has been suggested as a promising serotonin transporter (SERT) imaging agent for the central nervous system. In this study, the biodistribution of SERTs in the rabbit brain was investigated using [{sup 123}I] ADAM and mapping images of the same animal produced by both single-photon emission computed tomography (SPECT) and microautoradiography. A semiquantification method was adopted to deduce the optimum time for SPECT imaging, whereas the input for a simple fully quantitative tracer kinetic model was provided from arterial blood sampling data. Methods: SPECT imaging was performed on female rabbits postinjection of 185 MBq [{sup 123}I] ADAM. The time-activity curve obtained from the SPECT images was used to quantify the SERTs, for which the binding potential was calculated from the kinetic modeling of [{sup 123}I] ADAM. The kinetic data were analyzed by the nonlinear least squares method. The effects of the selective serotonin reuptake inhibitors fluoxetine and p-chloroamphetamine (PCA) on rabbits were also evaluated. After scanning, the same animal was sacrificed and the brain was removed for microautoradiography. Regions-of-interest were analyzed using both SPECT and microautoradiography images. The SPECT images were coregistered manually with the corresponding microautoradiography images for comparative study. Results: During the time interval 90-100 min postinjection, the peak specific binding levels in different brain regions were compared and the brain stem was shown to have the highest activity. The target-to-background ratio was 1.89{+-}0.02. Similar studies with fluoxetine and PCA showed a background level for SERT occupation. Microautoradiography demonstrated a higher level of anatomical details of the [{sup 123}I] ADAM distribution than that obtained by SPECT imaging of the rabbit brain. Conclusion: SPECT imaging of the rabbit brain with

  6. Comparative Analysis of the Omics Technologies Used to Study Antimonial, Amphotericin B, and Pentamidine Resistance in Leishmania

    Directory of Open Access Journals (Sweden)

    Gagandeep Kaur

    2014-01-01

    Full Text Available Leishmaniasis is a serious threat in developing countries due to its endemic nature and debilitating symptoms. Extensive research and investigations have been carried out to learn about the mechanism of drug resistance in Leishmania but results obtained in the laboratory are not in agreement with those obtained from the field. Also the lack of knowledge about the mode of action for a number of drugs makes the study of drug resistance more complex. A major concern in recent times has been regarding the role of parasitic virulence in drug resistance for Leishmania. Researchers have employed various techniques to unravel the facts about resistance and virulence in Leishmania. With advent of advanced and more specific means of detection, further hints about probable mechanisms of conferring resistance are expected. This review aims to provide a consolidated picture along with a comparative account of the work done so far to study the mechanism of antimony, amphotericin B, and pentamidine resistance using various techniques.

  7. Theoretical Prediction of an Antimony-Silicon Monolayer (penta-Sb2Si): Band Gap Engineering by Strain Effect

    Science.gov (United States)

    Morshedi, Hosein; Naseri, Mosayeb; Hantehzadeh, Mohammad Reza; Elahi, Seyed Mohammad

    2018-04-01

    In this paper, using a first principles calculation, a two-dimensional structure of silicon-antimony named penta-Sb2Si is predicted. The structural, kinetic, and thermal stabilities of the predicted monolayer are confirmed by the cohesive energy calculation, phonon dispersion analysis, and first principles molecular dynamic simulation, respectively. The electronic properties investigation shows that the pentagonal Sb2Si monolayer is a semiconductor with an indirect band gap of about 1.53 eV (2.1 eV) from GGA-PBE (PBE0 hybrid functional) calculations which can be effectively engineered by employing external biaxial compressive and tensile strain. Furthermore, the optical characteristics calculation indicates that the predicted monolayer has considerable optical absorption and reflectivity in the ultraviolet region. The results suggest that a Sb2Si monolayer has very good potential applications in new nano-optoelectronic devices.

  8. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.).

    Science.gov (United States)

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander

    2015-12-01

    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact.

  9. Remuneração em opções de ações: o SFAS 123 revisado Share option awards: SFAS 123 revised

    Directory of Open Access Journals (Sweden)

    Fernando Caio Galdi

    2006-08-01

    Full Text Available Diferentes mecanismos de remuneração têm sido desenvolvidos com o intuito de estimular os empregados a agir com foco na maximização do valor da firma. Uma das maneiras utilizadas pelas empresas na busca desse objetivo é a remuneração vinculada à entrega de ações ou opções de ações da empresa para os empregados (chamada genericamente de remuneração baseada em ações em troca de seus serviços. Contudo, a utilização desse instrumento acarreta algumas questões controversas para a Contabilidade. Esse tipo de remuneração deve ser reconhecido como despesa? Opções de compra lançadas pela empresa para a remuneração de seus funcionários representam um passivo ou um item do patrimônio líquido? Por qual valor deve ser mensurado esse tipo de remuneração? E qual o período que deve ser considerado para a contabilização? No intuito de regulamentar o assunto, o FASB emitiu o SFAS 123 revisado. Este trabalho aborda os temas relacionados com a remuneração baseada em ações, concentrando-se na remuneração com opções de ações, e objetiva expor e analisar o arcabouço conceitual do SFAS 123 revisado. Para isso apresenta a evolução histórica da controversa normatização do tema, discorre sobre os principais conceitos emanados do SFAS 123 revisado e aborda a argumentação utilizada pelo FASB para o embasamento teórico da norma.Different kinds of awards have been developed to stimulate employers to focus on the maximization of the fi rm value. To reach this target, entities use share-based payment in exchange for the employee services they receive. However, the utilization of these instruments results in controversial questions for Accounting. Should equity awards be recognized as expenses? Is a share option award (issued to pay for employee services a liability or an equity instrument? What method should be used to measure the value of this instrument? What period of time should be considered to account for this kind

  10. Clinical significance of {sup 123}I-BMIPP myocardial SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Yamazaki, Junichi [Toho Univ., Tokyo (Japan). School of Medicine

    1998-07-01

    {sup 123}I-BMIPP is a radioiodinated branched chain fatty acid analog, showing high accumulation as well as prolonged retention in the myocardium. Therefore, it is used as a metabolic imaging agent suitable for myocardial SPECT. After {sup 123}I-BMIPP is taken in the myocardium, it remains there mainly as a storage type fatty acid of triglyceride, and it shows different behavior by the stage of cardiac disease. Usually, we evaluate metabolic findings by early imaging (20 minutes) after intravenous injection of {sup 123}I-BMIPP, however, sometimes washout or fill in are seen in the case of myocardial infarction or hypertrophic cardiomyopathy by delayed imaging (after 4 hours). The mismatch of {sup 201}TlCl and {sup 123}I-BMIPP are useful for the diagnosis of stunned myocardium or evaluation of prognosis. However, behavior of {sup 123}I-BMIPP in myocardium is known still not completely. Therefore clinical significance of this examination is thought to be clarified by the stock of cases of various heart diseases. (author)

  11. Iodine-123-labelled serum amyloid P component scintigraphy in amyloidosis

    International Nuclear Information System (INIS)

    Saile, R.; Deveaux, M.; Marchandise, X.; Duquesnoy, B.

    1993-01-01

    This study describes the results of scintigraphy with iodine-123-labelled serum amyloid P component (SAP) as a means of establishing the distribution of organ involvement in amyloidosis. The significance of 123 I-SAP scans obtained in 15 patients with biopsy-proven AA or AL amyloidosis is discussed. Biopsy-proven amyloidosis was typically confirmed by scintigraphy, though such confirmation was not obtained in the kidneys in six patients with histological proof of extensive renal amyloid deposition. This lack of uptake may have been due to the accumulation of a major part of the 123 I-SAP in the spleen and/or liver. Twenty-four hour whole-body retention of 123 I-SAP was higher in patients with amyloidosis than in controls. Twenty-four hour tracer accumulation of the radioactivity in the extravascular compartment was notably greater in patients than in controls and appeared to be a good diagnostic criterion. We conclude that 123 I-SAP scintigraphy may be helpful for the evaluation of organ involvement not only in patients with biopsy-proven amyloidosis but also when a biopsy cannot be performed or when a strong suspicion of amyloidosis exists in spite of repeated negative biopsises. (orig.)

  12. Enhanced Removal of Arsenic and Antimony in the Mining Site by Calcined γ-Fe2O3/Layered Double Hydroxide Nanocomposite

    Science.gov (United States)

    Lee, Sang-Ho; Choi, Heechul; Kim, Kyoung-Woong

    2016-04-01

    Arsenic (As) and Antimony (Sb) have been recognized as harmful contaminants in aquatic environment due to its high toxicity and carcinogenicity. Especially, the contamination of arsenic in the mining areas is considered as a serious emerging environmental issue in Korea. Due to the hazardous effect of arsenic, the United States Environmental Protection Agency (US EPA) regulated maximum contamination level of arsenic to 10 μg/L in drinking water. The harmful effect on human health by excessive intake of antimony was also reported by previous studies, and severe contamination level (100 - 7,000 μg/L) of antimony reported in surface and groundwater of abandoned mining area in China and Slovakia. Therefore, US EPA regulated maximum contaminants level of antimony in drinking water to 6 μg/L. In order to remove anionic contaminants in drinking water, various type of nanomaterials have been developed. Layered double hydroxide (LDH) is the artificial anionic clay that is based on the layered structure of positively charged brucite-like layers with interlayers of anions. The LDH is one of the promising nanomaterials for the removal of anionic contaminants because it has high selectivity for arsenic, phosphate, chromium and antimony. However, the biggest problem of LDH for wastewater treatment is that the particles cannot be easily separated after the removal of contaminants. In this study, magnetic nanoparticles (γ-Fe2O3) supported LDH nanocomposite (γ-Fe2O3/LDH) was investigated to enhance magnetic particle recovery and removal efficiency for arsenic and antimony. The calcined γ-Fe2O3/LDH nanocomposites synthesized by co-precipitation method, and the crystallographic properties of maghemite (γ-Fe2O3) and layered structure of LDH were confirmed by X-ray diffraction. The nano-sized γ-Fe2O3 (30 to 50 nm) was stably attached on the surface of LDH (100 to 150 nm) and O1s spectrum by X-ray photoelectron spectroscopy (XPS) explained that there are both physical and

  13. Synthesis of Ce(III)-doped Fe3O4 magnetic particles for efficient removal of antimony from aqueous solution

    International Nuclear Information System (INIS)

    Qi, Zenglu; Joshi, Tista Prasai; Liu, Ruiping; Liu, Huijuan; Qu, Jiuhui

    2017-01-01

    Highlights: • Doping of Ce into Fe 3 O 4 was achieved based on a facile solvothermal method. • After doping, the removal capacity was increased by 5 times for “Sb(V)” and 2 times for “Sb(III)”. • Decreasing pH improved adsorption of Sb(V) but decreased adsorption of Sb(III). • Antimony sorption mechanisms on Ce-doped Fe 3 O 4 were illustrated. - Abstract: Aqueous antimony (Sb) pollution from human activity is of great concern in drinking water due to its adverse health effect. Magnetic Fe 3 O 4 particles, with high separation ability from solution, have been considered as a low-cost Sb adsorbent for contaminants. However, the limited adsorption capacity has restricted its practical application. In this study, a solvothermal approach was developed for doping Ce(III) into Fe 3 O 4 , thereby increasing the adsorption efficacy for both Sb(III) and Sb(V). In contrast to un-doped Fe 3 O 4 , the adsorption capacity towards Sb(III) and Sb(V) in Ce-doped materials increased from 111.4 to 224.2 mg/g and from 37.2 to 188.1 mg/g at neutral pH, respectively. Based on the combined results of XPS, XRD, and FTIR, it confirmed that Ce atom successfully doped into the Fe 3 O 4 structure, resulting in the decreased particle size, increased the surface area, and isoelectric point. Furthermore, the vibrating sample magnetometer (VSM) results showed that the Ce doping process had some side effects on the primitive magnetic property, but remaining the high separation potential during water treatment. According to the high removal efficiency and magnetic property, the Ce-doped Fe 3 O 4 of great simplicity should be a promising adsorbent for aqueous Sb removal.

  14. A comparative study of antimony accumulation in plants growing in two mining areas in Iran, Moghanlo, and Patyar.

    Science.gov (United States)

    Jamali Hajiani, Naser; Ghaderian, Seyed Majid; Karimi, Naser; Schat, Henk

    2015-11-01

    Antimony occurs locally at high concentrations in some mineralized soils. Very little is known about behavior of antimony in plants. In this study, we analyzed the soil and vegetation of two mining areas in Iran, Patyar, and Moghanlo. Total Sb concentrations in soil were 358-3482 mg/kg in Moghanlo and 284-886 mg/kg in Patyar. Corresponding Sb concentrations in plant shoots were 0.8-287 and 1.3-49 mg/kg, respectively. In both areas, foliar Sb concentrations increased with acid-extractable soil Sb, although the slope was about 2-fold steeper for Patyar than for Moghanlo. Regressing the foliar concentrations on water-soluble Sb yielded identical slopes for both areas, suggesting that the soluble fraction of Sb rather than total Sb is the direct determinant of foliar Sb accumulation. Both in Patyar and Moghanlo, only a minor part of the total variance of shoot Sb was explained by soluble Sb. The major part was explained by plant species, demonstrating that plant taxonomic identity is the most important determinant of foliar Sb accumulation capacity in both areas. The translocation factor (TF) was highly variable too, with species as the only significant variance component. Only four species were able to accumulate more than 100 mg/kg Sb in their leaves. Among these species, Achillea wilhelmsii and Matthiola farinosa were by far the best Sb accumulators, with, on average, 141 and 132 mg/kg Sb in their leaves. Of these two, only Matthiola farinosa consistently maintained TF values far above unity across the whole range of soluble Sb in Moghanlo.

  15. Reliability evaluation of I-123 ADAM SPECT imaging using SPM software and AAL ROI methods

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Bang-Hung [Department of Biomedical Imaging and Radiological Sciences, National Yang-Ming University, Taipei, Taiwan (China); Department of Nuclear Medicine, Taipei Veterans General Hospital, Taiwan (China); Tsai, Sung-Yi [Department of Biomedical Imaging and Radiological Sciences, National Yang-Ming University, Taipei, Taiwan (China); Department of Imaging Medical, St.Martin De Porres Hospital, Chia-Yi, Taiwan (China); Wang, Shyh-Jen [Department of Biomedical Imaging and Radiological Sciences, National Yang-Ming University, Taipei, Taiwan (China); Department of Nuclear Medicine, Taipei Veterans General Hospital, Taiwan (China); Su, Tung-Ping; Chou, Yuan-Hwa [Department of Psychiatry, Taipei Veterans General Hospital, Taipei, Taiwan (China); Chen, Chia-Chieh [Institute of Nuclear Energy Research, Longtan, Taiwan (China); Chen, Jyh-Cheng, E-mail: jcchen@ym.edu.tw [Department of Biomedical Imaging and Radiological Sciences, National Yang-Ming University, Taipei, Taiwan (China)

    2011-08-21

    The level of serotonin was regulated by serotonin transporter (SERT), which is a decisive protein in regulation of serotonin neurotransmission system. Many psychiatric disorders and therapies were also related to concentration of cerebral serotonin. I-123 ADAM was the novel radiopharmaceutical to image SERT in brain. The aim of this study was to measure reliability of SERT densities of healthy volunteers by automated anatomical labeling (AAL) method. Furthermore, we also used statistic parametric mapping (SPM) on a voxel by voxel analysis to find difference of cortex between test and retest of I-123 ADAM single photon emission computed tomography (SPECT) images. Twenty-one healthy volunteers were scanned twice with SPECT at 4 h after intravenous administration of 185 MBq of {sup 123}I-ADAM. The image matrix size was 128x128 and pixel size was 3.9 mm. All images were obtained through filtered back-projection (FBP) reconstruction algorithm. Region of interest (ROI) definition was performed based on the AAL brain template in PMOD version 2.95 software package. ROI demarcations were placed on midbrain, pons, striatum, and cerebellum. All images were spatially normalized to the SPECT MNI (Montreal Neurological Institute) templates supplied with SPM2. And each image was transformed into standard stereotactic space, which was matched to the Talairach and Tournoux atlas. Then differences across scans were statistically estimated on a voxel by voxel analysis using paired t-test (population main effect: 2 cond's, 1 scan/cond.), which was applied to compare concentration of SERT between the test and retest cerebral scans. The average of specific uptake ratio (SUR: target/cerebellum-1) of {sup 123}I-ADAM binding to SERT in midbrain was 1.78{+-}0.27, pons was 1.21{+-}0.53, and striatum was 0.79{+-}0.13. The cronbach's {alpha} of intra-class correlation coefficient (ICC) was 0.92. Besides, there was also no significant statistical finding in cerebral area using SPM2

  16. Are 1,4- and 1,5-disubstituted 1,2,3-triazoles good pharmacophoric groups?

    Science.gov (United States)

    Massarotti, Alberto; Aprile, Silvio; Mercalli, Valentina; Del Grosso, Erika; Grosa, Giorgio; Sorba, Giovanni; Tron, Gian Cesare

    2014-11-01

    Over the last decade, 1,2,3-triazoles have received increasing attention in medicinal chemistry thanks to the discovery of the highly useful and widely applicable 1,3-dipolar cycloaddition reaction between azides and alkynes (click chemistry) catalyzed by copper salts and ruthenium complexes. After a decade of medicinal chemistry research on 1,2,3-triazoles, we feel that the time is ripe to demonstrate the real ability of this heterocycle to participate in important and pivotal binding interactions with biological targets while maintaining a good pharmacokinetic profile. In this study, we retrieved and analyzed X-ray crystal structures of complexes between 1,2,3-triazoles and either proteins or DNA to understand the pharmacophoric role of the triazole. Furthermore, the metabolic stability, the capacity to inhibit cytochromes, and the contribution of 1,2,3-triazoles to the overall aqueous solubility of compounds containing them have been analyzed. This information should furnish fresh insight for medicinal chemists in the design of novel bioactive molecules that contain the triazole nucleus. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Substitution of terminal amide with 1H-1,2,3-triazole: Identification of unexpected class of potent antibacterial agents.

    Science.gov (United States)

    Bi, Fangchao; Ji, Shengli; Venter, Henrietta; Liu, Jingru; Semple, Susan J; Ma, Shutao

    2018-03-01

    3-Methoxybenzamide (3-MBA) derivatives have been identified as novel class of potent antibacterial agents targeting the bacterial cell division protein FtsZ. As one of isosteres for the amide group, 1,2,3-triazole can mimic the topological and electronic features of the amide, which has gained increasing attention in drug discovery. Based on these considerations, we prepared a series of 1H-1,2,3-triazole-containing 3-MBA analogues via isosteric replacement of the terminal amide with triazole, which had increased antibacterial activity. This study demonstrated the possibility of developing the 1H-1,2,3-triazole group as a terminal amide-mimetic element which was capable of both keeping and modulating amide-related bioactivity. Surprisingly, a different action mode of these new 1H-1,2,3-triazole-containing analogues was observed, which could open new opportunities for the development of antibacterial agents. Copyright © 2018 Elsevier Ltd. All rights reserved.

