
Sample records for antimony 115

  1. Antimony (United States)

    Seal, Robert R.; Schulz, Klaus J.; DeYoung,, John H.; Sutphin, David M.; Drew, Lawrence J.; Carlin, James F.; Berger, Byron R.; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.


    Antimony is an important mineral commodity used widely in modern industrialized societies. The element imparts strength, hardness, and corrosion resistance to alloys that are used in many areas of industry, including in lead-acid storage batteries. Antimony’s leading use is as a fire retardant in safety equipment and in household goods, such as mattresses. The U.S. Government has considered antimony to be a critical mineral mainly because of its use in military applications. The great majority of the world’s antimony comes from China, and much of the remainder is shipped to China for smelting. Antimony resources are unevenly distributed around the world. China has the bulk of the world’s identified resources; other countries that have identified antimony resources include Bolivia, Canada, Mexico, Russia, South Africa, Tajikistan, and Turkey. Resources in the United States are located mainly in Alaska, Idaho, Montana, and Nevada. The most significant antimony mineral deposits occur in geologic environments with a thick sequence of siliciclastic sedimentary rocks in areas with significant fault and fracture systems. The most common antimony ore mineral is stibnite (Sb2 S3 ), but more than 100 other minerals also contain antimony. The presence of antimony in surface waters and groundwaters results primarily from rock weathering, soil runoff, and anthropogenic sources. Global emissions of antimony to the atmosphere average 6,100 metric tons per year. Empirical data suggest that the acid-generating potential of antimony mine waste is low.

  2. Antimony: a flame fighter (United States)

    Wintzer, Niki E.; Guberman, David E.


    Antimony is a brittle, silvery-white semimetal that conducts heat poorly. The chemical compound antimony trioxide (Sb2O3) is widely used in plastics, rubbers, paints, and textiles, including industrial safety suits and some children’s clothing, to make them resistant to the spread of flames. Also, sodium antimonate (NaSbO3) is used during manufacturing of high-quality glass, which is found in cellular phones.

  3. Mineral resource of the month: antimony (United States)



    The article describes the characteristics and industrial uses of antimony. Antimony, which is produced as a byproduct of mining other metals such as gold, lead or silver, is used in everything from flame retardants, batteries, ceramics and glass. It is also used in glass for television picture tubes, computer monitors, pigments and catalysts.

  4. Heteronuclear compounds of arsenic and antimony (United States)

    Mauser, James E.


    Volatilization of secondary metals such as arsenic, antimony, and bismuth, during the smelting of copper ores, is important because of environmental and resource considerations. The Bureau of Mines, United States Department of the Interior, has been studying copper concentrate roasting in conjunction with the volatility of these minor constituents. Some unusual vaporization behavior initiated this supplemental paper which shows that when the mixed sulfides of arsenic and antimony are heated, the volatilization of arsenic is retarded and the volatilization of antimony increased. Mixed oxides of arsenic and antimony also exhibit exceptional volatilization behavior. These anomalous vaporization behaviors are attributed to the formation of heteronuclear compounds of arsenic and antimony, but the colligative properties of solutions may also be a factor.

  5. Purification of indium, gallium, and antimony by melting with synthetic slug

    International Nuclear Information System (INIS)

    Walis, L.; Rowinska, L.; Nowicki, A.


    The tracer technique has been used for metal purification process control. The indium, gallium and antimony have been purified up to semiconductor purity in the melting with synthetic slug process. The 115m Cd, 59 Fe, 204 Tl. 76 As, 210 Bi have been used as tracers. The high effectiveness of proposed purification method have been found in the cases of indium and gallium. 6 refs, 2 figs, 2 tabs

  6. Surface complexation of antimony on kaolinite. (United States)

    Rakshit, Sudipta; Sarkar, Dibyendu; Datta, Rupali


    Geochemical fate of antimony (Sb) - a similar oxyanion as arsenic (As) - in a variety of environment is largely unexplored. Kaolinite is an important, naturally occurring clay mineral in soils and aquifers and is known to control the fate of several contaminants via a multitude of geochemical processes, primarily adsorption. Here we report adsorption of antimony on kaolinite as a function of solution chemistry: initial antimony concentration, pH, ionic strength, and a competing anion. A surface complexation modeling (SCM) approach was undertaken to understand the potential mechanistic implications of sorption envelope data. In the SCM, a multicomponent additive approach, in which kaolinite is assumed to be a (1:1) mixture of quartz (≡SiOH) and gibbsite (≡AlOH), was tested. Results indicated that ionic strength has a minimal effect on antimony adsorption. For the lower initial antimony concentration (4.11 μM), the additive model with binuclear surface complexes on quartz and gibbsite showed a better fit at pH3.5. However, the additive model with binuclear surface complex on quartz and mononuclear surface complex on gibbsite showed an excellent fit of the data. Phosphate greatly influenced antimony adsorption on kaolinite at both low and high antimony loadings, indicating competition for available surface sites. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Investigation into the reduction of antimony

    International Nuclear Information System (INIS)

    Hornibrook, C.


    This paper describes a program being implemented to decrease the antimony being released in waste water from the processing of liquid low-level radioactive wastes. The process being studied is the use of a crossflow membrane filter to remove antimony, and possibly cobalt 58. The process will evaluate the efficiency gains available from changing the oxidation states of the antimony with respect to the removal efficiency. Ion absorbers and ion exchange media will also be evaluated. The equipment is to be first tested on waste water from the November outage of Oconee, and then to use it on other radwaste processing studies


    Directory of Open Access Journals (Sweden)

    Cláudia Maria Valete-Rosalino


    Full Text Available Introduction: Pentavalent antimonials are the first drug of choice in the treatment of tegumentary leishmaniasis. Data on ototoxicity related with such drugs is scarcely available in literature, leading us to develop a study on cochleovestibular functions. Case Report: A case of a tegumentary leishmaniasis patient, a 78-year-old man who presented a substantial increase in auditory threshold with tinnitus and severe rotatory dizziness during the treatment with meglumine antimoniate, is reported. These symptoms worsened in two weeks after treatment was interrupted. Conclusion: Dizziness and tinnitus had already been related to meglumine antimoniate. However, this is the first well documented case of cochlear-vestibular toxicity related to meglumine antimoniate.