  18. Dry Distillation of Radioiodine from TeO2 Targets

    OpenAIRE

    Fonslet, Jesper; Koziorowski, Jacek

    2013-01-01

    As medical cyclotrons are becoming more abundant, 123I and 124I are getting more attention as alternatives to 131I for diagnostics of thyroid disease. Both 123I and 124I provide better diagnostics, deliver less dose to patients and both reduce the risk of thyroid stunning, facilitating subsequent therapy. Dry distillation of radioiodine from tellurium dioxide targets has become the standard approach to producing these radioiodines. Setting up such a production of radioiodine is associated wit...

  19. [(123)I]FP-CIT ENC-DAT normal database

    DEFF Research Database (Denmark)

    Tossici-Bolt, Livia; Dickson, John C; Sera, Terez

    2017-01-01

    BACKGROUND: [(123)I]FP-CIT is a well-established radiotracer for the diagnosis of dopaminergic degenerative disorders. The European Normal Control Database of DaTSCAN (ENC-DAT) of healthy controls has provided age and gender-specific reference values for the [(123)I]FP-CIT specific binding ratio...... quantifications methods, BRASS and Southampton, and explores the performance of the striatal phantom calibration in their harmonisation. RESULTS: BRASS and Southampton databases comprising 123 ENC-DAT subjects, from gamma cameras with parallel collimators, were reconstructed using filtered back projection (FBP......) and iterative reconstruction OSEM without corrections (IRNC) and compared against the recommended OSEM with corrections for attenuation and scatter and septal penetration (ACSC), before and after applying phantom calibration. Differences between databases were quantified using the percentage difference...

  20. Abnormal I-123 HIPDM images in various disease entities

    International Nuclear Information System (INIS)

    Shih, W.J.; Magoun, S.; Coupal, J.J.; Clark, D.B.; Dekosky, S.T.; Kung, H.F.; Beihn, R.; Ryo, U.Y.

    1987-01-01

    Eighty patients who were referred from neurology service for evaluation of stroke, Alzheimer disease (AD), and/or other neurologic diseases underwent the study. Four views of planar images were obtained following the intravenous injection of 3-5 mCi of I-123 HIPDM. SPECT images were then obtained using a camera interfaced to a PDP-11 computer. Forty of the 80 patients had scintigraphic findings of stroke, which correlated well with head CT/cerebral angiogram. Sixteen patients with AD had good correlation between the degree of temporoparietal abnormality in the images. Severe AD and severe stroke patients almost always had a positive planar image. Normal I-123 HIPDM localization in the brain requires intact cerebral flow and cerebral neuronal function. A focal area of decreased I-123 HIPDM localization may represent either interruption of blood flow or neurochemical dysfunction

  1. I-123 IMP brain scintigraphies in asphyxiated newborns

    International Nuclear Information System (INIS)

    Maeda, Hisatoshi; Konishi, Yukuo; Kuriyama, Masanori; Ishii, Yasushi; Sudo, Masakatsu

    1987-01-01

    Brain scintigraphies with N-Isopropyl (I-123) p-Iodoamphetamine (I-123 IMP) were conducted in eight patients who had asphyxia at the time of birth. Two patients, 15 and 26 year-old, had local defects and diffuse low cerebral uptakes. Two children, 70 day and 2 year-old, had no cerebral uptake. Brain scintigraphies were carried out twice in three among four newborns. Only slight I-123 IMP brain uptakes were observed in the first 10 days. The lateral views of the brain scintigraphies showed increased uptake in the middle region of the brain between 10 to 30 days and reached almost equally distributed in frontal, middle and posterior regions after 30 days. These results were thought to represent rather developmental changes of the cerebral blood flow after ischemic attacks at birth. (author)

  2. Sup(123)I excretion in breast milk - additional data

    Energy Technology Data Exchange (ETDEWEB)

    Lawes, S.C. (Queen' s Medical Centre, Nottingham (United Kingdom))

    1992-07-01

    A woman with a suspected sublingual thyroid was referred for thyroid imaging with {sup 123}I-sodium iodide. On attending it was ascertained that she was currently breastfeeding her 3-month-old baby. Reference to the available literature showed little information regarding the excretion of {sup 123}I-sodium iodide in human breast milk apart from one single case. It was felt therefore that this would be an ideal opportunity to collect some useful data. Originally the presence of impurities in the radiopharmaceutical administered had been discounted as being of little significance. However, after consideration, a review of the contribution of any impurity was undertaken. (author).

  3. Localization of a pheochromocytoma using I-123 MIBG adrenal scintigraphy.

    Directory of Open Access Journals (Sweden)

    Shirkare S

    1994-04-01

    Full Text Available In a patient with the clinical diagnosis of pheochromocytoma, the localization of the tumor is essential for planning treatment. Recently, we have performed I-123 metaiodobenzylguanidine (MIBG adrenal scintigraphy in a patient presenting with a history of paroxysmal hypertension. Scintigraphy accurately located an ectopic unilateral pheochromocytoma. The scintigraphic diagnosis was confirmed by surgery and a diagnosis of ectopic unilateral pheochromocytoma was made by histopathological examination. This case report illustrates the specific diagnosis of pheochromocytoma by I-123 MIBG scintigraphy which is especially useful when other diagnostic procedures are equivocal.

  4. Aluminum Dimer Containing Bulky 1,2,3-Triazolate Ligand

    Directory of Open Access Journals (Sweden)

    Issam Kobrsi

    2014-01-01

    Full Text Available The first molecular aluminum 1,2,3-triazolato complex was synthesized bearing a bulky 1,2,3-triazolate ligand. Oligomers and polymers were avoided due to the bulkiness and noncoordinating nature of the substituents. The novel Al2N4 ring formed contains symmetrical Al-N bond distances unexpectedly having asymmetric Al-N-N angles of 144.55(15° and 115.83(14°. This asymmetry demonstrates the effect of the steric hindrance of the ligand.

  5. Relative SHG measurements of metal thin films: Gold, silver, aluminum, cobalt, chromium, germanium, nickel, antimony, titanium, titanium nitride, tungsten, zinc, silicon and indium tin oxide

    Directory of Open Access Journals (Sweden)

    Franklin Che

    Full Text Available We have experimentally measured the surface second-harmonic generation (SHG of sputtered gold, silver, aluminum, zinc, tungsten, copper, titanium, cobalt, nickel, chromium, germanium, antimony, titanium nitride, silicon and indium tin oxide thin films. The second-harmonic response was measured in reflection using a 150 fs p-polarized laser pulse at 1561 nm. We present a clear comparison of the SHG intensity of these films relative to each other. Our measured relative intensities compare favorably with the relative intensities of metals with published data. We also report for the first time to our knowledge the surface SHG intensity of tungsten and antimony relative to that of well known metallic thin films such as gold and silver. Keywords: Surface second-harmonic generation, Nonlinear optics, Metal thin films

  6. An improved method for the determination of trace levels of arsenic and antimony in geological materials by automated hydride generation-atomic absorption spectroscopy

    Science.gov (United States)

    Crock, J.G.; Lichte, F.E.

    1982-01-01

    An improved, automated method for the determination of arsenic and antimony in geological materials is described. After digestion of the material in sulfuric, nitric, hydrofluoric and perchloric acids, a hydrochloric acid solution of the sample is automatically mixed with reducing agents, acidified with additional hydrochloric acid, and treated with a sodium tetrahydroborate solution to form arsine and stibine. The hydrides are decomposed in a heated quartz tube in the optical path of an atomic absorption spectrometer. The absorbance peak height for arsenic or antimony is measured. Interferences that exist are minimized to the point where most geological materials including coals, soils, coal ashes, rocks and sediments can be analyzed directly without use of standard additions. The relative standard deviation of the digestion and the instrumental procedure is less than 2% at the 50 ??g l-1 As or Sb level. The reagent-blank detection limit is 0.2 ??g l-1 As or Sb. ?? 1982.

  7. Comparative acute toxicity of gallium(III), antimony(III), indium(III), cadmium(II), and copper(II) on freshwater swamp shrimp (Macrobrachium nipponense).

    Science.gov (United States)

    Yang, Jen-Lee

    2014-04-01

    Acute toxicity testing were carried out the freshwater swamp shrimp, Macrobrachium nipponense, as the model animal for the semiconductor applied metals (gallium, antimony, indium, cadmium, and copper) to evaluate if the species is an suitable experimental animal of pollution in aquatic ecosystem. The static renewal test method of acute lethal concentrations determination was used, and water temperature was maintained at 24.0 ± 0.5°C. Data of individual metal obtained from acute toxicity tests were determined using probit analysis method. The median lethal concentration (96-h LC50) of gallium, antimony, indium, cadmium, and copper for M. nipponense were estimated as 2.7742, 1.9626, 6.8938, 0.0539, and 0.0313 mg/L, respectively. Comparing the toxicity tolerance of M. nipponense with other species which exposed to these metals, it is obviously that the M. nipponense is more sensitive than that of various other aquatic animals.

  8. The cytotoxicity of organobismuth compounds with certain molecular structures can be diminished by replacing the bismuth atom with an antimony atom in the molecules.

    Science.gov (United States)

    Kohri, Kumiko; Yoshida, Eiko; Yasuike, Shuji; Fujie, Tomoya; Yamamoto, Chika; Kaji, Toshiyuki

    2015-06-01

    Organic-inorganic hybrid molecules, which are composed of an organic structure and metal(s), are indispensable for synthetic chemical reactions; however, their toxicity has been incompletely understood. In the present study, we discovered two cytotoxic organobismuth compounds whose cytotoxicity diminished upon replacement of the intramolecular bismuth atom with an antimony atom. The intracellular accumulation of the organobismuth compounds was much higher than that of the organoantimony compounds with the corresponding organic structures. We also showed that both the organic structure and bismuth atom are required for certain organobismuth compounds to exert their cytotoxic effect, suggesting that the cytotoxicity of such a compound is a result of an interaction between the organic structure and the bismuth atom. The present data suggest that organobismuth compounds with certain molecular structures exhibit cytotoxicity via an interaction between the molecular structure and the bismuth atom, and this cytotoxicity can be diminished by replacing the bismuth atom with an antimony atom, resulting in lower intracellular accumulation.

  9. Simultaneous determination of asrenic, mercury, antimony and selenium in biological materials with prior collection of gaseous products followed by neutron activation analysis

    International Nuclear Information System (INIS)

    Wu, C.Y.; Chen, P.Y.; Yang, M.H.

    1986-01-01

    A method combining prior collection of gaseous products with subsequent neutron activation analysis has been developed for simultaneous determination of traces of arsenic, mercury, antimony and selenium in biological materials. The generation of hydrides of arsenic, antimony and selenium and cold vapor of mercury in the generation and collection system was investigated by the use of radiotracers of the respective elements. The result indicates that selenium and mercury can be completely evaporated from the digested sample solution in 5M HCl with the addition of 5% sodium tetrahydroborate solution, while additional reduction process by potassium iodide and ascorbic acid is needed for complete evaporation of arsenic and antiomony. The gaseous products were collected in a quartz tube for neutron irradiation. The detection limits of these elements were found to be in the range of 10 -7 to 10 -8 g under the present experimental conditions. The reliability was checked with NBS standard reference materisl. (author)

  10. Molecular precursors for the phase-change material germanium-antimony-telluride, Ge{sub 2}Sb{sub 2}Te{sub 5} (GST)

    Energy Technology Data Exchange (ETDEWEB)

    Harmgarth, Nicole; Zoerner, Florian; Engelhardt, Felix; Edelmann, Frank T. [Chemisches Institut, Otto-von-Guericke-Universitaet Magdeburg (Germany); Liebing, Phil [Laboratorium fuer Anorganische Chemie, ETH Zuerich (Switzerland); Burte, Edmund P.; Silinskas, Mindaugas [Institut fuer Mikro- und Sensorsysteme, Otto-von-Guericke-Universitaet Magdeburg (Germany)

    2017-10-04

    This review provides an overview of the precursor chemistry that has been developed around the phase-change material germanium-antimony-telluride, Ge{sub 2}Sb{sub 2}Te{sub 5} (GST). Thin films of GST can be deposited by employing either chemical vapor deposition (CVD) or atomic layer deposition (ALD) techniques. In both cases, the success of the layer deposition crucially depends on the proper choice of suitable molecular precursors. Previously reported processes mainly relied on simple alkoxides, alkyls, amides and halides of germanium, antimony, and tellurium. More sophisticated precursor design provided a number of promising new aziridinides and guanidinates. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  11. Critical currents and weak links in melt textured R123

    International Nuclear Information System (INIS)

    Veal, B. W.; Zhang, H.; Claus, H.; Chen, L.; Paulikas, A. P.; Koshelev, A.; Crabtree, G. W.

    2000-01-01

    Weak link behavior is studied, using magnetization and Hall probe measurements of ring samples, in welded melt-textured R123 monoliths and in dual-seeded samples with disoriented domains. Techniques for welding samples yield transport currents across the junction that are in excess of 10 4 A/cm 2

  12. An economical method for the continuous production of iodine-123

    Science.gov (United States)

    Blue, J. W.; Smith, W. R.; Sodd, V. J.

    1968-01-01

    Simple and inexpensive method produces iodine 123, in a conventional cyclotron. Tellurium 122, a stable isotope available in enrichments exceeding 95 percent, is held on a porous metal plate by a flowing stream of helium and bombarded with either alpha particles or helium 3.

  13. 19 CFR 123.24 - Sealing of conveyances or compartments.

    Science.gov (United States)

    2010-04-01

    ...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.24 Sealing of conveyances or compartments. (a) Sealing required. Merchandise in transit...-bound seals may go forward without additional seals. (c) Carrier relieved of responsibility. The port...

  14. Construction of Association Scheme Using Some (123)-avoiding ...

    African Journals Online (AJOL)

    This paper presents some backgrounds research on association scheme using a class of (123)-avoiding pattern of Aunu numbers as an application area. It also attempts to highlight some further applications ... concept of association scheme. This research also shows us that the Aunu patterns can be used in design theory.

  15. 30 CFR 229.123 - Standards for audit activities.

    Science.gov (United States)

    2010-07-01

    ... 229.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... required, including a knowledge of accounting, auditing, agency regulations, and industry operations. (ii... statement of standards. (iii) The auditor's report should contain a statement of positive assurance on those...

  16. Efficient Synthesis of 1-Sulfonyl-1,2,3-triazoles

    Science.gov (United States)

    Raushel, Jessica; Fokin, Valery V.

    2010-01-01

    An efficient room temperature method for the synthesis of 1-sulfonyl-1,2,3-triazoles from in situ generated copper(I) acetylides and sulfonyl azides is described. Copper(I) thiophene-2-carboxylate (CuTC) catalyst produces the title compounds under both non-basic anhydrous and aqueous conditions in good yields. PMID:20931987

  17. 13 CFR 123.12 - Are books and records required?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Are books and records required... PROGRAM Overview § 123.12 Are books and records required? You must retain complete records of all... disaster business or economic injury loan, you must also maintain current and accurate books of account...

  18. 34 CFR 303.123 - Prohibition against commingling.

    Science.gov (United States)

    2010-07-01

    ... assurance in this section is satisfied by the use of an accounting system that includes an “audit trail” of... EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS AND TODDLERS WITH DISABILITIES State Application for a Grant Statement of Assurances § 303.123 Prohibition...

  19. 47 CFR 76.123 - Satellite syndicated program exclusivity.

    Science.gov (United States)

    2010-10-01

    ... Exclusivity and Sports Blackout § 76.123 Satellite syndicated program exclusivity. (a) Upon receiving... station licensed by the Commission, a program carried on a nationally distributed superstation or on a station carried pursuant to § 76.54 of this chapter when the syndicated program exclusivity rights to such...

  20. 7 CFR 4280.123 - Guaranteed loan funding.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND... Efficiency Improvements Program Section B. Guaranteed Loans § 4280.123 Guaranteed loan funding. (a) The... the renewable energy system or energy efficiency improvement. (1) Post-application purchase and...

  1. Transformation and biodegradation of 1,2,3-trichloropropane (TCP)

    NARCIS (Netherlands)

    Samin, Ghufrana; Janssen, Dick B.

    1,2,3-Trichloropropane (TCP) is a persistent groundwater pollutant and a suspected human carcinogen. It is also is an industrial chemical waste that has been formed in large amounts during epichlorohydrin manufacture. In view of the spread of TCP via groundwater and its toxicity, there is a need for

  2. 19 CFR 123.22 - In-transit manifest.

    Science.gov (United States)

    2010-04-01

    ... CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.22 In-transit... cars or other overland carriers transiting Mexico a manifest on Customs Form 7512-B or 7533-C shall be... enter and reenter Canada in a continuing movement en route to a final destination in the United States...

  3. Iofetamine HCl I-123 (Iodoamphetamine) brain SPECT atlas

    International Nuclear Information System (INIS)

    Falls, M.; Park, C.H.; Madsen, M.

    1985-01-01

    SPECT brain imaging using Iofetamine HC1 I-123 (IMP) has a great potential in the evaluation of various neurologic disorders. Transverse, coronal, and sagittal sectional IMP images obtained using a single head rotating gamma camera system are correlated with corresponding normal brain slices in this atlas

  4. 14 CFR 417.123 - Computing systems and software.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 417.123... systems and software. (a) A launch operator must document a system safety process that identifies the... systems and software. (b) A launch operator must identify all safety-critical functions associated with...

  5. 40 CFR 63.123 - Storage vessel provisions-recordkeeping.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS (CONTINUED) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS FOR SOURCE CATEGORIES National Emission Standards for Organic Hazardous Air Pollutants From the Synthetic Organic Chemical Manufacturing Industry for Process Vents, Storage Vessels, Transfer Operations, and Wastewater § 63.123 Storage...

  6. Reducing plant radiation fields by source term reduction - tracking cobalt and antimony to their sources at Gentilly-2

    International Nuclear Information System (INIS)

    Gauthier, P.; Guzonas, D.A.

    2006-01-01

    Gentilly-2 NGS is experiencing high radiation fields in the fuelling machine vaults. These high fields make maintenance outages more expensive and their management more complicated. As part of the station refurbishment project, a task group was created to identify the cause of the high fields and make recommendations to prevent their reoccurrence in the second (post-refurbishment) operating cycle. To identify the root cause of the problem, the task group decided to analyse the primary heat transport system (PHTS), the fuel handling system and their inter-relation. Gentilly-2 has had to manage a unique (to CANDU) problem arising from antimony released from the main heat transport pump seals. Antimony deposits on in-core surfaces, becomes activated, and subsequently can be released, especially under oxidizing coolant conditions. It then becomes incorporated into the magnetite deposits on PHTS piping, including the steam generators and inlet feeders. Gentilly-2 has focused a great deal of effort on managing antimony over the last 15 years. As a result of these initiatives, radioantimony fields have been quite effectively managed since 1997, resulting in a decrease in their relative contribution to the total fields. The decrease in radioantimony fields highlighted the significant contribution of 60 Co cobalt activity; the high levels of both radioantimony and 60 Co differentiate Gentilly-2 from other CANDU 6 plants. Two types of 59 Co sources are present in the CANDU PHTS. High surface area materials such as steam generator tubes and feeder pipes contain trace concentrations of 59 Co as an impurity, which can be released by corrosion. Low surface area materials such as Stellites contain high concentrations of 59 Co that can be released as either corrosion or wear products. After assessing potential cobalt sources, the task group concluded that PHTS materials were not likely the origin of the high 60 Co fields. The major PHTS components identified as cobalt sources have

  7. Elimination of the inter-element interferences of iron, gold, molybdenum, tin and antimony when determined in organic solvents by flame atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Aneva, Zara; Arpadjan, Sonja

    1988-01-01

    The mutual interferences in the flame atomic absorption spectrometric determination of iron, gold, molybdenum, tin and antimony after their extraction - pre-concentration as chloride complexes from platinum solutions into isobutyl methyl ketone are investigated. It is suggested that the interferences are caused by chemical reactions in the flame and are influenced by the flame characteristics. The possibility of eliminating the interferences by addition of long-chain quaternary ammonium salts is discussed. (author)

  8. Structural, optical and electrical properties of copper antimony sulfide thin films grown by a citrate-assisted single chemical bath deposition

    Science.gov (United States)

    Loranca-Ramos, F. E.; Diliegros-Godines, C. J.; Silva González, R.; Pal, Mou

    2018-01-01

    Copper antimony sulfide (CAS) has been proposed as low toxicity and earth abundant absorber materials for thin film photovoltaics due to their suitable optical band gap, high absorption coefficient and p-type electrical conductivity. The present work reports the formation of copper antimony sulfide by chemical bath deposition using sodium citrate as a complexing agent. We show that by tuning the annealing condition, one can obtain either chalcostibite or tetrahedrite phase. However, the main challenge was co-deposition of copper and antimony as ternary sulfides from a single chemical bath due to the distinct chemical behavior of these metals. The as-deposited films were subjected to several trials of thermal treatment using different temperatures and time to find the optimized annealing condition. The films were characterized by different techniques including Raman spectroscopy, X-ray diffraction (XRD), profilometer, scanning electron microscopy (SEM), UV-vis spectrophotometer, and Hall Effect measurements. The results show that the formation of chalcostibite and tetrahedrite phases is highly sensitive to annealing conditions. The electrical properties obtained for the chalcostibite films varied as the annealing temperature increases from 280 to 350 °C: hole concentration (n) = 1017-1018 cm-3, resistivity (ρ) = 1.74-2.14 Ωcm and carrier mobility (μ) = 4.7-9.26 cm2/Vseg. While for the tetrahedrite films, the electrical properties were n = 5 × 1019 cm-3, μ = 18.24 cm2/Vseg, and ρ = 5.8 × 10-3 Ωcm. A possible mechanism for the formation of ternary copper antimony sulfide has also been proposed.

  9. Dopamine transporter density of the basal ganglia assessed with I-123 IPT SPECT in methamphetamine abusers

    International Nuclear Information System (INIS)

    Lee, Joo Ryung; Ahn, Byeong Cheol; Kewm, Do Hun

    2005-01-01

    Functional imaging of dopamine transporter (DAT) defines integrity of the dopaminergic system, and DAT is the target site of drugs of abuse such as cocaine and methamphetamine. Functional imaging the DAT may be a sensitive and selective indicator of neurotoxic change by the drug. The aim of the present study is to evaluate the clinical implications of qualitative/quantitative analyses of dopamine transporter imaging in methamphetamine abusers. Six detoxified methamphetamine abusers (abuser group) and 4 volunteers (control group) were enrolled in this study. Brain MRI was performed in all of abuser group. Abuser group underwent psychiatric and depression assessment using brief psychiatric rating scale (BPRS) and Hamilton depression rating scale (HAMD), respectively. All of the subjects underwent I-123 IPT SPECT (IPT SPECT). IPT SPECT image was analysed with visual qualitative method and quantitative method using basal ganglia dopamine transporter (DAT) specific/non-specific binding ratio (SBR). Comparison of DAT SBR between abuser and control groups was performed. We also performed correlation tests between psychiatric and depression assessment results and DAT SBR in abuser group. All of abuser group showed normal MRI finding, but had residual psychiatric and depressive symptoms, and psychiatric and depressive symptom scores were exactly correlated (r=1.0, ρ =0.005) each other. Five of them showed abnormal finding on qualitative visual I-123 IPT SPECT. Abuser group had lower basal ganglia DAT SBR than that of control (2.38 ± 0.20 vs 3.04 ± 0.27, ρ =0.000). Psychiatric and depressive symptoms were negatively well correlated with basal ganglia DAT SBR (r=-0.908, ρ =0.012, r=-0.924, ρ =0.009) This results suggest that dopamine transporter imaging using I-123 IPT SPECT may be used to evaluate dopaminergic system of the basal ganglia and the clinical status in methamphetamine abusers

  10. Dopamine transporter density of the basal ganglia assessed with I-123 IPT SPECT in methamphetamine abusers

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Joo Ryung; Ahn, Byeong Cheol [Kyungpook National University Medical School, Daegu (Korea, Republic of); Kewm, Do Hun [National Bugok Mental Hospital, Changryung (Korea, Republic of)] (and others)

    2005-10-15

    Functional imaging of dopamine transporter (DAT) defines integrity of the dopaminergic system, and DAT is the target site of drugs of abuse such as cocaine and methamphetamine. Functional imaging the DAT may be a sensitive and selective indicator of neurotoxic change by the drug. The aim of the present study is to evaluate the clinical implications of qualitative/quantitative analyses of dopamine transporter imaging in methamphetamine abusers. Six detoxified methamphetamine abusers (abuser group) and 4 volunteers (control group) were enrolled in this study. Brain MRI was performed in all of abuser group. Abuser group underwent psychiatric and depression assessment using brief psychiatric rating scale (BPRS) and Hamilton depression rating scale (HAMD), respectively. All of the subjects underwent I-123 IPT SPECT (IPT SPECT). IPT SPECT image was analysed with visual qualitative method and quantitative method using basal ganglia dopamine transporter (DAT) specific/non-specific binding ratio (SBR). Comparison of DAT SBR between abuser and control groups was performed. We also performed correlation tests between psychiatric and depression assessment results and DAT SBR in abuser group. All of abuser group showed normal MRI finding, but had residual psychiatric and depressive symptoms, and psychiatric and depressive symptom scores were exactly correlated (r=1.0, {rho} =0.005) each other. Five of them showed abnormal finding on qualitative visual I-123 IPT SPECT. Abuser group had lower basal ganglia DAT SBR than that of control (2.38 {+-} 0.20 vs 3.04 {+-} 0.27, {rho} =0.000). Psychiatric and depressive symptoms were negatively well correlated with basal ganglia DAT SBR (r=-0.908, {rho} =0.012, r=-0.924, {rho} =0.009) This results suggest that dopamine transporter imaging using I-123 IPT SPECT may be used to evaluate dopaminergic system of the basal ganglia and the clinical status in methamphetamine abusers.

  11. Novel 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole derivatives: a patent review (2008 - 2011).

    Science.gov (United States)

    Ferreira, Vitor F; da Rocha, David R; da Silva, Fernando C; Ferreira, Patrícia G; Boechat, Núbia A; Magalhães, Jorge L

    2013-03-01

    The triazoles represent a class of five-membered heterocyclic compounds of great importance for the preparation of new drugs with diverse biological activities because they may present several structural variations with the same numbers of carbon and nitrogen atoms. Due to the success of various triazoles that entered the pharmaceutical market and are still being used in medicines, many companies and research groups have shown interest in developing new methods of synthesis and biological evaluation of potential uses for these compounds. In this review, the authors explored aspects of patents for the 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole families, including prototypes being considered in clinical studies between 2008 and 2011. The triazoles have been studied for over a century as an important class of heterocyclic compounds and still attract considerable attention due to their broad range of biological activities. More recently, there has been considerable interest in the development of novel triazoles with anti-inflammatory, antiplatelet, antimicrobial, antimycobacterial, antitumoral and antiviral properties and activity against several neglected diseases. This review emphasizes recent perspective and advances in the therapeutically active 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole derivative patents between 2008 and 2011, covering the development of new chemical entities and new pharmaceuticals. Many studies have focused on these compounds as target structures and evaluated them in several biological targets. The preparation of 1H-1,2,3-, 2H-1,2,3-, 1H-1,2,4- and 4H-1,2,4-triazole derivatives brings to light several issues. There is a need to find new, more efficient preparations for these triazoles that take into consideration current issues in green chemistry, energy saving and sustainability. New diseases are discovered and new viruses and bacteria continue to challenge mankind, so it is imperative to find new prototypes for these

  12. Synthetic aspects, spectral, thermal studies and antimicrobial screening on bis(N,N-dimethyldithiocarbamato-S,S‧)antimony(III) complexes with oxo or thio donor ligands

    Science.gov (United States)

    Chauhan, H. P. S.; Carpenter, Jaswant; Joshi, Sapana

    2014-09-01

    The bis(N,N-dimethyldithiocarbamato-S,S‧)antimony(III) complexes have been obtained by the reaction of chloro bis(N,N-dimethyldithiocarbamato-S,S‧)antimony(III) with corresponding oxo or thio donor ligands such as sodium benzoate 1, sodium thioglycolate 2, phenol 3, sodium 1-propanethiolate 4, potassium thioacetate 5, sodium salicylate 6, ethane-1,2-dithiolate 7 and disodium oxalate 8. These complexes have been characterized by the physicochemical [melting point, molecular weight determination and elemental analysis (C, H, N, S and Sb)], spectral [UV-Visible, FT-IR, far IR, NMR (1H and 13C)], thermogravimetric (TG & DTA) analysis, ESI-Mass and powder X-ray diffraction studies. Thermogravimetric analysis of the complexes confirmed the final decomposition product as highly pure antimony sulfide (Sb2S3) and powder X-ray diffraction studies show that the complexes are in lower symmetry with monoclinic crystal lattice and nano-ranged particle size (11.51-20.82 nm). The complexes have also been screened against some bacterial and fungal strains for their antibacterial and antifungal activities and compared with standard drugs. These show that the complexes have greater activities against some human pathogenic bacteria and fungi than the activities of standard drugs.

  13. Synthetic aspects, spectral, thermal studies and antimicrobial screening on bis(N,N-dimethyldithiocarbamato-S,S')antimony(III) complexes with oxo or thio donor ligands.

    Science.gov (United States)

    Chauhan, H P S; Carpenter, Jaswant; Joshi, Sapana

    2014-09-15

    The bis(N,N-dimethyldithiocarbamato-S,S')antimony(III) complexes have been obtained by the reaction of chloro bis(N,N-dimethyldithiocarbamato-S,S')antimony(III) with corresponding oxo or thio donor ligands such as sodium benzoate 1, sodium thioglycolate 2, phenol 3, sodium 1-propanethiolate 4, potassium thioacetate 5, sodium salicylate 6, ethane-1,2-dithiolate 7 and disodium oxalate 8. These complexes have been characterized by the physicochemical [melting point, molecular weight determination and elemental analysis (C, H, N, S and Sb)], spectral [UV-Visible, FT-IR, far IR, NMR (1H and 13C)], thermogravimetric (TG & DTA) analysis, ESI-Mass and powder X-ray diffraction studies. Thermogravimetric analysis of the complexes confirmed the final decomposition product as highly pure antimony sulfide (Sb2S3) and powder X-ray diffraction studies show that the complexes are in lower symmetry with monoclinic crystal lattice and nano-ranged particle size (11.51-20.82 nm). The complexes have also been screened against some bacterial and fungal strains for their antibacterial and antifungal activities and compared with standard drugs. These show that the complexes have greater activities against some human pathogenic bacteria and fungi than the activities of standard drugs. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Determination of antimony by electrochemical hydride generation atomic absorption spectrometry in samples with high iron content using chelating resins as on-line removal system

    International Nuclear Information System (INIS)

    Bolea, E.; Arroyo, D.; Laborda, F.; Castillo, J.R.

    2006-01-01

    A method for the removal of the interference caused by iron on electrochemical generation of stibine is proposed. It consists of a chelating resin Chelex 100 column integrated into a flow injection system and coupled to the electrochemical hydride generator quartz tube atomic absorption spectrometer (EcHG-QT-AAS). Iron, as Fe(II), is retained in the column with high efficiency, close to 99.9% under optimal conditions. No significant retention was observed for Sb(III) under same conditions and a 97 ± 5% signal recovery was achieved. An electrochemical hydride generator with a concentric configuration and a reticulated vitreous carbon cathode was employed. The system is able to determine antimony concentrations in the range of ng ml -1 in presence of iron concentrations up to 400 mg l -1 . The procedure was validated by analyzing PACS-2 marine sediments reference material with a 4% (w/w) iron content and a [Fe]:[Sb] ratio of 4000:1, which caused total antimony signal suppression on the electrochemical hydride generation system. A compost sample with high iron content (0.7%, w/w), was also analyzed. A good agreement was found on both samples with the certified value and the antimony concentration determined by ICP-MS, respectively

  15. The use of silver nanoparticles as an effective modifier for the determination of arsenic and antimony by electrothermal atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Gunduz, S., E-mail: semagunduz@itu.edu.t [Istanbul Technical University, Faculty of Science and Letters, Department of Chemistry, 34469, Maslak-Istanbul (Turkey); Akman, S., E-mail: akmans@itu.edu.t [Istanbul Technical University, Faculty of Science and Letters, Department of Chemistry, 34469, Maslak-Istanbul (Turkey); Baysal, A., E-mail: baysalas@itu.edu.t [Istanbul Technical University, Faculty of Science and Letters, Department of Chemistry, 34469, Maslak-Istanbul (Turkey); Kahraman, M., E-mail: mkahraman@yeditepe.edu.t [Yeditepe University, Faculty of Engineering and Architecture, Department of Genetics and Bioengineering, 34755 Kayisdagi-Istanbul (Turkey)

    2010-04-15

    Silver nanoparticles (AgNPs) were proposed as a new chemical modifier for the elimination of interferences when determining arsenic and antimony in aqueous NaCl or Na{sub 2}SO{sub 4} solutions and in sea-water by electrothermal atomic absorption spectrometry. For this purpose, the AgNPs were prepared simply by reducing silver nitrate with sodium citrate. The effects of pyrolysis and atomization temperatures and the amounts of interferents and modifiers on the sensitivities of these elements were investigated. In the presence of the proposed modifier, a pyrolysis temperature of at least 1100 deg. C for arsenic and 900 deg. C for antimony could be applied without the loss of analytes, and the interferences were greatly reduced to allow for interference-free determination. The detection limits (N = 10, 3sigma) for arsenic and antimony were 0.022 ng and 0.046 ng, respectively. AgNPs are cheaper and more available compared to many other modifiers. No background was detected, and the blank values were negligible.

  16. A new cloud point extraction procedure for determination of inorganic antimony species in beverages and biological samples by flame atomic absorption spectrometry.

    Science.gov (United States)

    Altunay, Nail; Gürkan, Ramazan

    2015-05-15

    A new cloud-point extraction (CPE) for the determination of antimony species in biological and beverages samples has been established with flame atomic absorption spectrometry (FAAS). The method is based on the fact that formation of the competitive ion-pairing complex of Sb(III) and Sb(V) with Victoria Pure Blue BO (VPB(+)) at pH 10. The antimony species were individually detected by FAAS. Under the optimized conditions, the calibration range for Sb(V) is 1-250 μg L(-1) with a detection limit of 0.25 μg L(-1) and sensitive enhancement factor of 76.3 while the calibration range for Sb(III) is 10-400 μg L(-1) with a detection limit of 5.15 μg L(-1) and sensitive enhancement factor of 48.3. The precision as a relative standard deviation is in range of 0.24-2.35%. The method was successfully applied to the speciative determination of antimony species in the samples. The validation was verified by analysis of certified reference materials (CRMs). Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. Synthesis and evaluation of [{sup 123}I] iodoquercetin and [{sup 123}I] iodocatechin as radical seeking agents

    Energy Technology Data Exchange (ETDEWEB)

    Park, Bok Nam; Choe, Yearn Seong; Lee, Sang Yoon; Lee, Kyung Han; Choi, Yong; Kim, Sang Eun; Kim, Byung Tae [College of Medicine, Sungkyunkwan Univ., Seoul (Korea, Republic of)

    2001-07-01

    Free radicals are thought to be involved in processes such as central nervous system disorder, cardiovascular injury, inflammation, cancer, aging, and so on. Polyphenols, which are the active ingredients in tea, are known to scavenge various kinds of free radicals. Therefore, radioiodinated quercetin and catechin may help us elucidate relationships between the radicals and the incidence of the diseases. Precursors for radiolabeling were prepared from protection of the hydroxyl groups, iodination and stannylation of quercetin and cetechin. [{sup 123}I]Iodinated quercetin and catechin were prepared by the reaction of the stannylated precursors with Na{sup 123}I in the presence of chloramine-T followed by deprotection. After HPLC purification, ({sup 123}I)iodoquercetin was incubated at 37 .deg. C two sets of mediums containing the unactivated (control) and activated U937 cell lines, respectively. Based on our NMR data, the site of iodination was either at C6 or C8 in the A ring, the latter being more likely. Radiochemical yields of the radiotracers ranged from 30 to 40% and radiochemical purity was greater than 99%. Higher uptake of [{sup 123}I] iodoquercetin was observed in the activated system which is known to generate the hydrogen peroxide and other free radicals, compared to the control (1:4:1). Radioiodinated quercetin and catechin were prepared in high radiochemical yield and showed a distinguishable uptake pattern between control and activated cell systems. Further biological evaluation is currently underway.

  18. Target Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — [Part of the ATLAS user facility.] The Physics Division operates a target development laboratory that produces targets and foils of various thickness and substrates,...