  9. Sorption of antimony on human teeth

    International Nuclear Information System (INIS)

    Nofal, M.; Amin, H.; Alian, G.


    The study of the uptake of toxic elements on human teeth represents an interesting research area, as the fate of these elements when present in the human food is of health significance. Since antimony is one of the common toxic elements and since, the chemical behaviour of antimony is similar to that of arsenic, one of the most important toxic elements commonly encountered in cases of food poisoning, it has been decided to investigate its uptake on human teeth and on other restoration materials. The radioactive tracer technique was used to evaluate the concentration of antimony sorbed on teeth. This tracer was obtained by irradiation of antimony metal in the reactor, subsequent dissolution in concentrated sulphuric acid, evaporation to dryness and making the solution 6 M in Hydrochloric acid (1). Antimony prepared in this way is in the trivalent state (Sb III). Sorption was studied in water, tea, coffee, red tea and chicken soup. The highest sorption was achieved from water and chicken soup and least sorption was noticed in case of coffee. The results are presented in the form of the depletion of the radioactivity (A) of antimony with time in presence of a tooth in water and other drinks

  10. Chlorination of antimony and its volatilization treatment of waste antimony-uranium composite oxide catalyst

    International Nuclear Information System (INIS)

    Sawada, K.; Enokida, Y.


    For the waste antimony-uranium composite oxide catalyst, the chlorination of antimony and its volatilization treatment were proposed, and evaluated using hydrogen chloride gas at 873-1173 K. During the treatment, the weight loss of the composite oxide sample, which resulted from the volatilization of antimony, was confirmed. An X-ray diffraction analysis showed that uranium oxide, U 3 O 8 , was formed during the reaction. After the treatment at 1173 K for 1 h, almost all the uranium contained in the waste catalyst was dissolved by a 3 M nitric acid solution at 353 K within 10 min, although that of the non-treated catalyst was less than 0.1%. It was found that the chlorination and volatilization treatment was effective to separate antimony from the composite oxide catalyst and change uranium into its removable form. (orig.)

  11. Microbial antimony biogeochemistry: Enzymes, regulation, and related metabolic pathways (United States)

    Li, Jingxin; Qian Wang,; Oremland, Ronald S.; Kulp, Thomas R.; Rensing, Christopher; Wang, Gejiao


    Antimony (Sb) is a toxic metalloid that occurs widely at trace concentrations in soil, aquatic systems, and the atmosphere. Nowadays, with the development of its new industrial applications and the corresponding expansion of antimony mining activities, the phenomenon of antimony pollution has become an increasingly serious concern. In recent years, research interest in Sb has been growing and reflects a fundamental scientific concern regarding Sb in the environment. In this review, we summarize the recent research on bacterial antimony transformations, especially those regarding antimony uptake, efflux, antimonite oxidation, and antimonate reduction. We conclude that our current understanding of antimony biochemistry and biogeochemistry is roughly equivalent to where that of arsenic was some 20 years ago. This portends the possibility of future discoveries with regard to the ability of microorganisms to conserve energy for their growth from antimony redox reactions and the isolation of new species of “antimonotrophs.”

  12. Identification of Potential Biomarkers for Antimony Susceptibility ...

    Indian Academy of Sciences (India)

    Probing natural antimony resistance using customised DNA microarrays with oligos of all ABC transporters · Slide 38 · Comparative proteomics to reveal changes in drug resistant parasites · isobaric tags for relative and absolute quantification (iTRAQ®) allows global analyses of protein expression and quantitative ...

  13. Identification of Potential Biomarkers for Antimony Susceptibility ...

    Indian Academy of Sciences (India)

    Identification of Potential Biomarkers for Antimony Susceptibility/Resistance in L. donovani Rentala Madhubala School of Life Sciences Jawaharlal Nehru ... tags for relative and absolute quantification (iTRAQ®) allows global analyses of protein expression and quantitative comparison among samples by mass spectrometry.

  14. 115th Congressional Districts (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This layer depicts the 115th Congressional Districts for the United States, with attributes listing the elected officials for the 115th Congress. Elected to a...

  15. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta Etel Treiger; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Lab. de Biologia Molecular]. E-mail:; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail:; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo (IMT-SP), SP (Brazil). Lab. de Protozoologia].


    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes {sup 122} Sb and {sup 124} Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  16. Speciation analysis of antimony in marine biota by HPLC-(UV)-HG-AFS: Extraction procedures and stability of antimony species. (United States)

    De Gregori, Ida; Quiroz, Waldo; Pinochet, Hugo; Pannier, Florence; Potin-Gautier, Martine


    Speciation analysis of antimony in marine biota is not well documented, and no specific extraction procedure of antimony species from algae and mollusk samples can be found in the literature. This work presents a suitable methodology for the speciation of antimony in marine biota (algae and mollusk samples). The extraction efficiency of total antimony and the stability of Sb(III), Sb(V) and trimethylantimony(V) in different extraction media (water at 25 and 90 degrees C, methanol, EDTA and citric acid) were evaluated by analyzing the algae Macrosystis integrifolia (0.55+/-0.04mugSbg(-1)) and the mollusk Mytilus edulis (0.23+/-0.01mugSbg(-1)). The speciation analysis was performed by anion exchange liquid chromatography (post-column photo-oxidation) and hydride generation atomic fluorescence spectrometry as detection system (HPLC-(UV)-HG-AFS). Results demonstrated that, based on the extraction yield and the stability, EDTA proved to be the best extracting solution for the speciation analysis of antimony in these matrices. The selected procedure was applied to antimony speciation in different algae samples collected from the Chilean coast. Only the inorganic Sb(V) and Sb(III) species were detected in the extracts. In all analyzed algae the sum of total antimony extracted (determined in the extracts after digestion) and the antimony present in the residue was in good agreement with the total antimony concentration determined by HG-AFS. However, in some extracts the sum of antimony species detected was lower than the total extracted, revealing the presence of unknown antimony species, possibly retained on the column or not detected by HPLC-(UV)-HG-AFS. Further work must be carried out to elucidate the identity of these unknown species of antimony.

  17. The presence of antimony in various dental filling materials

    International Nuclear Information System (INIS)

    Molokhia, Anat; Combe, E.C.; Lilley, J.D.