  19. Arsenic and antimony geochemistry of mine wastes, associated waters and sediments at the Giant Mine, Yellowknife, Northwest Territories, Canada

    Science.gov (United States)

    Fawcett, Skya E.; Jamieson, Heather E.; Nordstrom, D. Kirk; McCleskey, R. Blaine

    2015-01-01

    Elevated levels of arsenic (As) and antimony (Sb) in water and sediments are legacy residues found downstream from gold-mining activities at the Giant Mine in Yellowknife, Northwest Territories (NWT), Canada. To track the transport and fate of As and Sb, samples of mine-waste from the mill, and surface water, sediment, pore-water, and vegetation downstream of the mine were collected. Mine waste, pore-water, and sediment samples were analyzed for bulk chemistry, and aqueous and solid-state speciation. Sediment and vegetation chemistry were evaluated using scanning electron microscope imaging, synchrotron-based element mapping and electron microprobe analysis. The distributions of As and Sb in sediments were similar, yet their distributions in the corresponding pore-waters were mostly dissimilar, and the mobility of As was greater than that of Sb. Competition for sorption sites is the most likely cause of elevated Sb concentrations in relatively oxidized pore-water and surface water. The aqueous and solid-state speciation of As and Sb also differed. In pore-water, As(V) dominated in oxidizing environments and As(III) in reducing environments. In contrast, the Sb(V) species dominated in all but one pore-water sample, even under reducing conditions. Antimony(III) appears to preferentially precipitate or adsorb onto sulfides as evidenced by the prevalence of an Sb(III)-S secondary solid-phase and the lack of Sb(III)(aq) in the deeper zones. The As(V)–O solid phase became depleted with depth below the sediment–water interface, and the Sb(V)–O phase persisted under relatively reducing conditions. In the surficial zone at a site populated by Equisetum fluviatile (common horsetail), As and Sb were associated with organic material and appeared mobile in the root zone. In the zone below active plant growth, As and Sb were associated primarily with inorganic phases suggesting a release and reprecipitation of these elements upon plant death. The co-existence of reduced

  20. Collective properties of the odd-mass I nuclei: 123,125,127I

    Science.gov (United States)

    Shroy, R. E.; Gordon, D. M.; Gai, M.; Fossan, D. B.; Gaigalas, A. K.

    1982-09-01

    The high-spin states of 123,125,127I have been investigated via the ASn(6Li, 3n)A+3I reactions to study the collective properties of the odd-mass I isotopes. In-beam measurements of γ-ray excitations, γ-γ coincidences, γ-ray angular distributions, and pulsed beam-γ timing were performed with Ge detectors to determine level energies, decay schemes, γ-ray multipolarities, Jπ assignments, and lifetime information. A similar study of the 117,119,121I isotopes is reported in the following paper. Two collective features have been identified in these odd-mass I nuclei. Systematic ΔJ=1 bands built on low-lying 92+ proton-hole (4p-1h) states were observed. The 92+ bandheads, that involve the excitation of a 1g92 proton across the Z=50 shell, drop to very low energies near the middle of the neutron shell. The properties of the 92+ proton-hole states for all of the odd-mass I isotopes are presented and related to the systematic information for the proton-hole states in the entire Z>50 transition region. Systematic ΔJ=2 bands built on 112- (1h112 quasiproton) states, on 72+ (1g72 quasiproton) states, and on 52+ (2d52 quasiproton) states were also observed. The ΔJ=2 band spacings generally follow the spacings of the Te-core ground-state bands with the exception of the 112- ΔJ=2 bands, for which the spacings decrease significantly relative to those for the Te cores as A decreases. These systematic properties are discussed in terms of several theoretical approaches to the onset of collectivity in transitional nuclei. An isomer at 2660 keV in 123I was observed to have a mean lifetime τ=38+/-3 ns. NUCLEAR REACTIONS 120-124Sn(6Li, 3n)123-127I measured γ-γ coincidences, γ(E, θ, t) deduced level schemes in odd-mass 123-127I, γ multipolarities, Jπ, T12. Enriched targets, Ge(Li) detectors.

  1. Targeted Beverage Taxes Influence Food and Beverage Purchases among Households with Preschool Children123

    Science.gov (United States)

    Ford, Christopher N; Ng, Shu Wen; Popkin, Barry M

    2015-01-01

    Background: How beverage taxes might influence purchases of foods and beverages among households with preschool children is unclear. Thus, we examined the relation between beverage taxes and food and beverage purchases among US households with a child 2–5 y of age. Objectives: We examined how a potential tax on sugar-sweetened beverages (SSBs), or SSBs and >1% fat and/or high-sugar milk, would influence household food and beverage purchases among US households with a preschool child. We aimed to identify the lowest tax rate associated with meaningful changes in purchases. Methods: We used household food and beverage purchase data from households with a single child who participated in the 2009–2012 Nielsen Homescan Panel. A 2-part, multilevel panel model was used to examine the relation between beverage prices and food and beverage purchases. Logistic regression was used in the first part of the model to estimate the probability of a food/beverage being purchased, whereas the second part of the model used log-linear regression to estimate predicted changes in purchases among reporting households. Estimates from both parts were combined, and bootstrapping was performed to obtain corrected SEs. In separate models, prices of SSBs, or SSBs and >1% and/or high-sugar milk, were perturbed by +10%, +15%, and +20%. Predicted changes in food and beverage purchases were compared across models. Results: Price increases of 10%, 15%, and 20% on SSBs were associated with fewer purchases of juice drinks, whereas price increases of 10%, 15%, and 20% simulated on both SSBs plus >1% fat and/or high-sugar milk (combined tax) were associated with fewer kilocalories purchased from >1% fat, low-sugar milk, and meat, poultry, fish, and mixed meat dishes. Conclusions: Our study provides further evidence that a tax on beverages high in sugar and/or fat may be associated with favorable changes in beverage purchases among US households with a preschool child. PMID:26063069

  2. Targeted Beverage Taxes Influence Food and Beverage Purchases among Households with Preschool Children123

    OpenAIRE

    Ford, Christopher N; Ng, Shu Wen; Popkin, Barry M

    2015-01-01

    Background: How beverage taxes might influence purchases of foods and beverages among households with preschool children is unclear. Thus, we examined the relation between beverage taxes and food and beverage purchases among US households with a child 2–5 y of age.

  3. A novel voltammetric sensor based on carbon nanotubes and nanoparticles of antimony tin oxide for the determination of ractopamine.

    Science.gov (United States)

    Baytak, Aysegul Kutluay; Teker, Tugce; Duzmen, Sehriban; Aslanoglu, Mehmet

    2016-02-01

    An electrochemical sensor was prepared by the modification of a glassy carbon electrode (GCE) with carbon nanotubes (CNTs) and nanoparticles of antimony tin oxide (ATO). The surface layer was characterized by scanning electronmicroscopy (SEM), energy dispersive X-ray diffraction method (EDX) and ATR FT-IR spectroscopy. The proposed electrode was assessed in respect to the electro-oxidation of ractopamine. Compared with a bare GCE and a GCE electrode modified with CNTs, the ATONPs/CNTs/GCE exhibited a great catalytic activity towards the oxidation of ractopamine with a well-defined anodic peak at 600 mV. The current response was linear with the concentration of ractopamine over the range from 10 to 240 nM with a detection limit of 3.3 nM. The proposed electrode enabled the selective determination of ractopamine in the presence of high concentrations of ascorbic acid (AA), dopamine (DA) and uric acid (UA). The proposed electrode was successfully applied for the determination of ractopamine in feed and urine samples. The sensitive and selective determination of ractopamine makes the developed method of great interest for monitoring its therapeutic use and doping control purposes.

  4. Therapeutic trial of sodium antimony gluconate alone and in combination with ketoconazole in post-kala-azar dermal leishmaniasis

    Directory of Open Access Journals (Sweden)

    Rathi S

    2003-11-01

    Full Text Available BACKGROUND: Drugs used in PKDL include parenteral sodium antimony gluconate (SAG, amphotericin-B, pentamidine, and ketoconazole (KTZ. SAG is the most effective one. Given alone, SAG has to be given for a long duration, leading to poor patient compliance and treatment failure. This study was carried out to compare the effectiness of SAG alone and a combination of SAG and KTZ for sixty days. METHODS: Ten patients of PKDL were included in the study. Five patients (Group A were given SAG intravenously, in the dose of 20 mg/kg per day and five (Group B were given SAG (intravenously 20 mg/kg per day and KTZ (200 mg twice daily orally. Both treatment regimens were given for sixty days. RESULTS: In Group A, the nodules and/or plaques showed approximate 80-85% clinical improvement, and macules showed 25-30% improvement. In group B (SAG + KTZ, there was 90-95% clinical improvement in the nodules and/or plaques and 25-30% in macules. CONCLUSION: This study suggests the therapeutic superiority of the combination treatment regimen in a shorter duration but is not conclusive as the number of patients was low. Further trials are recommended.

  5. Ultrasound-assisted HCl-NaCl leaching of lead-rich and antimony-rich oxidizing slag.

    Science.gov (United States)

    Zhang, Rong Liang; Zhang, Xiao Fei; Tang, Shu Zhen; Huang, Ai Dong

    2015-11-01

    Lead-rich and antimony-rich oxidizing slag was subjected to regular HCl-NaCl leaching, with the experimental conditions optimized under which ultrasound was introduced. After only 15 min of ultrasound-assisted leaching, the leaching rate of Sb resembled that after 45 min of regular leaching. Ultrasonic treatment considerably elevated the leaching rates of Sb and Pb, and shortened the leaching time. With the decrease of particle size, the leaching rate of Sb and Pb increased gradually. Especially, as the particle size of the slag was greater than 0.217 mm, the ultrasonic leaching effects of Sb and Pb were significantly higher than that of regular leaching effects. The temperature exhibited great effect on ultrasonic leaching performance. As the temperature increased, the leaching rates of Sb and Pb increased step by step. In case the temperature was higher than 85°C, the increasing speed of the leaching rates for Sb and Pb tended to be slow. Increasing ultrasonic power could augment the leaching rate or accelerate the procedure till the same leaching rate. However, since ultrasound failed to energize the formation of new reaction pathways, the maximum leaching rates of Sb and Pb were determined by their phase compositions rather than by ultrasonic field. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Thickness-Dependent Bioelectrochemical and Energy Applications of Thickness-Controlled Meso-Macroporous Antimony-Doped Tin Oxide

    Directory of Open Access Journals (Sweden)

    Daniel Mieritz

    2018-04-01

    Full Text Available Coatings of hierarchically meso-macroporous antimony-doped tin oxide (ATO enable interfacing adsorbed species, such as biomacromolecules, with an electronic circuit. The coating thickness is a limiting factor for the surface coverage of adsorbates, that are electrochemically addressable. To overcome this challenge, a carbon black-based templating method was developed by studying the composition of the template system, and finding the right conditions for self-standing templates, preventing the reaction mixture from flowing out of the mask. The thicknesses of as-fabricated coatings were measured using stylus profilometry to establish a relationship between the mask thickness and the coating thickness. Cyclic voltammetry was performed on coatings with adsorbed cytochrome c to check whether the entire coating thickness was electrochemically addressable. Further, bacterial photosynthetic reaction centers were incorporated into the coatings, and photocurrent with respect to coating thickness was studied. The template mixture required enough of both carbon black and polymer, roughly 7% carbon black and 6% poly(ethylene glycol. Coatings were fabricated with thicknesses approaching 30 µm, and thickness was shown to be controllable up to at least 15 µm. Under the experimental conditions, photocurrent was found to increase linearly with the coating thickness, up to around 12 µm, above which were diminished gains.

  7. Respirable antimony and other trace-elements inside and outside an elementary school in Flagstaff, AZ, USA

    International Nuclear Information System (INIS)

    Majestic, Brian J.; Turner, Joseph A.; Marcotte, Aurelie R.

    2012-01-01

    Because people spend almost 90% of their time indoors, ambient air monitors may severely underestimate actual exposure to atmospheric particulate matter (PM). Therefore, it becomes increasingly important to better understand the microenvironments where people are spending their time. For preadolescent children, the best estimates of exposure may be inside of their school. In this study, 11 size fractions of PM were collected inside and outside of an elementary school in Flagstaff, AZ, USA. In particles −3 — greater than many urban areas around the world. Cu:Sb ratios and size distribution functions suggest that the excess source of PM1 indoor Sb results from the suspension of embedded Sb (used as a flame retardant) in the carpeting. This is the first study to observe elevated submicron Sb in schools and further studies are required to determine if this is a widespread health risk. -- Highlights: ► Atmospheric particulate matter (PM) was collected inside and outside an elementary school. ► Size-resolved trace metal and mass concentrations were measured. ► Indoor / Outdoor ratios of PM mass were very large for particles larger than 1 µm and about unity for particles < 1 µm. ► Most of the metal mass was found to originate from crustal sources. ► Highly elevated levels of antimony were measured – most likely from the resuspension of Sb embedded in carpeting.

  8. Influence of silicon treatment on antimony uptake and translocation in rice genotypes with different radial oxygen loss.

    Science.gov (United States)

    Zhang, Liping; Yang, Qianqian; Wang, Shiliang; Li, Wanting; Jiang, Shaoqing; Liu, Yan

    2017-10-01

    Antimony (Sb) pollution in soil may have a negative impact on the health of people consuming rice. This study investigated the effect of silicon (Si) application on rice biomass, iron plaque formation, and Sb uptake and speciation in rice plants with different radial oxygen loss (ROL) using pot experiments. The results demonstrated that Si addition increased the biomass of straw and grain, but had no obvious impact on the root biomass. Indica genotypes with higher ROL underwent greater iron plaque formation and exhibited more Sb sequestration in iron plaque. Silicon treatments increased iron levels in iron plaque from the different genotypes but decreased the total Sb concentration in root, straw, husk, and grain. In addition, Si treatment reduced the inorganic Sb concentrations but slightly increased the trimethylantimony (TMSb) concentrations in rice straw. Moreover, rice straw from hybrid genotypes accumulated higher concentrations of TMSb and inorganic Sb than that from indica genotypes. The conclusions from this study indicate that Sb contamination in rice can be efficiently reduced by applying Si treatment and selecting genotypes with high ROL. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. Structural and optical changes induced by incorporation of antimony into InAs/GaAs(001) quantum dots

    International Nuclear Information System (INIS)

    Taboada, A. G.; Alonso-Alvarez, D.; Alen, B.; Rivera, A.; Ripalda, J. M.; Llorens, J. M.; Martin-Sanchez, J.; Gonzalez, Y.; Sanchez, A. M.; Beltran, A. M.; Molina, S. I.; Bozkurt, M.; Ulloa, J. M.; Koenraad, P. M.; Garcia, J. M.

    2010-01-01

    We present experimental evidence of Sb incorporation inside InAs/GaAs(001) quantum dots exposed to an antimony flux immediately before capping with GaAs. The Sb composition profile inside the nanostructures as measured by cross-sectional scanning tunneling and electron transmission microscopies show two differentiated regions within the quantum dots, with an Sb rich alloy at the tip of the quantum dots. Atomic force microscopy and transmission electron microscopy micrographs show increased quantum-dot height with Sb flux exposure. The evolution of the reflection high-energy electron-diffraction pattern suggests that the increased height is due to changes in the quantum-dot capping process related to the presence of segregated Sb atoms. These structural and compositional changes result in a shift of the room-temperature photoluminescence emission from 1.26 to 1.36 μm accompanied by an order of magnitude increase in the room-temperature quantum-dot luminescence intensity.

  10. High-throughput combinatorial chemical bath deposition: The case of doping Cu (In, Ga) Se film with antimony

    Science.gov (United States)

    Yan, Zongkai; Zhang, Xiaokun; Li, Guang; Cui, Yuxing; Jiang, Zhaolian; Liu, Wen; Peng, Zhi; Xiang, Yong

    2018-01-01

    The conventional methods for designing and preparing thin film based on wet process remain a challenge due to disadvantages such as time-consuming and ineffective, which hinders the development of novel materials. Herein, we present a high-throughput combinatorial technique for continuous thin film preparation relied on chemical bath deposition (CBD). The method is ideally used to prepare high-throughput combinatorial material library with low decomposition temperatures and high water- or oxygen-sensitivity at relatively high-temperature. To check this system, a Cu(In, Ga)Se (CIGS) thin films library doped with 0-19.04 at.% of antimony (Sb) was taken as an example to evaluate the regulation of varying Sb doping concentration on the grain growth, structure, morphology and electrical properties of CIGS thin film systemically. Combined with the Energy Dispersive Spectrometer (EDS), X-ray Photoelectron Spectroscopy (XPS), automated X-ray Diffraction (XRD) for rapid screening and Localized Electrochemical Impedance Spectroscopy (LEIS), it was confirmed that this combinatorial high-throughput system could be used to identify the composition with the optimal grain orientation growth, microstructure and electrical properties systematically, through accurately monitoring the doping content and material composition. According to the characterization results, a Sb2Se3 quasi-liquid phase promoted CIGS film-growth model has been put forward. In addition to CIGS thin film reported here, the combinatorial CBD also could be applied to the high-throughput screening of other sulfide thin film material systems.

  11. Immunotherapy Using Autoclaved L. Major Antigens and M. Vaccae with Meglumine Antimoniate, for the Treatment of Experimental Canine Visceral Leishmaniasis

    Directory of Open Access Journals (Sweden)

    Sh Jamshidi

    2011-09-01

    Full Text Available Background: To evaluate immunotherapy against canine visceral leishmaniasis, Leishmania ma­jor antigen and heat-killed Mycobacterium vaccae (SRL172 were used as stimulators of immune de­fense mechanisms and the results were compared with standard chemotherapy meglumine antimoni­ate.Methods: Nineteen mongrel dogs aging 1-3 years old were used in this experiment. Infection was carried out in 15 out of 19 dogs using L. infantum, isolated from a naturally infected poly-symptomatic dog.Results: All the cases showed positive serologic results by direct agglutination test during 30-60 days following inoculation. In the first group, which was under chemotherapy (GlucantimeR, one of the members showed recurrence of the disease despite rapid effect of the therapeutic protocol. Im­munotherapy using SRL172 caused complete cleaning of the parasite in group 2, but the speed was less than Glucantime. Immunotherapy using L. major antigen combined with M. vaccae in group 3 and combine administration of immunotherapy and chemotherapy in group 4 both were with relapsing of one case in each group. Group 5 and 6 were consisted of positive and negative con­trol dogs, respectively.Conclusion: Immunotherapy seems to be an adjuvant in treatment of canine leishmaniasis but it needs more investigation for final confirmation.

  12. Influence of arbuscular mycorrhizal fungi on antimony phyto-uptake and compartmentation in vegetables cultivated in urban gardens.

    Science.gov (United States)

    Pierart, Antoine; Dumat, Camille; Maes, Arthur QuyManh; Sejalon-Delmas, Nathalie

    2018-01-01

    1. Urban areas are often contaminated with various forms of persistent metal (loid) and emerging contaminants such as antimony (Sb). Thus, in the context of urban agriculture where sustainable practices such as biofertilizers application (arbuscular mycorrhizal fungi, AMF) could improve nutrient transfer from the soil to the vegetables, the effect of AMF on metal (loid) mobility and human bioaccessibility is still poorly known. 2. The role of AMF in Sb uptake by lettuce and carrot grown in artificial substrate spiked with different Sb chemical species was investigated. Plants were grown under hydroponic conditions and half of the treatments received a concentrated spore solution to obtain mycorrhized and non-mycorrhized plants. Three weeks before harvest, plants were exposed to 10 mg.L -1 of either Sb 2 O 3 or KSbO-tartrate (KSb). 3. The presence of AMF significantly increased its accumulation in carrots (all organs) with higher accumulation in roots. In lettuce, accumulation appeared to be dependent on the Sb chemical species. Moreover, it was observed for the first time that AMF changed the human bioaccessible fraction of Sb in edible organs. 4. The present results highlight a possible risk of Sb transfer from soil to edible plants cultivated in soil naturally containing AMF propagules, or when AMF are added as biofertilizers. After validating the influence of soil environment and AMF on Sb behavior in the field, these results should be considered in health risk assessments. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. 3D Cathodes of Cupric Oxide Nanosheets Coated onto Macroporous Antimony-Doped Tin Oxide for Photoelectrochemical Water Splitting.

    Science.gov (United States)

    Wang, Xu-Dong; Xu, Yang-Fan; Chen, Bai-Xue; Zhou, Ning; Chen, Hong-Yan; Kuang, Dai-Bin; Su, Cheng-Yong

    2016-10-20

    Cupric oxide (CuO), a narrow-bandgap semiconductor, has a band alignment that makes it an ideal photocathode for the renewable production of solar fuels. However, the photoelectrochemical performance of CuO is limited by its poor conductivity and short electron diffusion lengths. Herein, a three-dimensional (3D) architecture consisting of CuO nanosheets supported onto transparent conducting macroporous antimony-doped tin oxide (mpATO@CuONSs) is designed as an excellent photocathode for promoting the hydrogen evolution reaction (HER). Owing to the 3D structure affording superior light-harvesting characteristics, large contact areas with the electrolyte, and highly conductive pathways for separation and transport of charge carriers, the mpATO@CuONSs photocathode produces an impressively high photocurrent density of -4.6 mA cm -2 at 0 V versus the reversible hydrogen electrode (RHE), which is much higher than that of the CuONSs array onto planar FTO glass (-1.9 mA cm -2 ). © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Investigation of physico-mechanical properties of flexible poly (vinyl chloride) filled with antimony trioxide using ionizing radiation.

    Science.gov (United States)

    Elnaggar, Mona Y; Fathy, E S; Hassan, Medhat M

    2018-04-12

    Composites of polyvinyl chloride (PVC) with 2% calcium carbonate, 2% diethyl phthalate, 2% paraffin wax and 2% lead sulphate and different contents of antimony trioxide (Sb 2 O 3 ) prepared by melting and irradiated with gamma ray have been considered. Assessment of the mechanical and thermal properties of the unirradiated and irradiated flexible polyvinyl chloride (FPVC) were completed utilizing elasticity (TS), Elongation at break (Eb) and thermogravimetric analysis measurements. TS and thermal stability of FPVC displayed advanced improvement after addition of additives and this approach highlighted the efficiency of those ingredients on PVC. The compounding of FPVC with Sb 2 O 3 in various extents was examined by FTIR, X-ray diffraction and scanning electron microscope methods. It is obvious that the presence of Sb 2 O 3 begins impacting oxidative degradation, leading to a decrease in mechanical properties up to 10%. Moreover, a slight increase in the thermal stability of composites by exposure to ionizing radiation is apparently due to cross-linking of FPVC chains.

  15. Kinetic modeling of pH-dependent antimony (V) sorption and transport in iron oxide-coated sand.

    Science.gov (United States)

    Cai, Yongbing; Li, Lulu; Zhang, Hua

    2015-11-01

    Understanding the mechanisms and kinetics controlling the retention and transport of antimony (Sb) is prerequisite for evaluating the risk of groundwater contamination by the toxic element. In this study, kinetic batch and saturated miscible displacement experiments were performed to investigate effects of protonation-deprotonation reactions on sorption-desorption and transport of Sb(V) in iron oxide-coated sand (IOCS). Results clearly demonstrated that Sb(V) sorption was highly nonlinear and time dependent, where both sorption capacity and kinetic rates decreased with increasing solution pH. Breakthrough curves (BTCs) obtained at different solution pH exhibited that mobility of Sb(V) were higher under neutral to alkaline condition than under acidic condition. Because of the nonlinear and non-equilibrium nature of Sb(V) retention and transport, multi-reaction models (MRM) with equilibrium and kinetic sorption expressions were utilized successfully to simulate the experiment data. Equilibrium distribution coefficient (Ke) and reversible kinetic retention parameters (k1 and k2) of both kinetic sorption and transport experiment showed marked decrease as pH increased from 4.0 to 7.5. Surface complexation is suggested as the dominant mechanism for the observed pH-dependent phenomena, which need to be incorporated into the kinetic models to accurately simulate the reactive transport of Sb(V) in vadose zone and aquifers. Copyright © 2015. Published by Elsevier Ltd.

  16. Effects of storage temperature and time of antimony release from PET bottles into drinking water in China.

    Science.gov (United States)

    Qiao, Fei; Lei, Kun; Li, Zicheng; Liu, Qing; Wei, Zhanliang; An, Lihui; Qi, Hongli; Cui, Song

    2018-01-01

    Antimony (Sb) concentrations were measured in 10 brands of PET bottled drinking water available in supermarkets in China. To simulate general storage habits based on market research, these PET bottles with drinking water were stored for 4 weeks in a lab or a car trunk during the summer. Although the PET package material of brand A had the lowest Sb level (142.71 ± 29.81 μg/g), it showed a significant increase in Sb concentrations when stored in both the car trunk and the lab. There was significant release of Sb from the PET bottles into the water following 24 h of incubation at ≥ 40 °C (40, 50, 60, and 70 °C), especially at 70 °C. The potential health risk of Sb release from PET bottles was calculated based on daily intake values and determined to be acceptable for consumers under normal storage conditions.

  17. FACTORS ASSOCIATED TO ADHERENCE TO DIFFERENT TREATMENT SCHEMES WITH MEGLUMINE ANTIMONIATE IN A CLINICAL TRIAL FOR CUTANEOUS LEISHMANIASIS

    Directory of Open Access Journals (Sweden)

    Madelon Novato Ribeiro

    2014-07-01

    Full Text Available The favorable outcome of the treatment of a disease is influenced by the adherence to therapy. Our objective was to assess factors associated with adherence to treatment of patients included in a clinical trial of equivalence between the standard and alternative treatment schemes with meglumine antimoniate (MA in the treatment of cutaneous leishmaniasis (CL, in the state of Rio de Janeiro. Between 2008 and 2011, 57 patients with CL were interviewed using a questionnaire to collect socioeconomic data. The following methods were used for adherence monitoring: counting of vial surplus, monitoring card, Morisky test and modified Morisky test (without the question regarding the schedule; we observed 82.1% (vial return, 86.0% (monitoring card, 66.7% (Morisky test and 86.0% (modified Morisky test adherence. There was a strong correlation between the method of vial counting and the monitoring card and modified Morisky test. A significant association was observed between greater adherence to treatment and low dose of MA, as well as with a lower number of people sleeping in the same room. We recommend the use of the modified Morisky test to assess adherence to treatment of CL with MA, because it is a simple method and with a good performance, when compared to other methods.

  18. 19 CFR 123.28 - Merchandise remaining in or exported to Canada or Mexico.

    Science.gov (United States)

    2010-04-01

    ... Mexico. 123.28 Section 123.28 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.28 Merchandise remaining in or exported to Canada or Mexico. (a) In-transit status...

  19. 19 CFR 123.26 - Transshipment of merchandise moving through Canada or Mexico.

    Science.gov (United States)

    2010-04-01

    ... or Mexico. 123.26 Section 123.26 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.26 Transshipment of merchandise moving through Canada or Mexico. (a...

  20. 9 CFR 354.123 - Segregation of suspects on ante-mortem inspection.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Segregation of suspects on ante-mortem inspection. 354.123 Section 354.123 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... Inspection Procedures; Ante-Mortem Inspections § 354.123 Segregation of suspects on ante-mortem inspection...

  1. 7 CFR 400.123 - Request for review of the indebtedness.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Request for review of the indebtedness. 400.123 Section 400.123 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL CROP...-Regulations for the 1986 and Succeeding Crop Years § 400.123 Request for review of the indebtedness. (a...

  2. Novel seeds applicable for mass processing of LRE-123 single-grain bulks

    Czech Academy of Sciences Publication Activity Database

    Muralidhar, M.; Suzuki, K.; Ishihara, A.; Jirsa, Miloš; Fukumoto, .Y.; Tomita, M.

    2010-01-01

    Roč. 23, č. 12 (2010), 124003/1-124003/8 ISSN 0953-2048 Institutional research plan: CEZ:AV0Z10100520 Keywords : batch processing * Gd-123 * LRE-123 * Nd-123 thin film seed Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.402, year: 2010

  3. Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle

    International Nuclear Information System (INIS)

    Bomanji, J.; Britton, K.E.

    1987-01-01

    Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context

  4. Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle

    Energy Technology Data Exchange (ETDEWEB)

    Bomanji, J.; Britton, K.E.

    1987-08-01

    Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context.

  5. 13 CFR 123.508 - How can you use Military Reservist EIDL funds?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How can you use Military Reservist EIDL funds? 123.508 Section 123.508 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Military Reservist Economic Injury Disaster Loans § 123.508 How can you use Military...

  6. 13 CFR 123.506 - How much can you borrow under the Military Reservist EIDL Program?

    Science.gov (United States)

    2010-01-01

    ... Military Reservist EIDL Program? 123.506 Section 123.506 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Military Reservist Economic Injury Disaster Loans § 123.506 How much can you borrow under the Military Reservist EIDL Program? You can borrow an amount equal to the substantial...

  7. 13 CFR 123.512 - What is the interest rate on a Military Reservist EIDL?

    Science.gov (United States)

    2010-01-01

    ... Military Reservist EIDL? 123.512 Section 123.512 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Military Reservist Economic Injury Disaster Loans § 123.512 What is the interest rate on a Military Reservist EIDL? The interest rate on a Military Reservist EIDL will be 4...

  8. Standardization of I-123-meta-iodobenzylguanidine myocardial sympathetic activity imaging: phantom calibration and clinical applications

    NARCIS (Netherlands)

    Nakajima, Kenichi; Verschure, Derk O.; Okuda, Koichi; Verberne, Hein J.

    2017-01-01

    Purpose Myocardial sympathetic imaging with I-123-meta-iodobenzylguanidine (I-123-mIBG) has gained clinical momentum. Although the need for standardization of I-123-mIBG myocardial uptake has been recognized, the availability of practical clinical standardization approaches is limited. The need for

  9. 31 CFR 12.3 - Sale of tobacco products in vending machines prohibited.

    Science.gov (United States)

    2010-07-01

    ... machines prohibited. 12.3 Section 12.3 Money and Finance: Treasury Office of the Secretary of the Treasury RESTRICTION OF SALE AND DISTRIBUTION OF TOBACCO PRODUCTS § 12.3 Sale of tobacco products in vending machines prohibited. The sale of tobacco products in vending machines located in or around any Federal building under...

  10. 40 CFR 81.123 - Southeastern Oklahoma Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... Quality Control Region. 81.123 Section 81.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.123 Southeastern Oklahoma Intrastate Air Quality Control Region. The Southeastern Oklahoma Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

  11. 30 CFR 250.123 - Will MMS allow gas storage on unleased lands?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Will MMS allow gas storage on unleased lands? 250.123 Section 250.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... § 250.123 Will MMS allow gas storage on unleased lands? You may not store gas on unleased lands unless...

  12. 34 CFR 97.123 - Early termination of research support: Evaluation of applications and proposals.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Early termination of research support: Evaluation of applications and proposals. 97.123 Section 97.123 Education Office of the Secretary, Department of Education... Protection of Human Research Subjects) § 97.123 Early termination of research support: Evaluation of...

  13. 40 CFR 90.123 - Denial, revocation of certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... conformity. 90.123 Section 90.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Emission Standards and Certification Provisions § 90.123 Denial, revocation of certificate of conformity... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...

  14. 40 CFR 91.123 - Denial, revocation of certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... conformity. 91.123 Section 91.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Certification Provisions § 91.123 Denial, revocation of certificate of conformity. (a) If, after review of the... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...

  15. 21 CFR 133.123 - Cold-pack and club cheese.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cold-pack and club cheese. 133.123 Section 133.123... FOR HUMAN CONSUMPTION CHEESES AND RELATED CHEESE PRODUCTS Requirements for Specific Standardized Cheese and Related Products § 133.123 Cold-pack and club cheese. (a)(1) Cold-pack cheese, club cheese, is...

  16. 19 CFR 123.61 - Baggage arriving in baggage car.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Baggage arriving in baggage car. 123.61 Section... car. An inward foreign manifest on Customs Form 7533 shall be used for all baggage arriving in baggage cars. [T.D. 70-121, 35 FR 8215, May 26, 1970, as amended by T.D. 82-145, 47 FR 35478, Aug. 16, 1982] ...

  17. Clinical application of l-123 MlBG cardiac imaging

    International Nuclear Information System (INIS)

    Kang, Do Young

    2004-01-01

    Cardiac neurotransmission imaging allows in vivo assessment of presynaptic reuptake, neurotransmitter storage and postsynaptic receptors. Among the various neurotransmitter, I-123 MlBG is most available and relatively well-established. Metaiodobenzylguanidine (MIBG) is an analogue of the false neurotransmitter guanethidine. It is taken up to adrenergic neurons by uptake-1 mechanism as same as norepinephrine. As tagged with I-123, it can be used to image sympathetic function in various organs including heart with planar or SPECT techniques. I-123 MIBG imaging has a unique advantage to evaluate myocardial neuronal activity in which the heart has no significant structural abnormality or even no functional derangement measured with other conventional examination. In patients with cardiomyopathy and heart failure, this imaging has most sensitive technique to predict prognosis and treatment response of betablocker or ACE inhibitor. In diabetic patients, it allow very early detection of autonomic neuropathy. In patients with dangerous arrhythmia such as ventricular tachycardia or fibrillation, MIBG imaging may be only an abnormal result among various exams. In patients with ischemic heart disease, sympathetic derangement may be used as the method of risk stratification. In heart transplanted patients, sympathetic reinnervation is well evaluated. Adriamycin-induced cardiotoxicity is detected earlier than ventricular dysfunction with sympathetic dysfunction. Neurodegenerative disorder such as Parkinson's disease or dementia with Lewy bodies has also cardiac sympathetic dysfunction. Noninvasive assessment of cardiac sympathetic nerve activity with l-123 MlBG imaging may be improve understanding of the pathophysiology of cardiac disease and make a contribution to predict survival and therapy efficacy

  18. Reversible magnetization of melt-processed NEG-123 superconductor

    Czech Academy of Sciences Publication Activity Database

    Jirsa, Miloš; Rameš, Michal; Muralidhar, M.; Kacmarcik, J.; Marcenat, C.

    2010-01-01

    Roč. 118, č. 5 (2010), 1022-1023 ISSN 0587-4246. [Czech and Slovak Conference on Magnetism /14./. Košice, 06.07.2010-09.07.2010] R&D Projects: GA MŠk(CZ) ME10069 Institutional research plan: CEZ:AV0Z10100520 Keywords : electronic specific heat * NEG-123 * high-Tc superconductor s * thermodynamic characteristics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.467, year: 2010

  19. Clinical application of l-123 MlBG cardiac imaging

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Do Young [College of Medicine, Donga Univ., Busan (Korea, Republic of)

    2004-10-01

    Cardiac neurotransmission imaging allows in vivo assessment of presynaptic reuptake, neurotransmitter storage and postsynaptic receptors. Among the various neurotransmitter, I-123 MlBG is most available and relatively well-established. Metaiodobenzylguanidine (MIBG) is an analogue of the false neurotransmitter guanethidine. It is taken up to adrenergic neurons by uptake-1 mechanism as same as norepinephrine. As tagged with I-123, it can be used to image sympathetic function in various organs including heart with planar or SPECT techniques. I-123 MIBG imaging has a unique advantage to evaluate myocardial neuronal activity in which the heart has no significant structural abnormality or even no functional derangement measured with other conventional examination. In patients with cardiomyopathy and heart failure, this imaging has most sensitive technique to predict prognosis and treatment response of betablocker or ACE inhibitor. In diabetic patients, it allow very early detection of autonomic neuropathy. In patients with dangerous arrhythmia such as ventricular tachycardia or fibrillation, MIBG imaging may be only an abnormal result among various exams. In patients with ischemic heart disease, sympathetic derangement may be used as the method of risk stratification. In heart transplanted patients, sympathetic reinnervation is well evaluated. Adriamycin-induced cardiotoxicity is detected earlier than ventricular dysfunction with sympathetic dysfunction. Neurodegenerative disorder such as Parkinson's disease or dementia with Lewy bodies has also cardiac sympathetic dysfunction. Noninvasive assessment of cardiac sympathetic nerve activity with l-123 MlBG imaging may be improve understanding of the pathophysiology of cardiac disease and make a contribution to predict survival and therapy efficacy.

  20. Detection of deep vein thrombosis with I-123 plasminogen

    International Nuclear Information System (INIS)

    Smal, F.; Schonne, E.; Mahieu, P.; Verhas, M.; Schoutens, A.

    1982-01-01

    An experience with I-123 plasminogen used to investigate patients with clinically suspected deep vein thrombosis is reported. The test is efficient, not invasive and produces no discomfort on the contrary to venography. The test is not sensitive to heparine therapy since 5 thrombosis were detected in patients under heparine. Certain false positive results such as those due to Erysipelas can be foreseen by careful clinical investigation. False negative cases were due to very old thrombi or superficial thrombosis without clinical consequences

  1. SPECT quantification of 123I - and - CIT in Parkinsonism

    International Nuclear Information System (INIS)

    Larcos, G.; Shaffi, M.; Hutton, B.F.; Hatton, R.; Kyme, A.; Fung, V.S.C.; Morris, J.G.L.

    2002-01-01

    Full text: Evaluation of presynaptic dopaminergic function using 2B-carboxymethoxy-3B-(4-[ 123 I] iodophenyl) tropane ( 123 I-and-CIT) SPECT has employed subjective or semi-quantitative methods. Our hypothesis is that disease classification in Parkinsonism may be improved by partial volume correction and co-registration with MRI. We studied seven patients (pts) with IPD (four men, three women, mean age=54.5+/-10.9 yrs; Hoehn and Yahr stage range 1-3; Schwab and England scale range: 30-100 [mean=67.1+/-26.9]) and two controls with 123 I- - CIT using 110-150 MBq and a dual-head camera equipped with fan-beam collimation. SPECT was registered to MRI and then aligned to a reference template. Specific to non-specific dopaminergic binding (UR) was calculated for the putamen and caudate nucleus, as well as the fractional volume (FV; fraction of the Structure affected) and residual uptake ratio (RUR; count density in area/remnant apparently unaffected by disease). Parameters that were statistically significant were the putamen (p; but not caudate) UR, FV and RUR. We conclude that: (a) it is possible to distinguish dopaminergic activity within the putamen from caudate using MRI image co-registration and (b) parameters other than UR may discriminate IPD from normal subjects and other entities. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc

  2. Iodine 123 radiolabeling of monoclonal antibodies for in vivo procedures

    International Nuclear Information System (INIS)

    Mills, S.L.; Denardo, S.J.; Denardo, G.L.; Epstein, A.L.; Peng, J.S.; Colcher, D.