    Antimony was determined in a number of non-metallic dental materials currently used for tooth restoration. The method applied was instrumental neutron activation analysis. The concentration of antimony in some of the brands tested was found to be as high as 900 fold that in the normal hard dental tissues. (author)

  18. The exposure to and health effects of antimony

    DEFF Research Database (Denmark)

    Cooper, Ross G.; Harrison, Adrian Paul


    of the eyes, skin, and lungs. Long-term inhalation of antimony can potentiate pneumoconiosis, altered electrocardiograms, stomach pain, diarrhea, vomiting, and stomach ulcers, results which were confirmed in laboratory animals. Although there were investigations of the effect of antimony in sudden infant...

  19. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta E.T.; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mails:;; Andrade Junior, Heitor F. de [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular; Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil); E-mail:; Osso Junior, Joao A. [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Centro de Radiofarmacia]. E-mail:


    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb{sup +5}) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes {sup 122}Sb and {sup 124}Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony

  20. Structural and electrical characterization of zinc oxide doped with antimony

    Directory of Open Access Journals (Sweden)

    G. Juárez Díaz


    Full Text Available In this work we report the results of structural and electrical characterization realized on zinc oxide single crystal samples with (001 orientation, which were doped with antimony. Doping was carried out by antimony thermal diffusion at 1000 °C for periods of 1 and 2 hours under nitrogen environment from a solid source formed by antimony oxide. Electrical characterization by I-V curves and Hall effect shown an increase in acceptor concentration which demonstrates that doping is effective and create holes in zinc oxide samples.

  1. Complex processing of antimony-mercury gold concentrates of Dzhizhikrut Deposit

    International Nuclear Information System (INIS)

    Abdusalyamova, M.N.; Gadoev, S.A.; Dreisinger, D.; Solozhenkin, P.M.


    Present article is devoted to complex processing of antimony-mercury gold concentrates of Dzhizhikrut Deposit. The purpose of research was obtaining the metallic mercury and antimony with further gold and thallium extraction.

  2. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    Johnson, E.; Littmark, U.; Johansen, A.; Christodoulides, C.


    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb + ions to a fluence of 5 x 10 20 ions/m 2 , thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  3. [Pollution characteristics of antimony, arsenic and mercury in human hair at Xikuangshan antimony mining area and Guiyang City, China]. (United States)

    Liu, Bi-Jun; Wu, Feng-Chang; Deng, Qiu-Jing; Mo, Chang-Li; Zhu, Jing; Zeng, Li; Fu, Zhi-You; Li, Wen


    The concentration levels of antimony, arsenic and mercury in human hair collected from Xikuangshan antimony mining area and Guiyang City were determined by hydride generation-atomic fluorescence spectrometry after having been digested by nitric acid and perchloric acid. The contents of Sb, As and Hg are 15.9, 4.21, 1.79 microg/g in the samples from Xikuangshan antimony mining area and 0.532, 0.280, 0.338 microg/g in the samples from Guiyang City respectively. The contents of Sb, As and Hg in human hair of Xikuangshan antimony area are much higher than those of Guiyang City. The independent-samples t-test shows that there are no marked differences in the contents of Sb and As between male and female hair samples from both Xikuangshan antimony mining area and Guiyang City (p > 0.05), while Hg contents in male hair are apparently higher than those in female hair from Guiyang City (p mining area may significantly affect human health than in the un-mining areas.

  4. Heat-treated Saccharomyces cerevisiae for antimony speciation and antimony(III) preconcentration in water samples

    Energy Technology Data Exchange (ETDEWEB)

    Marcellino, Sebastien [Universite de Lyon, Lyon1, Laboratoire des Sciences Analytiques, CNRS UMR 5180, bat CPE, 43, boulevard du 11 novembre 1918, 69622 Villeurbanne cedex (France); Attar, Hossein [Universite Louis Pasteur de Strasbourg, Laboratoire de Chimie Analytique et Sciences Separatives, CNRS UMR 7178, ECPM, 25 rue Becquerel 67087 Strasbourg (France); Lievremont, Didier; Lett, Marie-Claire [Universite Louis Pasteur de Strasbourg, Laboratoire de Genetique Moleculaire, Genetique et Microbiologie, CNRS UMR 7156, 28 rue Goethe, 67000 Strasbourg (France); Barbier, Frederique [CNRS USR 59, Service Central d' Analyse, 59 Chemin du Canal BP22 69390 Vernaison (France); Lagarde, Florence [Universite de Lyon, Lyon1, Laboratoire des Sciences Analytiques, CNRS UMR 5180, bat CPE, 43, boulevard du 11 novembre 1918, 69622 Villeurbanne cedex (France); Universite Louis Pasteur de Strasbourg, Laboratoire de Chimie Analytique et Sciences Separatives, CNRS UMR 7178, ECPM, 25 rue Becquerel 67087 Strasbourg (France)], E-mail:


    An analytical method was developed for antimony speciation and antimony(III) preconcentration in water samples. The method is based on the selective retention of Sb(III) by modified Saccharomyces cerevisiae in the presence of Sb(V). Heat, caustic and solvent pretreatments of the biomass were investigated to improve the kinetics and thermodynamics of Sb(III) uptake process at room temperature. Heating for 30 min at 80 deg. C was defined as the optimal treatment. Antimony accumulation by the cells was independent of pH (5-10) and ionic strength (0.01-0.1 mol L{sup -1}). 140 mg of yeast and 2 h of contact were necessary to ensure quantitative sequestration of Sb(III) up to 750 {mu}g L{sup -1}. In these conditions, Sb(V) was not retained. Sb(V) was quantified in sorption supernatant by inductively coupled plasma mass spectrometry (ICP-MS) or inductively coupled plasma optical emission spectrometry (ICP-OES). Sb(III) was determined after elution with 40 mmol L{sup -1} thioglycolic acid at pH 10. A preconcentration factor close to nine was achieved for Sb(III) when 100 mL of sample was processed. After preconcentration, the detection limits for Sb(III) and Sb(V) were 2 and 5 ng L{sup -1}, respectively, using ICP-MS, 7 and 0.9 {mu}g L{sup -1} using ICP-OES. The proposed method was successfully applied to the determination of Sb(III) and Sb(V) in spiked river and mineral water samples. The relative standard deviations (n = 3) were in the 2-5% range at the tenth {mu}g L{sup -1} level and less than 10% at the lowest Sb(III) and Sb(V) tested concentration (0.1 {mu}g L{sup -1}). Corrected recoveries were in all cases close to 100%.