    1986-01-01

    When labeled to monoclonal antibodies (MAbs) or their fragments, 123 I can be used for imaging or for predicting the treatment potential and radiation dosimetry of 131 I labeled to the same molecular species. Because 123 I (p,5n) from the Crocker Nuclear Laboratory is in dilute solution, when compared with commercial 125 I of labeling grade, we have evaluated labeling parameters using Chloramine-T as the oxidant and derived an optimum set of labeling conditions that provide a 60-80% radiochemical yield of highly immunoreactive antibody. When Lym-1, an IgG-2a murine antibody against human lymphoma, was used, yields of labeled immunoglobulin were decreased by protein or Chloramine-T concentrations less than 0.4 microgram/microliter and 0.8 microgram/microliter, respectively; denaturation of the immunoglobulin occurred when the Chloramine-T concentration was greater than 1.0 microgram/microliter. Optimum labeling occurred at pH 7-8 with deleterious effects when the pH was below 5 or above 10. An optimum method for labeling antibodies with multimillicurie amounts of 123 I (less than one iodine atom per 100 antibody molecules) is described. Some of the observations derived from this study are also applicable to the preparation of treatment doses of 131 I-labeled antibodies, wherein the amount of antibody can be a restrictive factor

  3. Iodine 123-antipyrine. A diffusible tracer for brain exploration

    International Nuclear Information System (INIS)

    Dantonel-Mathieu, Evelyne.

    1978-09-01

    Iodine 123-labelled iodoantipyrine is a liposoluble diffusible tracer which crosses the blood-brain barrier intact. Its build-up in brain tissue is proportional to the regional blood flow. Its behavior was studied in undervascularised brain lesions and in cases where research with traditional radioactive tracers (99mTc and its different vectors for example) has proved limited. Because of the great diffusibility of iodoantipyrine a brain parenchyma image is obtained within minutes after its injection, and this by the use of a non-invasive technique and under good gamma-camera exploration conditions. 81 brain explorations including 11 standards have been carried out on subjects averaging 51,2 years old; these examinations took place in three nuclear medicine centres. The 123 I iodoantipyrine used in each nuclear medicine centre is supplied by the CEA. Iodoantipyrine is labelled with a good yield (>98%) checked by chromatography by means of a CEA kit. After intraveinous injection of 4 to 6 mCi iodine-123 iodoantipyrine, a dynamic study (from 0 to 60 seconds) of the tracer passage in the brain tissue may be followed by static images taken in the next minutes according to a standard procedure. The table of results shows the major interest of this tracer for the exploration of vascular accidents with ischemic lesions, especially in the early phase of the accident. The lesion appears as a hypoactive zone and this lack of perfusion lasts for some minutes after the injection [fr

  4. 76 FR 32081 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2011-06-03

    ... Ethylbenzene 3200 5 1,2,3-trichloropropane 5 Phenolics 22999 Antimony 6 Surface Water: Styrene 1400... sampling parameters were ethylbenzene, styrene, 1,2,3-trichloropropane, antimony, and phenolics, as well as...

  5. Study of important parameters on the irradiation of 124Xe, to improve the production of 123I with high purity using the Cyclone-30 cyclotron at IPEN-CNEN/SP

    International Nuclear Information System (INIS)

    Sumiya, Luiz Carlos do Amaral

    2006-01-01

    The development of diagnosis equipment and therapy procedures in nuclear medicine depends on the availability of commercial radioisotopes. IPEN is the most important institution that provides radioisotopes for national market. In order to achieve this function, IPEN had invested in the acquisition of a 30 MeV Cyclone-30 cyclotron to produce mainly 18 F, 67 Ga, 201 Tl and 123 I. The 123 I production is the aim of the present work. With the 123 I routine production data obtained by proton irradiation of Xe targets with an enrichment greater than 99.8%, it was possible to identify the important parameters that have direct influence on the production yield of high purity degree 123 I. Even though the methodology for the commercial production of 123 I, there are an scarcity of operational parameters data for this task. In this work the evaluated parameters were: 124 Xe pressure, proton beam quality, irradiation time, operational temperature of the irradiation system under irradiation, waiting time to obtain 123 I, temperature of washing solution and the impact of the internal Ni coating in the target. With the obtained results it was possible to modify the operational conditions for routine production and increasing the efficiency in about 30%. (author)

  6. The oxygen sensitivity of a multipoint antimony electrode for tissue pH measurements. A study of the sensitivity for in vivo PO2 variations below 6 kPa.

    Science.gov (United States)

    Sjöberg, F; Edwall, G; Lund, N

    1987-02-01

    Monocrystalline micro antimony electrodes in a multipoint arrangement as described by Lund et al. were placed on the skeletal muscle surface of the rabbit. Tissue oxygen levels were measured simultaneously with the MDO (Mehrdraht Dortmund Oberfläche) oxygen electrode. The sensitivity for variations in tissue PO2 (PO2(t)) was evaluated for the antimony metal-metal oxide sensor. The sensitivity (delta E/delta log10 PO2)+/- SE was found to be 21.8 +/- 1.2 mV in the interval between 0.1 kPa and 1 kPa and 53 +/- 5 mV in the interval between 1 kPa and 6 kPa. These results are not consistent with the oxygen sensitivity of monocrystalline antimony described in vitro, but are in agreement with the findings of Nilsson & Edwall. A plausible explanation for the S-shaped oxygen sensitivity curve of antimony at oxygen levels below 10 kPa could be an interaction, at the electrode surface, between the dissolved oxygen and the oxygen bound to haemoglobin. If this is the case, the use of an antimony electrode would make possible the determination of the dissociation of oxyhaemoglobin in tissues.

  7. Imaging active lymphocytic infiltration in coeliac disease with iodine-123-interleukin-2 and the response to diet

    Energy Technology Data Exchange (ETDEWEB)

    Signore, A.; Chianelli, M.; Annovazzi, A.; Rossi, M.; Greco, M.; Ronga, G.; Picarelli, A. [Nuclear Medicine Unit (Nu.M.E.D. Group) and Gastroenterology Unit, Department of Clinical Sciences, University of Rome ' ' La Sapienza' ' (Italy); Maiuri, L. [Inst. of Paediatrics, Children' s Hospital Posilipon, University ' ' Federico II' ' , Naples (Italy); Britton, K.E. [Dept. of Nuclear Medicine, St. Bartholomew' s Hospital, London (United Kingdom)

    2000-01-01

    Coeliac disease is diagnosed by the presence of specific antibodies and a jejunal biopsy showing mucosal atrophy and mononuclear cell infiltration. Mucosal cell-mediated immune response is considered the central event in the pathogenesis of coeliac disease, and untreated coeliac patients show specific features of T-cell activation in the small intestine. Here we describe the use of iodine-123-interleukin-2 scintigraphy in coeliac patients as a non-invasive tool for detection of lymphocytic infiltration in the small bowel and its use for therapy follow-up, and we demonstrate the specificity of binding of labelled-IL2 to activated lymphocytes by ex-vivo autoradiography of jejunal biopsies. {sup 123}I-IL2 was administered i.v. [74 MBq (2 mCi)], and gamma camera images were acquired after 1 h. Ten patients were studied with {sup 123}I-IL2 scintigraphy at diagnosis and seven were also investigated after 12-19 months of gluten-free diet. Results were expressed as target-to-background radioactivity ratios in six different bowel regions before and after the diet. At the time of diagnosis all patients showed a significantly higher bowel uptake of {sup 123}I-IL2 than normal subjects (P<0.003 in all regions). A significant correlation was found between jejunal radioactivity and the number of IL2R+ve lymphocytes per millimetre of jejunal mucosa as detected by immunostaining of jejunal biopsy (r{sup 2}=0.66; P=0.008). Autoradiography of jejunal biopsies confirmed that labelled-IL2 only binds to activated T-lymphocytes infiltrating the gut mucosa. After 1 year of the diet, bowel uptake of {sup 123}I-IL2 significantly decreased in five out of six regions (P<0.03), although two patients still had a positive IL2 scintigraphy in one region. We conclude that {sup 123}I-IL2 scintigraphy is a sensitive non-invasive technique for assessing in vivo the presence of activated mononuclear cells in the bowel of patients affected by coeliac disease. Unlike jejunal biopsy, this method provides

  8. Development of I-123-labeled amines for brain studies: localization of I-123 iodophenylalkyl amines in rat brain

    International Nuclear Information System (INIS)

    Winchell, H.S.; Baldwin, R.M.; Lin, T.H.

    1980-01-01

    Localization in rat brain of forty iodophenylalkyl amines labeled with I-123 was evaluated in an attempt to develop I-123-labeled amines useful for brain studies. For the amines studied, the highest activity in brain and the brain-to-blood activity ratios ranked p > m > o as related to iodine position on the benzene ring: for alkyl groups the rank order was α-methylethyl > ethyl > methyl > none; for N additions it was single lipophilic group > H > two lipophilic groups. It is suggested that introduction of a halogen into the ring structure of many amines results in greater concentration of the agent in brain than is seen with the nonhalogenated parent compound. The agent N-isopropyl-p-iodoamphetamine was chosen for further study because, in the rat, it showed high brain activity (1.57%/g) and brain-blood ratio (12.6) at 5 min

  9. Variability in Heart-to-Mediastinum Ratio from Planar123I-MIBG Images of a Thorax Phantom for 6 Common γ-Camera Models.

    Science.gov (United States)

    Owenius, Rikard; Zanette, Michelle; Cella, Patrick

    2017-12-01

    A heart-to-mediastinum (H/M) ratio of 1.6 or greater on planar 123 I-iobenguane ( 123 I-MIBG) images identifies heart failure patients at low risk of experiencing an adverse cardiac event. This phase-4 study used standardized phantoms to assess the intercamera, intracamera, and interhead variability in H/M ratio determinations from planar cardiac 123 I-MIBG imaging using commercially available, dual-head γ-cameras. Methods: A fillable thorax phantom was developed to simulate the typical uptake of 123 I-MIBG. The phantom had a nominal H/M ratio of 1.6 on the reference camera. Commercial cameras used in the study were dual-head and capable of 90° configuration for cardiac imaging. The target sample size was 8 units (examples) per camera model. Two imaging technologists independently analyzed planar images of simulated 123 I-MIBG uptake from the thorax phantom. H/M was the ratio of the average counts per pixel of the heart and mediastinum regions of interest. The primary endpoint, intercamera variability in H/M ratio from head 1, was determined for each camera model via comparison with the H/M ratio on the reference camera. Only cameras with at least 8 units tested ( n ≥ 8) were included in the primary analysis. Intracamera and interhead variability in the H/M ratio were also evaluated. Results: Nine camera models were studied. The mean H/M ratio ranged from 1.342 to 1.677. The primary analysis (6 camera models) using a mixed-model, repeated-measures analysis showed no significant difference in H/M ratio between any camera model and the reference camera. Intracamera variability (head 1) in the H/M ratio among camera models with 8 units or more was high, with SDs ranging from 0.0455 to 0.1193. Interhead variability was low (SDs of the interhead difference, 0.017-0.074). Conclusion: Commonly used γ-cameras produced H/M ratios from simulated 123 I-MIBG phantom images that were not significantly different from those on the reference camera. This finding indicates

  10. Translation initiation requires cell division cycle 123 (Cdc123) to facilitate biogenesis of the eukaryotic initiation factor 2 (eIF2).

    Science.gov (United States)

    Perzlmaier, Angelika F; Richter, Frank; Seufert, Wolfgang

    2013-07-26

    The eukaryotic translation initiation factor 2 (eIF2) is central to the onset of protein synthesis and its modulation in response to physiological demands. eIF2, a heterotrimeric G-protein, is activated by guanine nucleotide exchange to deliver the initiator methionyl-tRNA to the ribosome. Here we report that assembly of the eIF2 complex in vivo depends on Cdc123, a cell proliferation protein conserved among eukaryotes. Mutations of CDC123 in budding yeast reduced the association of eIF2 subunits, diminished polysome levels, and increased GCN4 expression indicating that Cdc123 is critical for eIF2 activity. Cdc123 bound the unassembled eIF2γ subunit, but not the eIF2 complex, and the C-terminal domain III region of eIF2γ was both necessary and sufficient for Cdc123 binding. Alterations of the binding site revealed a strict correlation between Cdc123 binding, the biological function of eIF2γ, and its ability to assemble with eIF2α and eIF2β. Interestingly, high levels of Cdc123 neutralized the assembly defect and restored the biological function of an eIF2γ mutant. Moreover, the combined overexpression of eIF2 subunits rescued an otherwise inviable cdc123 deletion mutant. Thus, Cdc123 is a specific eIF2 assembly factor indispensable for the onset of protein synthesis. Human Cdc123 is encoded by a disease risk locus, and, therefore, eIF2 biogenesis control by Cdc123 may prove relevant for normal cell physiology and human health. This work identifies a novel step in the eukaryotic translation initiation pathway and assigns a biochemical function to a protein that is essential for growth and viability of eukaryotic cells.

  11. A Novel Dopamine Transporter Inhibitor CE-123 Improves Cognitive Flexibility and Maintains Impulsivity in Healthy Male Rats

    Directory of Open Access Journals (Sweden)

    Agnieszka Nikiforuk

    2017-11-01

    Full Text Available Reduced cognitive abilities are often characterized by an impairment of flexibility, i.e., the ability to switch from learned rules or categories that were important in certain contexts to different new modalities that rule the task. Drugs targeting the dopamine transporter (DAT are widely used for their potential to enhance cognitive abilities. However, commercially available drugs are of limited specificity for DAT, blocking also noradrenaline and serotonine transporters, that can lead to unwanted side effects in healthy subjects. Therefore, we tested a newly synthetized compound (CE-123 with higher specificity for DAT in male rats in an attentional set-shifting task (ASST, that proves for cognitive flexibility and a 5-choice serial-reaction time task (5-CSRTT assessing visuospatial attention and impulsivity. Treated rats at a dose of 0.3 and 1.0 but not 0.1 mg/kg bodyweight showed reduced extra-dimensional shifts in the ASST compared to controls indicating increased cognitive flexibility. Rats treated with R-Modafinil, a commercially available DAT inhibitor at a dose of 10 mg/kg bodyweight showed increased premature responses, an indicator of increased impulsivity, during a 10 s but not a 2.5, 5, or 7.5 s intertrial interval when compared to vehicle-treated rats in the 5-CSRTT. This was not found in rats treated with CE-123 at the same dose as for R-Modafinil. Visuospatial attention, except premature responses, did not differ between R-Modafinil and CE-123-treated rats and their respective controls. Thus, CE-123 increased cognitive flexibility with diminished impulsivity.

  12. Assessment of cerebral benzodiazepine receptor distribution in anxiety disorders by 123I-iomazenil-SPECT. Comparison to cerebral perfusion scintigraphy by 123I-IMP

    International Nuclear Information System (INIS)

    Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji

    1997-01-01

    123 I-Iomazenil ( 123 I-IMZ) and 123 I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On 123 I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on 123 I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower 123 I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of 123 I-IMZ, negative correlation (R 123 I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)

  13. A novel voltammetric sensor based on carbon nanotubes and nanoparticles of antimony tin oxide for the determination of ractopamine

    Energy Technology Data Exchange (ETDEWEB)

    Baytak, Aysegul Kutluay; Teker, Tugce; Duzmen, Sehriban; Aslanoglu, Mehmet, E-mail: maslanoglu@harran.edu.tr

    2016-02-01

    An electrochemical sensor was prepared by the modification of a glassy carbon electrode (GCE) with carbon nanotubes (CNTs) and nanoparticles of antimony tin oxide (ATO). The surface layer was characterized by scanning electron microscopy (SEM), energy dispersive X-ray diffraction method (EDX) and ATR FT-IR spectroscopy. The proposed electrode was assessed in respect to the electro-oxidation of ractopamine. Compared with a bare GCE and a GCE electrode modified with CNTs, the ATONPs/CNTs/GCE exhibited a great catalytic activity towards the oxidation of ractopamine with a well-defined anodic peak at 600 mV. The current response was linear with the concentration of ractopamine over the range from 10 to 240 nM with a detection limit of 3.3 nM. The proposed electrode enabled the selective determination of ractopamine in the presence of high concentrations of ascorbic acid (AA), dopamine (DA) and uric acid (UA). The proposed electrode was successfully applied for the determination of ractopamine in feed and urine samples. The sensitive and selective determination of ractopamine makes the developed method of great interest for monitoring its therapeutic use and doping control purposes. - Highlights: • A novel voltammetric sensor was prepared using nanoparticles of ATO and CNTs. • The ATONPs/CNTs/GCE has greatly improved the voltammetry of ractopamine. • The proposed electrode enabled a detection limit of 3.3 nM. • AA, DA and UA did not interfere with the selective detection of ractopamine. • Measurements were precise and accurate.

  14. Eficácia do sulfato de aminosidine na leishmaniose visceral grave, resistente ao tratamento com antimonial pentavalente

    Directory of Open Access Journals (Sweden)

    Cleudson Castro

    1995-09-01

    Full Text Available Descreve-se um caso de calazar grave resistente a dez cursos de antimonial petitavalente (glucantime à base de 20mg de Sb5/kg/dia, que respondeu favoravelmente ao sulfato de aminosidine intramuscular na dose de 20mg/kg/dia por 20 dias, repetido após 20 dias. O parasitismo esplénico passou de 50 parasitos por campo a 3 parasitos em 10 campos logo após a primeira série de sulfato de aminosidine, tornando-se negativo depois de sete meses. A melhora clínica foi imediata, com redução gradual da hepatoesplenomegalia, e desaparecimento 26 meses após. Neste período aumentou 13 kg. Após o uso de aminosidine a reação de Monténégro tornou-se positiva e as células mononucleares responderam quando estimuladas com antígenos de leishmânia.A grave kala-azar infection in a 14 years old boy is described. The leishmanial infection failed to respond to ten interrupted courses of glucantime of variable duration (14-56 days at a dose of 20mg Sb5/kg/day. However a favorable response ocurred to intramuscular aminosidine sulphate (20mg/kg/day for 20 days. This same regimen was repeated 20 days later. After the first treatment splenic puncture parasite density fell from 50 amastigotes per oil immersion field to 3 amastigotes in 10 fields. A further splenic puncture 7 months after treatment was negative. The marked hepatoesplenomegaly gradually resolved over 26 months follow up and he gained 13 kilogramas in weight. After aminosidine sulphate therapy his Montenegro reaction become positive and his lymphocytes responded to leishmania antigens.