  5. Antimony recovery from end-of-life products and industrial process residues: A critical review


    Dupont, David; Arnout, Sander; Jones, Peter Tom; Binnemans, Koen


    Antimony has become an increasingly critical element in recent years, due to a surge in industrial demand and the Chinese domination of primary production. Antimony is produced from stibnite ore (Sb2O3) which is processed into antimony metal and antimony oxide (Sb2O3). The industrial importance of antimony is mainly derived from its use as flame retardant in plastics, coatings, and electronics, but also as decolourizing agent in glass, alloys in lead-acid batteries, and catalysts for the p...

  6. Selective oxidation of propene on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony

    International Nuclear Information System (INIS)

    Pendleton, P.; Taylor, D.


    Propene + 18 0 2 reactions have been studied in a static reaction system on bismuth molybdate and mixed oxides of tin and antimony and of uranium and antimony. The [ 16 0] acrolein content of the total acrolein formed and the proportion of 16 0 in the oxygen of the carbon dioxide by-product have been determined. The results indicate that for each catalyst the lattice is the only direct source of the oxygen in the aldehyde, and that lattice and/or gas phase oxygen is used in carbon dioxide formation. Oxygen anion mobility appears to be greater in the molybdate catalyst than in the other two. (author)

  7. Neutron activation analysis of arsenic and antimony in human hair

    International Nuclear Information System (INIS)

    Kanda, Yukio; Isono, Hideo; Kozuka, Hiroshi.


    A radiochemical neutron activation method for the determination of trace amounts of arsenic and antimony in human hair samples is studied. The sample of hair (100 mg) irradiated for 5 hours with a neutron flux of 2.1x10 12 n/cm 2 s was decomposed with a sulfuric-nitric acid mixture after addition of each 5 mg of arsenic and antimony as carrier. Arsine and stibine were evolved from the solution of decomposed hair by reduction with 3 g of granular zinc and were absorbed in 0.1N iodine solution for half an hour. Metal arsenic was separated from iodine solution by precipitation with sodium hypophosphite, followed by precipitation of antimony as sulfide with thioacetamide. These precipitates were dissolved and their gamma-ray spectra were measured with a well type 3''x3'' NaI(TI) detector equipped with a 200 channel pulse-height analyzer. After the measurement of gamma-ray spectra, the chemical yields were determined by colorimetric methods. The relative standard deviations were 7% and 4% for 0.01 μg As and 0.024 μg Sb, respectively. The sensitivity of this method was estimated to be 1x10 -3 μg for arsenic and 2x10 -3 μg for antimony. (auth.)

  8. Electrical Properties of Antimony (Sb) Metal Contacts to Silicon (Si ...

    African Journals Online (AJOL)

    The study investigates the behaviour of the contacts formed by Antimony (Sb) metal to Silicon (Si) thin films for electric field values 10 – 100V/m. Measurements of I-v characteristics were obtained at temperatures 303, 313, 323, 333, 343 and 353K respectively. The results show linear I – V relationship over a specified range ...

  9. electrocardiographic findings in ethiopians on penta valent antimony ...

    African Journals Online (AJOL)

    East Africa Medical Journal Vol. 78 No. 11 November 2001. ELECTROCARDIOGRAPHIC FINDINGS IN ETHIOPIANS ON PENTA VALENT ANTIMONY THERAPY FOR VISCERAL LEISHMANIASIS. N. Berhe, MD, DTMH, Institute of Pathobiology, Addis Ababa University, P.O. Box 1176, Addis Ababa, Ethiopia, Y. Abraham, ...

  10. Vapor pressures of dimethylcadmium, trimethylbismuth, and tris(dimethylamino)antimony

    Czech Academy of Sciences Publication Activity Database

    Morávek, Pavel; Fulem, Michal; Pangrác, Jiří; Hulicius, Eduard; Růžička, K.


    Roč. 360, Dec (2013), s. 106-110 ISSN 0378-3812 R&D Projects: GA ČR GA13-15286S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : vapor pressure * dimethylcadmium * trimethylbismuth * tris(dimethylamino)antimony * sublimation and vaporization enthalpy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.241, year: 2013

  11. Application of KWU antimony removal process at Gentilly-2

    International Nuclear Information System (INIS)

    Dundar, Y.; Odar, S.; Streit, K.; Allsop, H.; Guzonas, D.


    This paper describes the work performed to adapt the KWU PWR antimony removal process to CANDU plant conditions, and the application of the process at the Hydro Quebec unit, Gentilly-2. The results of the application will be presented and the 'lessons learned' will be discussed in detail. (author)

  12. Antimony content of macrofungi from clean and polluted areas

    Czech Academy of Sciences Publication Activity Database

    Borovička, J.; Řanda, Zdeněk; Jelínek, E.


    Roč. 64, č. 11 (2006), s. 1837-1844 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z10480505 Keywords : mushrooms * antimony pollution * bioaccumulation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.442, year: 2006

  13. The decoration of vicinal copper polycrystalline surface by Antimony

    CSIR Research Space (South Africa)

    Ndlovu, GF


    Full Text Available An Ultra-high Vacuum Variable Temperature Scanning Tunnelling Microscope was used to study the growth mechanism of Antimony on vicinal Cu polycrystalline samples. The STM data after deposition of 0.3 ML Sb at 300°C showed localization of Sb atoms...

  14. Antimony and arsenic biogeochemistry in the East China Sea (United States)

    Ren, Jing-Ling; Zhang, Xu-Zhou; Sun, You-Xu; Liu, Su-Mei; Huang, Daji; Zhang, Jing


    The biogeochemical cycles of the metalloid elements arsenic and antimony in the East China Sea (ECS), one of the most important marginal seas for western Pacific, were examined in May 2011. Dissolved inorganic arsenic (As(V) and As(III)) and antimony (Sb(V) and Sb(III)) species were determined by selective hydride generation-atomic fluorescence spectrometry (HG-AFS). Results show that total dissolved inorganic arsenic (TDIAs; [TDIAs]=[As(V)]+[As(III)]) were moderately depleted in the surface water and enriched in the deep water. Arsenite (As(III)) showed different vertical profiles with that of TDIAs, with significant surface enrichment in the middle shelf region where the concentrations of phosphate were extremely low. Speciation of dissolved arsenic was subtly controlled by the stoichiometric molar ratio of arsenate (As(V)) to phosphate. The average As(V)/P ratio for the ECS in spring 2011 was 10.8×10-3, which is higher than previous results and indicates the arsenate stress. The concentrations of total dissolved inorganic antimony (TDISb; [TDISb]=[Sb(V)]+[Sb(III)]) were high near the Changjiang Estuary and the coastal area of Hangzhou Bay and decreased moderately off the coast. TDISb displayed moderate conservative behavior in the ECS that confirms by the correlations with salinity and dissolved aluminum. Different with that of As(III), antimonite (Sb(III)) concentrations were extremely lower in the ECS, with relative higher concentration appeared at the bottom layer which indicates the contribution from sediment-water interface. A preliminary box model was established to estimate the water-mass balance and antimony budgets for the ECS. Compared with other areas in the world, the concentrations of dissolved inorganic arsenic and antimony in the ECS remain at natural levels.

  15. BioGeochemistry of antimony, Sources, Transfers, Impacts and Assessment (United States)

    Le Roux, Gael; Pinelli, Eric; Hedde, Mickael; Guiresse, Maritxu; De Vleeschouwer, François; Silvestre, Jérôme; Enrico, Maxime; Gandois, Laure; Monna, Fabrice; Gers, Charles; Probst, Anne


    BioGeoSTIB is a project funded by ADEME (French Environmental Protection Agency). Its aim is to provide a better understanding of biogeochemical cycle disturbances of antimony by man. Specifically, it is focused on the atmosphere-soil-organism interfaces. Based on a multi-scale approach, the impact of antimony on organisms and organism communities and the factors of Sb dispersion in the environment aim to better characterized. This report gives the main results of 2 and 1 -2 years of research. Using peat bogs as environmental archives, we show that Sb contamination in soils date back to the beginning of the metallurgy. Atmospheric deposition of Sb largely increased by 100 times during the Industrial Revolution compared to natural levels (~0,001-0,01 mg m-2 an-1) estimated in the deepest peat layers. This disturbance in the antimony geochemical cycle modified its concentrations in soils. One main source of present Sb contamination is automotive traffic due to Sb in braking lines. This emerging contamination was characterized close to a roundabout. This additional source of Sb does not seem to impact soil fauna but Sb concentrations in soil solutions exceed 1 μg L-1. Genotoxicity tests have been performed on the model plant Vicia faba and show that antimony is genotoxic at its lowest concentrations and that there is a synergistic effect lead, a trace metal frequently found in association with antimony in the environment. It is a main issue to determine Sb critical loads in the environment but main identified lacks are thermodynamic data, which are not available yet, to model the behavior of Sb in soil solutions and the fact the antimony is always associated with other anthropogenic trace metals like lead. Critical thresholds of Sb have been determined for the first time based on genotoxicity experiment. Simulations show that these thresholds can be exceeded in the future, whereas present limits for invertebrates (US-EPA) are and will not be reached. However

  16. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema


    Full Text Available Pentavalent antimony, as meglumine antimoniate (Glucantime® or sodium stibogluconate (Pentostam® , is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology.Os antimoniais pentavalentes, como o antimoniato de meglumina (Glucantime® ou estibogluconato de sódio (Pentostam® , são o principal tratamento para a leishmaniose, um complexo de doenças causadas pelo protozoário parasita Leishmania, uma doença endêmica e negligenciada no Brasil. Apesar do seu uso clínico por mais de meio século, seu mecanismo de ação, toxicidade e dados de farmacocinética permanecem desconhecidos. Os métodos analíticos para determinação de antimônio em sistemas biológicos são complexos e apresentam baixa sensibilidade. Estudos utilizando radiotraçadores têm papel potencial no desenvolvimento farmacológico. O objetivo deste estudo foi desenvolver um radiotraçador de antimônio, com propriedades físicas e biológicas adequadas. O antimoniato de meglumina foi irradiado por nêutrons no reator nuclear IEA-R1, produzindo dois radioisótopos: 122

  17. Selective synthesis of ternary copper-antimony sulfide nanocrystals. (United States)

    Xu, Dongying; Shen, Shuling; Zhang, Yejun; Gu, Hongwei; Wang, Qiangbin


    Ternary copper-antimony sulfide nanocrystals (CAS NCs) have attracted increasing attention in photovoltaics and photoelectric nanodevices due to their tunable band gaps in the near-IR regime. Although much progress in the synthesis of CAS NCs has been achieved, the selective synthesis of CAS NCs with controllable morphologies and compositions is preliminary: in particular, a facile method is still in demand. In this work, we have successfully selectively synthesized high-quality CAS NCs with diverse morphologies, compositions, and band gaps, including rectangular CuSbS2 nanosheets (NSs), trigonal-pyramidal Cu12Sb4S13 NCs, and rhombic Cu3SbS3 NSs, by cothermodecomposition of copper diethyldithiocarbamate trihydrate (Cu(Ddtc)2) and antimony diethyldithiocarbamate trihydrate (Sb(Ddtc)3). The direct and indirect band gaps of the obtained CAS NCs were systematically studied by performing Kubelka-Munk transformations of their solid-state diffuse reflectance spectra.

  18. Determination of phosphorus contamination during antimony implantation by measurement and simulation

    International Nuclear Information System (INIS)

    Kuruc, M.; Hulenyi, L.; Kinder, R.


    Experimental determination of phosphorus cross-contamination during antimony implantation is presented. As a suitable structure for this experiment, a buried layer was employed which is created by implanting antimony followed by a long diffusion process. The samples implanted in different implanters were analysed by secondary ion mass spectrometry (SIMS), four-point probe and spreading resistance methods. The obtained results were compared with those calculated by program SUPREM-IV. Methods that can and cannot be used to determine phosphorus contamination during antimony implantation and to estimate the fluence of phosphorus being co-implanted with antimony are described in detail

  19. High dose implantations of antimony for buried layer applications

    International Nuclear Information System (INIS)

    Gailliard, J.P.; Dupuy, M.; Garcia, M.; Roussin, J.C.