  15. Microbial degradation of high impact polystyrene (HIPS), an e-plastic with decabromodiphenyl oxide and antimony trioxide

    International Nuclear Information System (INIS)

    Sekhar, Vini C.; Nampoothiri, K. Madhavan; Mohan, Arya J.; Nair, Nimisha R.; Bhaskar, Thallada; Pandey, Ashok

    2016-01-01

    Highlights: • Biodegradation of a high impact polystyrene e − plastic. • 12.4% (w/w) e plastic film lost using an isolate, Enterobacter sp. • Noted changes in the physico-chemical characteristics of degraded e-plastic film. • Polystyrene intermediates were detected in the degradation medium. • e-plastic degrading microbes displayed extracellular depolymerase activity. - Abstract: Accumulation of electronic waste has increased catastrophically and out of that various plastic resins constitute one of the leading thrown out materials in the electronic machinery. Enrichment medium, containing high impact polystyrene (HIPS) with decabromodiphenyl oxide and antimony trioxide as sole carbon source, was used to isolate microbial cultures. The viability of these cultures in the e-plastic containing mineral medium was further confirmed by triphenyl tetrazolium chloride (TTC) reduction test. Four cultures were identified by 16S rRNA sequencing as Enterobacter sp., Citrobacter sedlakii, Alcaligenes sp. and Brevundimonas diminuta. Biodegradation experiments were carried out in flask level and gelatin supplementation (0.1% w/v) along with HIPS had increased the degradation rate to a maximum of 12.4% (w/w) within 30 days. This is the first report for this kind of material. The comparison of FTIR, NMR, and TGA analysis of original and degraded e-plastic films revealed structural changes under microbial treatment. Polystyrene degradation intermediates in the culture supernatant were also detected using HPLC analysis. The gravity of biodegradation was validated by morphological changes under scanning electron microscope. All isolates displayed depolymerase activity to substantiate enzymatic degradation of e-plastic.

  16. Microbial degradation of high impact polystyrene (HIPS), an e-plastic with decabromodiphenyl oxide and antimony trioxide

    Energy Technology Data Exchange (ETDEWEB)

    Sekhar, Vini C. [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India); Nampoothiri, K. Madhavan, E-mail: madhavan85@hotmail.com [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India); Mohan, Arya J.; Nair, Nimisha R. [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India); Bhaskar, Thallada [Bio-Fuels Division (BFD), CSIR-Indian Institute of Petroleum (IIP), Dehradun, Uttarakhand 248005 (India); Pandey, Ashok [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India)

    2016-11-15

    Highlights: • Biodegradation of a high impact polystyrene e − plastic. • 12.4% (w/w) e plastic film lost using an isolate, Enterobacter sp. • Noted changes in the physico-chemical characteristics of degraded e-plastic film. • Polystyrene intermediates were detected in the degradation medium. • e-plastic degrading microbes displayed extracellular depolymerase activity. - Abstract: Accumulation of electronic waste has increased catastrophically and out of that various plastic resins constitute one of the leading thrown out materials in the electronic machinery. Enrichment medium, containing high impact polystyrene (HIPS) with decabromodiphenyl oxide and antimony trioxide as sole carbon source, was used to isolate microbial cultures. The viability of these cultures in the e-plastic containing mineral medium was further confirmed by triphenyl tetrazolium chloride (TTC) reduction test. Four cultures were identified by 16S rRNA sequencing as Enterobacter sp., Citrobacter sedlakii, Alcaligenes sp. and Brevundimonas diminuta. Biodegradation experiments were carried out in flask level and gelatin supplementation (0.1% w/v) along with HIPS had increased the degradation rate to a maximum of 12.4% (w/w) within 30 days. This is the first report for this kind of material. The comparison of FTIR, NMR, and TGA analysis of original and degraded e-plastic films revealed structural changes under microbial treatment. Polystyrene degradation intermediates in the culture supernatant were also detected using HPLC analysis. The gravity of biodegradation was validated by morphological changes under scanning electron microscope. All isolates displayed depolymerase activity to substantiate enzymatic degradation of e-plastic.

  17. Mine waste acidic potential and distribution of antimony and arsenic in waters of the Xikuangshan mine, China

    International Nuclear Information System (INIS)

    Zhou, Jianwei; Nyirenda, Mathews T.; Xie, Lina; Li, Yi; Zhou, Baolong; Zhu, Yue; Liu, Huilin

    2017-01-01

    The Xikuangshan (XKS) mine in China has vast quantities of waste material and reported antimony (Sb) and arsenic (As) contamination of water in the mine area. This study estimated the potential of acid mine drainage (AMD) generation by waste material at XKS mine by using paste pH, acid base accounting and net acid generation geochemical static tests. Distribution of Sb and As in surface and groundwater in relation to mine waste AMD producing potential was also investigated. Thirty four (34) water samples and representative samples of three mine wastes from different periods (fresh, 10 and 50 years) were collected for this study: waste rock, smelting slag and tailings. The AMD prediction shows that waste rock (from 10 year period) is acid producing while the fresh mine waste had alkaline paste pH indicating the presence of reactive carbonates. Hence AMD generation may have occurred after a long time due to dissolution of carbonates. Water analysis found Sb with higher concentration than As with means of 3.74 mg/L and 0.19 mg/L respectively. Highest Sb and As concentrations were observed in the North mine along the water flow path from waste heaps and tailing pond; Mine water in the South mine also had elevated Sb and As concentrations. Mining activities at the XKS mine have accelerated Sb and As releases because of the disturbed natural equilibrium. Proper mine waste management and collection and treatment of outflow from the waste rock heaps and tailing ponds seem to be a promising mitigation options. - Highlights: • High levels of Sb and As were detected in alkaline water at Xikuangshan mine. • Static test showed that mine waste aged over 10 years was acid generating. • Mine waste influenced the high concentration of Sb and As in water. • The Sb/As ratios in water favored Sb because of high Sb content in the ore body.

  18. Imipramine is an orally active drug against both antimony sensitive and resistant Leishmania donovani clinical isolates in experimental infection.

    Directory of Open Access Journals (Sweden)

    Sandip Mukherjee

    Full Text Available BACKGROUND: In an endeavor to find an orally active and affordable antileishmanial drug, we tested the efficacy of a cationic amphiphilic drug, imipramine, commonly used for the treatment of depression in humans. The only available orally active antileishmanial drug is miltefosine with long half life and teratogenic potential limits patient compliance. Thus there is a genuine need for an orally active antileishmanial drug. Previously it was shown that imipramine, a tricyclic antidepressant alters the protonmotive force in promastigotes, but its in vivo efficacy was not reported. METHODOLOGY/PRINCIPAL FINDINGS: Here we show that the drug is highly active against antimony sensitive and resistant Leishmania donovani in both promastigotes and intracellular amastigotes and in LD infected hamster model. The drug was found to decrease the mitochondrial transmembrane potential of Leishmania donovani (LD promastigotes and purified amastigotes after 8 h of treatment, whereas miltefosine effected only a marginal change even after 24 h. The drug restores defective antigen presenting ability of the parasitized macrophages. The status of the host protective factors TNF α, IFN γ and iNOS activity increased with the concomitant decrease in IL 10 and TGF β level in imipramine treated infected hamsters and evolution of matured sterile hepatic granuloma. The 10-day therapeutic window as a monotherapy, showing about 90% clearance of organ parasites in infected hamsters regardless of their SSG sensitivity. CONCLUSIONS: This study showed that imipramine possibly qualifies for a new use of an old drug and can be used as an effective orally active drug for the treatment of Kala-azar.

  19. A novel voltammetric sensor based on carbon nanotubes and nanoparticles of antimony tin oxide for the determination of ractopamine

    International Nuclear Information System (INIS)

    Baytak, Aysegul Kutluay; Teker, Tugce; Duzmen, Sehriban; Aslanoglu, Mehmet

    2016-01-01

    An electrochemical sensor was prepared by the modification of a glassy carbon electrode (GCE) with carbon nanotubes (CNTs) and nanoparticles of antimony tin oxide (ATO). The surface layer was characterized by scanning electron microscopy (SEM), energy dispersive X-ray diffraction method (EDX) and ATR FT-IR spectroscopy. The proposed electrode was assessed in respect to the electro-oxidation of ractopamine. Compared with a bare GCE and a GCE electrode modified with CNTs, the ATONPs/CNTs/GCE exhibited a great catalytic activity towards the oxidation of ractopamine with a well-defined anodic peak at 600 mV. The current response was linear with the concentration of ractopamine over the range from 10 to 240 nM with a detection limit of 3.3 nM. The proposed electrode enabled the selective determination of ractopamine in the presence of high concentrations of ascorbic acid (AA), dopamine (DA) and uric acid (UA). The proposed electrode was successfully applied for the determination of ractopamine in feed and urine samples. The sensitive and selective determination of ractopamine makes the developed method of great interest for monitoring its therapeutic use and doping control purposes. - Highlights: • A novel voltammetric sensor was prepared using nanoparticles of ATO and CNTs. • The ATONPs/CNTs/GCE has greatly improved the voltammetry of ractopamine. • The proposed electrode enabled a detection limit of 3.3 nM. • AA, DA and UA did not interfere with the selective detection of ractopamine. • Measurements were precise and accurate.

  20. Antimony doped tin oxides and their composites with tin pyrophosphates as catalyst supports for oxygen evolution reaction in proton exchange membrane water electrolysis

    DEFF Research Database (Denmark)

    Xu, Junyuan; Li, Qingfeng; Hansen, Martin Kalmar

    2012-01-01

    based on tin pyrophosphates as the catalyst support. The materials showed an overall conductivity of 0.57 S cm−1 at 130 °C under the water vapor atmosphere with a contribution of the proton conduction. Using this composite support, iridium oxide nanoparticle catalysts were prepared and characterized......Proton exchange membrane water electrolysers operating at typically 80 °C or at further elevated temperatures suffer from insufficient catalyst activity and durability. In this work, antimony doped tin oxide nanoparticles were synthesized and further doped with an inorganic proton conducting phase...

  1. Double blind, randomized controlled trial, to evaluate the effectiveness of a controlled nitric oxide releasing patch versus meglumine antimoniate in the treatment of cutaneous leishmaniasis [NCT00317629

    Directory of Open Access Journals (Sweden)

    Silva Federico A

    2006-05-01

    Full Text Available Abstract Background Cutaneous Leishmaniasis is a worldwide disease, endemic in 88 countries, that has shown an increasing incidence over the last two decades. So far, pentavalent antimony compounds have been considered the treatment of choice, with a percentage of cure of about 85%. However, the high efficacy of these drugs is counteracted by their many disadvantages and adverse events. Previous studies have shown nitric oxide to be a potential alternative treatment when administered topically with no serious adverse events. However, due to the unstable nitric oxide release, the topical donors needed to be applied frequently, making the adherence to the treatment difficult. The electrospinning technique has allowed the production of a multilayer transdermal patch that produces a continuous and stable nitric oxide release. The main objective of this study is to evaluate this novel nitric oxide topical donor for the treatment of cutaneous leishmaniasis. Methods and design A double-blind, randomized, double-masked, placebo-controlled clinical trial, including 620 patients from endemic areas for Leishmaniasis in Colombia was designed to investigate whether this patch is as effective as meglumine antimoniate for the treatment of cutaneous leishmaniasis but with less adverse events. Subjects with ulcers characteristic of cutaneous leishmaniasis will be medically evaluated and laboratory tests and parasitological confirmation performed. After checking the inclusion/exclusion criteria, the patients will be randomly assigned to one of two groups. During 20 days Group 1 will receive simultaneously meglumine antimoniate and placebo of nitric oxide patches while Group 2 will receive placebo of meglumine antimoniate and active nitric oxide patches. During the treatment visits, the medications will be daily administered and the presence of adverse events assessed. During the follow-up, the research group will visit the patients at days 21, 45, 90 and 180. The

  2. Design of a Flow-Through Voltammetric Sensor Based on an Antimony-Modified Silver Electrode for Determining Lithol Rubine B in Cosmetics

    OpenAIRE

    Lai-Hao, Wang; Shu-Juan, Huang

    2011-01-01

    Lithol Rubine B (LRB; the disodium salt of 3-hydroxy-4-[(4-methyl-2-sulfophenyl) azo]-2-naphthalenecarboxylic acid) was detected using high-performance liquid chromatography with an electrochemical (antimony film on silver) detector (HPLC-ECD). For direct current (DC) mode, with the current at a constant potential, and measurements with suitable experimental parameters, a linear concentration from 0.125 to 1.80 μg/mL was found. The detection limit of our method was approximately 2.0 ng/mL. An...

  3. Antimony in the soil-water-plant system at the Su Suergiu abandoned mine (Sardinia, Italy): strategies to mitigate contamination.

    Science.gov (United States)

    Cidu, Rosa; Biddau, Riccardo; Dore, Elisabetta; Vacca, Andrea; Marini, Luigi

    2014-11-01

    This study was aimed to implement the understanding of the Sb behavior in near-surface environments, as a contribution to address appropriate mitigation actions at contaminated sites. For this purpose, geochemical data of soil (8 sites), water (29 sites), and plant (12 sites) samples were collected. The study area is located at Su Suergiu and surroundings in Sardinia (Italy), an abandoned mine area heavily contaminated with Sb, with relevant impact on water bodies that supply water for agriculture and domestic uses. Antimony in the soil horizons ranged from 19 to 4400 mg kg(-1), with highest concentrations in soils located close to the mining-related wastes, and concentrations in the topsoil much higher than in the bedrock. The Sb readily available fraction was about 2% of the total Sb in the soil. Antimony in the pore water ranged from 23 to 1700 μg L(-1), with highest values in the Sb-rich soils. The waters showed neutral to slightly alkaline pH, redox potential values indicating oxidizing conditions, electrical conductivity in the range of 0.2 to 3.7 mS cm(-1), and dissolved organic carbon ≤2 mg L(-1). The waters collected upstream of the mine have Ca-bicarbonate dominant composition, and median concentration of Sb(tot) of 1.7 μg L(-1) (that is total antimony determined in waters filtered through 0.45 μm), a value relatively high as compared with the background value (≤0.5 μg L(-1) Sb) estimated for Sardinian waters, but below the limits established by the European Union and the World Health Organization for drinking water (5 μg L(-1) Sb and 20 μg L(-1) Sb, respectively). The waters flowing in the mine area are characterized by Ca-sulfate dominant composition, and median concentrations of 7000 μg L(-1) Sb(tot). Extreme concentrations, up to 30,000 μg L(-1) Sb(tot), were observed in waters flowing out of the slag materials derived from the processing of Sb-ore. The Sb(III) was in the range of 0.8 to 760 μg L(-1) and represented up to 6% of Sb

  4. Multiple endocrine neoplasia detection on I-123 MIBG imaging

    International Nuclear Information System (INIS)

    Reinhardt, C.A.; McEwan, L.M.; Wong, J.C.H.

    2000-01-01

    Full text: An 123 I meta-iodobenzylguanidine (MIBG) scan was performed on a 54-year-old lady with familial phaeochromocytoma, to evaluate for bilateral or extra-adrenal disease. She has hypertension with raised catecholamines and CT evidence of a right adrenal phaeochromocytoma, and a female sibling with bilateral phaeochromocytoma. Thyroid blockade using Lugol's Iodine was given orally prior to intravenous administration of 370 MBq 123 I MIBG. Planar and SPECT imaging were acquired at 24 hours. There was intense uptake in the known right phaeochromocytoma. An unexpected finding was focal intense uptake in the region of the right thyroid lobe, which may be either a functioning paraganglioma arising from the cervical sympathetic ganglia or a medullary thyroid carcinoma (MTC). At 48 hours, a further image of the neck showed no changes. This was followed by a standard injection of 150 MBq 99 Tc m pertechnetate for thyroid scanning. Imaging obtained on 99 Tc m energy window setting showed a large hypofunctioning region in the right thyroid lobe, corresponding in location to the focal 123 I MIBG uptake. This is in keeping with a MTC, a neuroendocrine tumour, as other thyroid carcinomas are non-MIBG avid. A subsequent serum calcitonin assay showed elevated levels. The patient underwent surgical removal of the right phaeochromocytoma followed several weeks later by a right hemithyroidectomy. Histological reports confirmed the tumour diagnoses. The patient's familial phaeochromocytoma is therefore part of the multiple endocrine neoplasia syndrome Type 2A (MEN 2A). To date, biochemistry has not shown any evidence of hyperparathyroidism which occurs in 15-20 per cent of patients with MEN 2A. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

  5. 1-123 iodoamphetamine SPECT findings in paranoid schizophrenia

    International Nuclear Information System (INIS)

    Simon, T.R.; Walker, B.S.; Matthieson, S.; Miller, C.D.; Raese, J.

    1989-01-01

    To find out if frontal metabolic and cerebral blood flow differ between normal subjects and patients with paranoid schizophrenia (PAR), the authors have examined regional synaptic amine metabolism. Using [I- 123]iodoamphetamine (IMP), the authors compared 85 subjects (61 PAR patients and 24 normal subjects) with single-head single-photon emission CT (SPECT). Virtually automatic analysis assigned relative tracer uptake to the frontal, anterior temporoparietal (TP), and posterior TP regions. Consistent with the visual inspection of two clinicians familiar with SPECT IMP images, this objective method yielded T-tests that showed higher relative frontal lobe ratios in normal subjects than in PAR patients (P =.03)

  6. Transformation and biodegradation of 1,2,3-trichloropropane (TCP)

    OpenAIRE

    Samin, Ghufrana; Janssen, Dick B.

    2012-01-01

    Purpose 1,2,3-Trichloropropane (TCP) is a persistent groundwater pollutant and a suspected human carcinogen. It is also is an industrial chemical waste that has been formed in large amounts during epichlorohydrin manufacture. In view of the spread of TCP via groundwater and its toxicity, there is a need for cheap and efficient technologies for the cleanup of TCP-contaminated sites. In situ or on-site bioremediation of TCP is an option if biodegradation can be achieved and stimulated. This pap...