    Electrical and physical properties of high dose implantations of antimony in silicon have been studied for use in buried layer applications. The results have been obtained both on and oriented silicon wafers. Following implantations which lead to amorphization we perform an annealing at 600 0 C for 10 mn in order to recrystallize the layer. The observed electrical properties (μ, R) show that the concentration of electrically active antimony ions is greater than that predicted from the solubility of antimony in silicon. Further annealing (in the range 1050 0 - 1200 0 ) induces: firstly a precipitation of the Sb and secondly a diffusion and dissolution of the precipitates. There is a different evolution of the defects in the and silicon slices. T.E.M. reveals no defects in the wafers after one hour annealing at 1200 0 C, whereas defects and twins remain in wafers. Having obtained the evolution of R with time and temperature it is then determined the implantation and annealing conditions which lead to the low resistivity (R = 10) needed for buried layer applications. Results with very many industrially made devices are discussed

  20. Research on the Characteristics and Mechanism of the Cumulative Release of Antimony from an Antimony Smelting Slag Stacking Area under Rainfall Leaching (United States)

    Zhou, Yingying; Deng, Renjian


    We aimed to study the characteristics and the mechanism of the cumulative release of antimony at an antimony smelting slag stacking area in southern China. A series of dynamic and static leaching experiments to simulate the effects of rainfall were carried out. The results showed that the release of antimony from smelting slag increased with a decrease in the solid-liquid ratio, and the maximum accumulated release was found to be 42.13 mg Sb/kg waste and 34.26 mg Sb/kg waste with a solid/liquid ratio of 1 : 20; the maximum amount of antimony was released within 149–420 μm size fraction with 7.09 mg/L of the cumulative leaching. Also, the antimony release was the greatest and most rapid at pH 7.0 with the minimum release found at pH 4.0. With an increase in rainfall duration, the antimony release increased. The influence of variation in rainfall intensity on the release of antimony from smelting slag was small. PMID:28804669

  1. Antimony leaching from polyethylene terephthalate (PET) plastic used for bottled drinking water. (United States)

    Westerhoff, Paul; Prapaipong, Panjai; Shock, Everett; Hillaireau, Alice


    Antimony is a regulated contaminant that poses both acute and chronic health effects in drinking water. Previous reports suggest that polyethylene terephthalate (PET) plastics used for water bottles in Europe and Canada leach antimony, but no studies on bottled water in the United States have previously been conducted. Nine commercially available bottled waters in the southwestern US (Arizona) were purchased and tested for antimony concentrations as well as for potential antimony release by the plastics that compose the bottles. The southwestern US was chosen for the study because of its high consumption of bottled water and elevated temperatures, which could increase antimony leaching from PET plastics. Antimony concentrations in the bottled waters ranged from 0.095 to 0.521 ppb, well below the US Environmental Protection Agency (USEPA) maximum contaminant level (MCL) of 6 ppb. The average concentration was 0.195+/-0.116 ppb at the beginning of the study and 0.226+/-0.160 ppb 3 months later, with no statistical differences; samples were stored at 22 degrees C. However, storage at higher temperatures had a significant effect on the time-dependent release of antimony. The rate of antimony (Sb) release could be fit by a power function model (Sb(t)=Sb 0 x[Time, h]k; k=8.7 x 10(-6)x[Temperature ( degrees C)](2.55); Sb 0 is the initial antimony concentration). For exposure temperatures of 60, 65, 70, 75, 80, and 85 degrees C, the exposure durations necessary to exceed the 6 ppb MCL are 176, 38, 12, 4.7, 2.3, and 1.3 days, respectively. Summertime temperatures inside of cars, garages, and enclosed storage areas can exceed 65 degrees C in Arizona, and thus could promote antimony leaching from PET bottled waters. Microwave digestion revealed that the PET plastic used by one brand contained 213+/-35 mgSb/kg plastic; leaching of all the antimony from this plastic into 0.5L of water in a bottle could result in an antimony concentration of 376 ppb. Clearly, only a small

  2. Complexation of HSA with different forms of antimony (Sb): An application of fluorescence spectroscopy

    International Nuclear Information System (INIS)

    Song, Wenjuan; Zhang, Daoyong; Pan, Xiangliang; Lee, Duu-Jong


    Antimony (Sb) pollution has been of a great environmental concern in some areas in China. Sb enters human body via drinking water, inhalation and food chain, unavoidably interacts with human serum albumin (HSA) in blood plasma, and consequently does harm to human health. The harmful effects of Sb on human health depend on the Sb species and their binding ability to HSA. In the present study, binding of three forms of Sb with HSA was investigated by excitation-emission matrix (EEM) spectroscopy. All of antimony potassium tartrate, antimony trichloride and potassium pyroantimonate quenched fluorescence of HSA. Values of conditional stability constant K a (×10 5 /M) for Sb and HSA systems were 8.13–9.12 for antimony potassium tartrate, 2.51–4.27 for antimony trichloride and 3.63–9.77 for potassium pyroantimonate. The binding constant K b (×10 4 /M) values of HSA with antimony potassium tartrate, antimony trichloride and potassium pyroantimonate were 0.02–0.07, 3.55–5.01, and 0.07–1.08, respectively. There was one independent class of binding site for antimony trichloride towards HSA. There was more than one Sb binding site and negative cooperativity between multiple binding sites for potassium pyroantimonate and antimony potassium tartrate towards HSA. The binding ability of HSA to complex Sb followed the order: antimony trichloride>potassium pyroantimonate>antimony potassium tartrate. -- Highlights: ► The first study reporting interaction of Sb with HSA. ► Sb can effectively quench the fluorescence of HSA. ► The binding ability of HSA to Sb was dependent on the form of Sb. ► Binding differences indicate differences in toxicity of various forms Sb to human. ► HAS-Sb binding parameters are important for understanding toxicity of Sb

  3. Heavy weight vehicle traffic and its relationship with antimony content in human blood. (United States)

    Quiroz, Waldo; De Gregori, Ida; Basilio, Paola; Bravo, Manuel; Pinto, Marcela; Lobos, Maria Gabriela


    Brake pads systems are nowadays considered as one of the most important sources of antimony in airborne particulate matter. One way that antimony can enter the body is through the lungs and specially by the interaction of antimony with -SH groups present in erythrocyte membrane cells. In spite of that, there are no studies about antimony enrichment in blood of workers exposed to high vehicle traffic. Port workers are generally exposed to heavy weight vehicle traffic. In Chile the biggest marine port is found in Valparaíso City. In this study antimony in whole blood and its fractions (erythrocytes-plasma and erythrocytes membranes-cytoplasm) of 45 volunteers were determined. The volunteers were port workers from Valparaíso city, and two control groups, one from Valparaíso and another from Quebrada Alvarado, the latter being a rural area located about 100 Km away from Valparaíso. The results demonstrate that port workers are highly impacted by antimony emissions from heavy weight vehicle traffic showing an average concentration of 27 +/- 9 ng Sb kg(-1), 5-10 times higher than the concentration of antimony in the blood of control groups. These are the highest antimony levels in blood ever reported in the literature. The highest antimony percentages (>60%) were always found in the erythrocyte fractions. However, the exposure degree to vehicle traffic is significant over antimony distribution in plasma, erythrocytes and cytoplasm. This results shows that the antimony mass in the erythrocyte membranes, was approximately constant at 1.0 +/- 0.1 ng Sb g(-1) of whole blood in all blood samples analyzed.

  4. Leishmania donovani isolates with antimony-resistant but not -sensitive phenotype inhibit sodium antimony gluconate-induced dendritic cell activation.

    Directory of Open Access Journals (Sweden)

    Arun Kumar Haldar


    Full Text Available The inability of sodium antimony gluconate (SAG-unresponsive kala-azar patients to clear Leishmania donovani (LD infection despite SAG therapy is partly due to an ill-defined immune-dysfunction. Since dendritic cells (DCs typically initiate anti-leishmanial immunity, a role for DCs in aberrant LD clearance was investigated. Accordingly, regulation of SAG-induced activation of murine DCs following infection with LD isolates exhibiting two distinct phenotypes such as antimony-resistant (Sb(RLD and antimony-sensitive (Sb(SLD was compared in vitro. Unlike Sb(SLD, infection of DCs with Sb(RLD induced more IL-10 production and inhibited SAG-induced secretion of proinflammatory cytokines, up-regulation of co-stimulatory molecules and leishmanicidal effects. Sb(RLD inhibited these effects of SAG by blocking activation of PI3K/AKT and NF-kappaB pathways. In contrast, Sb(SLD failed to block activation of SAG (20 microg/ml-induced PI3K/AKT pathway; which continued to stimulate NF-kappaB signaling, induce leishmanicidal effects and promote DC activation. Notably, prolonged incubation of DCs with Sb(SLD also inhibited SAG (20 microg/ml-induced activation of PI3K/AKT and NF-kappaB pathways and leishmanicidal effects, which was restored by increasing the dose of SAG to 40 microg/ml. In contrast, Sb(RLD inhibited these SAG-induced events regardless of duration of DC exposure to Sb(RLD or dose of SAG. Interestingly, the inhibitory effects of isogenic Sb(SLD expressing ATP-binding cassette (ABC transporter MRPA on SAG-induced leishmanicidal effects mimicked that of Sb(RLD to some extent, although antimony resistance in clinical LD isolates is known to be multifactorial. Furthermore, NF-kappaB was found to transcriptionally regulate expression of murine gammaglutamylcysteine synthetase heavy-chain (mgammaGCS(hc gene, presumably an important regulator of antimony resistance. Importantly, Sb(RLD but not Sb(SLD blocked SAG-induced mgammaGCS expression in DCs by

  5. Comparison of modification with strontium and the refining with antimony in A 356 aluminium alloys

    International Nuclear Information System (INIS)

    Fuoco, Ricardo; Correa, Edison Roberto; Correa, Alzira V.O.; Bocalini Junior, Mario


    Strontium and Antimony treated A356 aluminium alloy samples were metallographically characterized in the as cast and solution and aged conditions. Antimony treated alloy has shown slower spheroidizing kinetics of the Silicon particles during solution treatment, lower porosity level and higher tensile strength and elongation than Strontium treated one. (author)

  6. Effect of antimony on the microbial growth and the activities of soil enzymes. (United States)

    An, Youn-Joo; Kim, Minjin


    The effects of antimony (Sb) on microbial growth inhibition and activities of soil enzymes were investigated in the present study. Test bacterial species were Escherichia coli, Bacillus subtilis and Streptococcus aureus. Among the microorganisms tested, S. aureus was the most sensitive. The 50% effects on the inhibition of specific growth rate of E. coli, B. subtilis, and, S. aureus were 555, 18.4, and 15.8 mg Sb L(-1), respectively. A silt loam soil was amended with antimony and incubated in a controlled condition. Microbial activities of dehydrogenase, acid phosphatase (P cycle), arylsulfatase (S cycle), beta-glucosidase (C cycle), urease (N cycle), and fluorescein diacetate hydrolase in soil were measured. Activities of urease and dehydrogenase were related with antimony and can be an early indication of antimony contamination. The maximum increase in soil urease activity by antimony was up to 168% after 3d compared with the control. The activities of other four enzymes (acid phosphatase, fluorescein diacetate hydrolase, arylsulfatase and ss-glucosidase) were less affected by antimony. This study suggested that antimony affects nitrogen cycle in soil by changing urease activity under the neutral pH, however, soil enzyme activities may not be a good protocol due to their complex response patterns to antimony pollution.

  7. The Hydrothermal Chemistry of Gold, Arsenic, Antimony, Mercury and Silver

    Energy Technology Data Exchange (ETDEWEB)

    Bessinger, Brad; Apps, John A.


    A comprehensive thermodynamic database based on the Helgeson-Kirkham-Flowers (HKF) equation of state was developed for metal complexes in hydrothermal systems. Because this equation of state has been shown to accurately predict standard partial molal thermodynamic properties of aqueous species at elevated temperatures and pressures, this study provides the necessary foundation for future exploration into transport and depositional processes in polymetallic ore deposits. The HKF equation of state parameters for gold, arsenic, antimony, mercury, and silver sulfide and hydroxide complexes were derived from experimental equilibrium constants using nonlinear regression calculations. In order to ensure that the resulting parameters were internally consistent, those experiments utilizing incompatible thermodynamic data were re-speciated prior to regression. Because new experimental studies were used to revise the HKF parameters for H2S0 and HS-1, those metal complexes for which HKF parameters had been previously derived were also updated. It was found that predicted thermodynamic properties of metal complexes are consistent with linear correlations between standard partial molal thermodynamic properties. This result allowed assessment of several complexes for which experimental data necessary to perform regression calculations was limited. Oxygen fugacity-temperature diagrams were calculated to illustrate how thermodynamic data improves our understanding of depositional processes. Predicted thermodynamic properties were used to investigate metal transport in Carlin-type gold deposits. Assuming a linear relationship between temperature and pressure, metals are predicted to predominantly be transported as sulfide complexes at a total aqueous sulfur concentration of 0.05 m. Also, the presence of arsenic and antimony mineral phases in the deposits are shown to restrict mineralization within a limited range of chemical conditions. Finally, at a lesser aqueous sulfur

  8. Metabolism of antimony-124 in lactating dairy cows

    International Nuclear Information System (INIS)

    Bruwaene, R. van; Gerber, G.B.; Kirchmann, R.; Colard, J.