  7. Clinical evaluation of 123I-IMP SPECT in patients with various neurological diseases

    International Nuclear Information System (INIS)

    Yoneda, Naoto

    1993-01-01

    Single photon emission computed tomography with N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP SPECT) was performed in 57 patients with various neurological disease, and compared with the findings of brain CT, MRI, and EEG. The author also evaluated the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack after treatment with antiepileptic drugs in idiopathic epileptic patients. Abnormality of accumulation of 123 I-IMP SPECT was observed in 62.3% of all cases. Focal abnormality was detected in 28.3% of all cases by brain CT and 54.1% by MRI. The detectability of focal abnormality in brain CT and MRI was found to be lower than that of 123 I-TMP SPECT. There was very little significance in detectability between 123 I-IMP SPECT and EEG. But it infers that 123 I-IMP SPECT can detect the subictal state in epileptic patients. One comparative study of the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack by antiepileptic drugs in patients with idiopathic epilepsy, abnormality of 123 I-IMP SPECT findings was found to be higher in patients who were not controlled sufficiently than in patients who were controlled sufficiently, and a significant difference is found by X 2 test. 123 I-IMP SPECT is useful for the evaluation of treatment in patients with epilepsy. (author)

  8. Brain SPECT with 123I-isopropyl amphetamine in epilepsy

    International Nuclear Information System (INIS)

    Biersack, H.J.; Reske, S.N.; Rasche, A.; Reichmann, K.; Winkler, C.

    1983-01-01

    Ten patients were studied with N-isopropyl I-123 p-iodoamphetamine. Single photon emission computed tomography (SPECT) was carried out by hand of a rotating gamma camera system (Gammatome T9000/CGR, high resolution collimator). During 1 rotation (360 0 ) 64 frames (4k matrix) were acquired within 20 min 1 hour after injection of 6.5 mCi I-123 labeled amphetamine. The content of I-124 was less than 2%. After reconstruction of transverse slices coronar and sagittal reconstructions were rapidly performed using an array processor. Nine patients suffered from epilepsy and one from severe migraine. Excellent differentiation between gray and white matter of the cerebral cortex and the basal ganglia was evident in all of the cases. In 2 out of 3 patients with epilepsy and negative CT results SPECT revealed circumscribed areas with increased amphetamine uptake in accordance with the EEG findings. In 4 out of 6 cases with positive CT findings SPECT lesions with diminished amphetamine uptake could be established. One patient with severe migraine showed focal increased amphetamine uptake in accordance with the respective clinical results. (orig.)

  9. Long Gd-123 coated conductor by PLD method

    International Nuclear Information System (INIS)

    Fuji, H.; Igarashi, M.; Hanada, Y.; Miura, T.; Hanyu, S.; Kakimoto, K.; Iijima, Y.; Saitoh, T.

    2008-01-01

    We have developed long Gd-123 coated conductors by ion-beam-assisted deposition (IBAD) and pulsed-laser-deposition (PLD) method. Recently, large-scale reel-to-reel apparatus with the 110 cm x 15 cm assisting ion source was introduced to IBAD system. It was enable to produce 500 m-class IBAD-Gd 2 Zr 2 O 7 (GZO) tapes with Δφ of below 15 deg. and high throughputs of 3 m/h. Furthermore, apparatus with multi-lane and laser scanning was introduced to PLD system. As a result, end to end I c of 318 A were obtained for a 201.5 m long tape, and I c x L values were 64,077 Am. Furthermore, 500 m-class deposition was carried out by improving PLD conditions. As a result, I c x L values of 112,166 Am was obtained and it's a world record on August 2007. In the short samples, I c of over 500 A was obtained with Gd-123 thickness of 2.0 μm and over 100 A was obtained in magnetic field of 3 T, perpendicular to c-axis

  10. Medicinal attributes of 1,2,3-triazoles: Current developments.

    Science.gov (United States)

    Dheer, Divya; Singh, Virender; Shankar, Ravi

    2017-04-01

    1,2,3-Triazoles are important five-membered heterocyclic scaffold due to their extensive biological activities. This framework can be readily obtained in good to excellent yields on the multigram scale through click chemistry via reaction of aryl/alkyl halides, alkynes and NaN 3 under ambient conditions. It has been an emerging area of interest for many researchers throughout the globe owing to its immense pharmacological scope. The present work aims to summarize the current approaches adopted for the synthesis of the 1,2,3-triazole and medicinal significance of these architectures as a lead structure for the discovery of drug molecules such as COX-1/COX-2 inhibitors (celecoxib, pyrazofurin), HIV protease inhibitors, CB1 cannabinoid receptor antagonist and much more which are in the pipeline of clinical trials. The emphasis has been given on the major advancements in the medicinal prospectus of this pharmacophore for the period during 2008-2016. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Suppression of superconductivity in GdPr-123 system

    International Nuclear Information System (INIS)

    Akhavan, M.; Yamani, Z.

    1997-01-01

    Fourteen single phase polycrystalline ceramic Gd/sub 1-x/ Pr/sub x/ Ba/sub 2/, Cu/sub 3/ O/sub 7-y/ (Gd Pr-123) samples with different Pr doping concentration, x, have been prepared by the standard sintering technique and characterized by FXRD, SEM, TGA, and DT. The electrical resistivity measurements show that at X/sub cr/ = 0.45 superconductivity disappears. These data show that the T/sub c/(x) curve has two plate aux which appear at a 0-0.05 and x = 0.15-0.25. hence T/sub c/ (x) in this system does not follow the prediction of the Abrijkosov- Gorkov (AG) magnetic pair breaking theory. Based on the qualitative similarities among the physical properties of this system and the oxygen depleted RBa/sub 2/Cu/sub 3/O/sub 7-y/ (R-123) (R:Y or rare earth except Ce, Pr, Tb, Pm) system, such as T/sub c/(x) to T/sub c/(y) rho (T,x) to rho (T,y), we suggest that the increasing band filling and localization of states due to the disorder effects, together with Pr doping, could cause an 'effective' increasing of the oxygen deficiency in this system. This implies that a chain-plain correlation (CPC) effect is responsible for the high-T/sub c/ superconductivity. (author)

  12. Ultra-low carrier concentration and surface-dominant transport in antimony-doped Bi2Se3 topological insulator nanoribbons

    KAUST Repository

    Hong, Seung Sae

    2012-03-27

    A topological insulator is the state of quantum matter possessing gapless spin-locking surface states across the bulk band gap, which has created new opportunities from novel electronics to energy conversion. However, the large concentration of bulk residual carriers has been a major challenge for revealing the property of the topological surface state by electron transport measurements. Here we report the surface-state-dominant transport in antimony-doped, zinc oxide-encapsulated Bi2Se3 nanoribbons with suppressed bulk electron concentration. In the nanoribbon with sub-10-nm thickness protected by a zinc oxide layer, we position the Fermi levels of the top and bottom surfaces near the Dirac point by electrostatic gating, achieving extremely low two-dimensional carrier concentration of 2×10 11cm-2. The zinc oxide-capped, antimony-doped Bi 2Se3 nanostructures provide an attractive materials platform to study fundamental physics in topological insulators, as well as future applications. © 2012 Macmillan Publishers Limited. All rights reserved.

  13. Comparative acute toxicity of gallium(III, antimony(III, indium(III, cadmium(II, and copper(II on freshwater swamp shrimp (Macrobrachium nipponense

    Directory of Open Access Journals (Sweden)

    Jen-Lee Yang

    2014-01-01

    Full Text Available BACKGROUND: Acute toxicity testing were carried out the freshwater swamp shrimp, Macrobrachium nipponense, as the model animal for the semiconductor applied metals (gallium, antimony, indium, cadmium, and copper to evaluate if the species is an suitable experimental animal of pollution in aquatic ecosystem. RESULTS: The static renewal test method of acute lethal concentrations determination was used, and water temperature was maintained at 24.0 ± 0.5°C. Data of individual metal obtained from acute toxicity tests were determined using probit analysis method. The median lethal concentration (96-h LC50 of gallium, antimony, indium, cadmium, and copper for M. nipponense were estimated as 2.7742, 1.9626, 6.8938, 0.0539, and 0.0313 mg/L, respectively. CONCLUSIONS: Comparing the toxicity tolerance of M. nipponense with other species which exposed to these metals, it is obviously that the M. nipponense is more sensitive than that of various other aquatic animals.

  14. Impact of temperature and storage time on the migration of antimony from polyethylene terephthalate (PET) containers into bottled water in Qatar.

    Science.gov (United States)

    Al-Otoum, Fatima; Al-Ghouti, Mohammad A; Costa, Ozeas S; Khraisheh, Majeda

    2017-11-12

    Prosperity in Qatar and the consequent stresses on water resources resulted in a sustainable increase in the bottled drinking water market. Reports on health concerns and possible migration of chemicals from the plastic material into the water have driven the current investigation. This study aims to address the extent of antimony (Sb) leaching from polyethylene terephthalate (PET) water bottles subject to temperature variations (24-50 °C) due to Qatar's hot climate and improper storage conditions. A representative basket including 66 different imported and locally produced water bottles was considered. The concentrations of Sb in bottled water ranged from 0.168 to 2.263 μg/L at 24 °C and from 0.240 to 6.110 μg/L at 50 °C. Antimony concentrations in PET bottles at 24 °C was significantly lower than those at 50 °C (p = 0.0142), indicating that the temperature was a principal factor affecting the release of Sb from the plastic into the water. Although the detected Sb amounts were below the guidelines endorsed by WHO and Qatar (standard 5 μg/L) at 24 °C, the concentration measured at 50 °C was higher than the recommended WHO values (6.11 μg/L).

  15. Oral bioavailability of arsenic, antimony and a selection of metals in ashes; Oral biotillgaenglighet av arsenik, antimon och ett urval av metaller i askor

    Energy Technology Data Exchange (ETDEWEB)

    Carlsson, Christel; Bendz, David; Jones, Celia

    2008-06-15

    In an earlier study, financed by Varmeforsk, 'Q4-238 Environmental guidelines for reuse of ash in civil engineering applications', the total content of arsenic and lead was shown to determine whether or not reuse of some of the ashes in construction work is feasible. The model used to calculate the guidelines uses the total concentration of metals to evaluate the health risks resulting from exposure to the ashes. The use of total concentration can lead to overly conservative risk assessments if a significant fraction of the total metal content is not bioavailable. Better precision in the risk assessment can be given by the use of the bioavailable fraction of arsenic and lead in the model. As a result, ashes which are rejected on the basis of total metal concentration may be acceptable for use in engineering construction when the assessment is based on the bioavailable fraction. The purpose of the study was to (i) compile information on the oral bioavailability of arsenic, antimony and a selection of metals in ashes and similar materials, and on in vitro methods for determination of oral bioavailability, and (ii) experimentally estimate oral bioavailability of arsenic, antimony and some metals in a selection of ashes by analysis of the gastrointestinal bioaccessibility of these elements. The investigated elements were antimony, arsenic, lead, cadmium, copper, chromium, nickel and zinc. In the literature study performed within the project a number of static and dynamic in vitro methods simulating gastrointestinal processes of contaminants were compiled. The methods include one or several segments, i.e. mouth, stomach and intestine. Among the compiled methods, the RIVM (Rijksinstituut voor volksgesundheid en milieu) in vitro method was used in the experimental part of the project. The advantages with the method was that: the method to a high degree mimicked the human gastrointestinal processes (the method included three segments mouth, stomach, and intestine

  16. Dynamic myocardial scintigraphy with 123I-labelled free fatty acids

    International Nuclear Information System (INIS)

    Wall, E.E. van der.

    1981-01-01

    In this thesis, long-chain radioiodinated free fatty acids ( 123 I-FFA), 16-iodo- 123 I-cis-Δ 9 -hexadecenoic acid ( 123 I-HA) and 17-iodo- 123 I-heptade-canoic acid ( 123 I-Hsup(o)A), were employed for myocardial scintigraphy in patients with coronary artery disease. The results indicate that clearance of 123 I-FFA from the myocardium is dependent on the nature of ischemic injury. Clearance is delayed if the injury is reversible and accelerated in case of irreversible ischemia. Mechanisms responsible for divergent behaviour of FFA in patients with acute myocardial infarction versus patients with angina pectoris are purely speculative. This differential clearance from normally perfused, transiently ischemic and infarcted myocardium has practical application. The test provides a means to assess the nature of ischemic injury rapidly. These findings may have major consequences for logical management of patients presenting with chest pain and suspected coronary artery disease. (Auth.)

  17. Morphological stability of Sm123 superconductor during peritectic solidification from Sm211 + L mixture

    International Nuclear Information System (INIS)

    Sumida, Masaki; Shiohara, Yuh; Umeda, Takateru

    2000-01-01

    The interface stability of the Sm 123 superconductor was analyzed in accordance with the constitutional undercooling criterion. As the single-crystal growth of the 123 phase is largely dependent on the growth-interface stability, a quantitative analysis was very much required. From this analysis, it was clarified that the constitutional undercooling must exist in the liquid when the 123 growth interface comes close to a 211 particle during the peritectic solidification. It was also predicted that the larger 211 particle radius, smaller volume fraction of the 211 particles, larger growth rate, or smaller imposed temperature gradient would cause easy occurrence of the constitutional undercooling ahead of the 123 growth interface. Taking into account the nucleation at the L/211 interface just ahead of the 123 growth front due to the constitutional undercooling, the transition of 123 growth from a planar-interface morphology to an equiaxed blocky morphology was investigated quantitatively and qualitatively

  18. SOD1 Lysine 123 Acetylation in the Adult Central Nervous System

    Directory of Open Access Journals (Sweden)

    Michael Kaliszewski

    2016-12-01

    Full Text Available Superoxide dismutase 1 (SOD1 knockout (Sod1-/- mice exhibit an accelerated aging phenotype. In humans, SOD1 mutations are linked to familial amyotrophic lateral sclerosis (ALS, and post-translational modification (PTM of wild-type SOD1 has been associated with sporadic ALS. Reversible acetylation regulates many enzymes and proteomic studies have identified SOD1 acetylation at lysine 123 (K123. The function and distribution of K123-acetylated SOD1 (Ac-K123 SOD1 in the nervous system is unknown. Here, we generated polyclonal rabbit antibodies against Ac-K123 SOD1. Sod1 deletion in Sod1-/- mice, K123 mutation, or preabsorption with Ac-K123 peptide all abolished antibody binding. Using immunohistochemistry, we assessed Ac-K123 SOD1 distribution in the normal adult mouse nervous system. In the cerebellum, Ac-K123 SOD1 staining was prominent in cell bodies of the granular cell layer and Purkinje cell dendrites and interneurons of the molecular cell layer. In the hippocampus, Ac-K123 SOD1 staining was strong in the fimbria, subiculum, pyramidal cells, and Schaffer collateral fibers of the cornus ammonis (CA1 region and granule and neuronal progenitor cells of the dentate gyrus. In addition, labeling was observed in the choroid plexus and the ependyma of the brain ventricles and central canal of the spinal cord. In the olfactory bulb, Ac-K123 SOD1 staining was prominent in axons of sensory neurons, in cell bodies of interneurons, and neurites of the mitral and tufted cells. In the retina, labeling was strong in the retinal ganglion cell layer and axons of retinal ganglion cells, the inner nuclear layer, and cone photoreceptors of the outer nuclear layer. In summary, our findings describe Ac-K123 SOD1 distribution to distinct regions and cell types of the normal nervous system.

  19. Highly N2-Selective Palladium-Catalyzed Arylation of 1,2,3-Triazoles

    Science.gov (United States)

    Ueda, Satoshi; Su, Mingjuan; Buchwald, Stephen L.

    2012-01-01

    Highly N2-selective arylation of 4,5-unsubstituted and 4-substituted 1,2,3-triazoles was achieved for the first time by Pd/L1 catalyst system. A wide range of N2-aryl-1,2,3-triazoles were prepared from aryl bromides, chlorides and triflates with excellent (95–99%) N2-selectivity. DFT calculations suggest that formation of N2-arylated 1,2,3-triazoles is favored kinetically. PMID:21853510

  20. New antimony(III) halide complexes with dithiocarbamate ligands derived from thiuram degradation: The effect of the molecule's close contacts on in vitro cytotoxic activity

    Energy Technology Data Exchange (ETDEWEB)

    Urgut, O.S. [Department of Chemistry, Namık Kemal University, 59030, Tekirdag (Turkey); Ozturk, I.I., E-mail: iiozturk@nku.edu.tr [Department of Chemistry, Namık Kemal University, 59030, Tekirdag (Turkey); Banti, C.N., E-mail: cbanti@cc.uoi.gr [Section of Inorganic and Analytical Chemistry, Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Kourkoumelis, N., E-mail: nkourkou@uoi.gr [Medical Physics Laboratory, Medical School, University of Ioannina, Ioannina, 45110 (Greece); Manoli, M.; Tasiopoulos, A.J. [Department of Chemistry, University of Cyprus, Nicosia (Cyprus); Hadjikakou, S.K., E-mail: shadjika@uoi.gr [Section of Inorganic and Analytical Chemistry, Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)

    2016-01-01

    ABSTRACT: Antimony(III) halide complexes of the formulae {[SbBr(Me_2DTC)_2]_n} (1), {[SbI(Me_2DTC)_2]_n} (2) and {[(Me_2DTC)_2Sb(μ_2-I)Sb(Me_2DTC)_2]"+.I_3"−} (3) (Me{sub 2}DTC = dimethyldithiocarbomate) were synthesized from SbX{sub 3}, (X = Br or I) and tetramethylthiuram monosulfide (Me{sub 4}tms) or tetramethylthiuram disulfide (Me{sub 4}tds). The complexes were characterized by melting point (m.p.), elemental analysis (e.a.), Fourier-transform Infra-Red (FT-IR), Fourier-transform Raman (FT-Raman), Nuclear Magnetic Resonance ({sup 1}H,{sup 13}C-NMR) spectroscopy and Thermogravimetric-Differential Thermal Analysis (TG-DTA). Crystal structures of complexes 1–3 were determined with single crystal X-ray diffraction analysis. Complexes 1 and 2 are polymers with distorted square pyramidal (SP) geometry in each monomeric unit, whereas complex 3 is ionic, containing an iodonium linkage Sb–I{sup +}–Sb and an I{sub 3}{sup −} counter anion; to the best of our knowledge, this is the first ionic antimony(III) iodide complex. The in vitro cytotoxic activity of 1–3 against human adenocarcinoma cells: breast (MCF-7) and cervix (HeLa) cells and non-cancerous cells: MRC-5 (normal human fetal lung fibroblast cells) was evaluated with trypan blue (TB) and sulforhodamine B (SRB) assays. Among antimony(III) compounds with sulfur containing ligand, those of dithiocarbamates exhibit significant cytotoxic activity. Hirshfeld surface volumes were analyzed to clarify the nature of the intermolecular interactions by the 2D fingerprint plot. Molecules with lower H-all atoms inter-molecular interactions exhibit the higher activity against MCF-7 cells. The in vivo genotoxicity of 1–3 was evaluated by the mean of Allium cepa test. Alterations in the mitotic index values due to the chromosomal aberrations were observed in the case of complexes 2 and 3. Since, no such alteration is caused by 1, it makes this compound candidate for further study as potential drug. - Graphical