    Lactating cows received oral and intravenous administrations of radioactive antimony (III) chloride to study its intestinal and urinary excretion, secretion into milk and organ distribution. Milk samples were taken twice a day and the milk, feces and urine assayed using gamma spectroscopy. Cows administered orally were sacrificed at 102 days and those injected intravenously at 70 days. Distribution of 124 Sb in the organs was determined at the time of sacrifice. Excretion of 124 Sb occurs mainly via urine, little is secreted into milk. Highest organ concentrations are in the spleen, liver and bone. (U.K.)

  9. Extraction of antimony and arsenic from sulphidic concentrates

    Directory of Open Access Journals (Sweden)



    Full Text Available The efficiency of both mineral processing and extractive metallurgy of minerals depends on the separation of individual mineral components and on the exposure of their surface. The production of flotation concentrates, with particle sizes of tens of microns, is not sufficient for many hydrometallurgical processes to operate at their optimum. As a consequence, metallurgical plants require for the effective processing high temperatures and pressures and some sort of concentrate pretreatment. Mechanical activation is an innovative procedure where an improvement in hydrometallurgical processes can be attained via a combination of new surface area and formation of crystalline defects in minerals. The lowering of reaction temperatures, the increase of rate and amount of solubility, preparation of water soluble compounds, the necessity for simpler and less expensive reactors and shorter reaction times are some of the advantages of mechanical activation. The environmental aspects of these processes are particularly attractive.This paper is devoted to the examples of application of mechanochemical treatment in the processing of sulfidic concentrates. The sulphide concentrates of various origin (Peru, Chile, Slovakia were succesfully tested for antimony and arsenic extraction. The mechanochemical treatment improve the degree of recovery and the rate of leaching of both metals. Two modes of mechanochemical treatment were tested: the mechanical activation before leaching and the mechanochemical leaching which integrates mechanical activation and leaching into a common step. The flowsheet consisted of mechanochemical leaching in an attritor and further operations as filtration, cementation, antimony precipitation, crystallization and arsenic precipitation. The pilot plant unit was designed for 500 kg per day feed of tetrahedrite concentrate. For the antimony extraction, electrowinning has also been considered. The residue which is a CuAgAu concentrate was

  10. Electrostatically defined silicon quantum dots with counted antimony donor implants

    Energy Technology Data Exchange (ETDEWEB)

    Singh, M., E-mail:; Luhman, D. R.; Lilly, M. P. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Integrated Nanotechnologies, Sandia National Laboratories, Albuquerque, New Mexico 87175 (United States); Pacheco, J. L.; Perry, D.; Garratt, E.; Ten Eyck, G.; Bishop, N. C.; Wendt, J. R.; Manginell, R. P.; Dominguez, J.; Pluym, T.; Bielejec, E.; Carroll, M. S. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)


    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants.

  11. Electrical conductivity of uranium-antimony oxide catalysts

    International Nuclear Information System (INIS)

    Golunski, S.E.; Nevell, T.G.; Hucknall, D.J.


    The relative ionic and electronic contributions to the electrical conductivity of a uranium-antimony oxide catalyst and of USbO 5 have been determined from measurements of a.c. and d.c. conductance. Under inert atmospheres (390 to 775 K) conduction in the catalyst (predominantly USb 3 O 10 together with small proportions of Sb 2 O 4 and USbO 5 ) is associated with both electronic and effectively charged atomic point defects. Only electronic conduction occurs in USbO 5 . Under oxygen (10 to 70 kPa, 493 to 682 K) both materials are n-type semiconductors at higher temperatures, but at lower temperatures semiconducting behaviour varies with the pressure of oxygen. Heating USbO 5 in oxygen induces an ionic contribution to conductivity. Ionic conduction in the catalyst is eliminated by heating in hydrogen or propene at 470 K but is restored by heating in oxygen. It is suggested that both charged oxygen vacancies and interstitial oxide ions are involved in interactions of gaseous components with uranium-antimony oxides. With alkenes, interstitial oxide ions give rise to the products of selective partial oxidation. (author)

  12. Segregation of antimony in InP in MOVPE

    International Nuclear Information System (INIS)

    Weeke, Stefan


    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  13. Segregation of antimony in InP in MOVPE

    Energy Technology Data Exchange (ETDEWEB)

    Weeke, Stefan


    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  14. Removal of arsenic and antimony from anode slime by vacuum dynamic flash reduction. (United States)

    Lin, Deqiang; Qiu, Keqiang


    Anode slime is an important material of recycling precious metals. Up to now, treating the arsenic- and antimony-rich anode slime by conventional processes has the following problems: its economic and environmental effect is less than satisfactory, and the removal effect of arsenic and antimony from anode slime in present processes is not all that could be desired. Therefore, vacuum dynamic flash reduction, a new process for treating arsenic- and antimony-rich anode slime, was investigated in this work. During vacuum dynamic flash reduction, silver from the arsenic- and antimony-rich anode slime was left behind in the distilland as the silver alloy, and trivalent oxides of arsenic and antimony were evaporated in the distillate. The experimental results showed that the evaporation percent of the arsenic- and antimony-rich anode slime was 65.6%. Namely, 98.92% by weight of arsenic and 93.67% by weight of antimony can be removed under the following experimental conditions: temperature of 1083 K, vacuum evaporation time of 60 min, and air flow rate of 400 mL/min corresponding to the residual gas pressure of 250 Pa. Moreover, vacuum treatment eliminates much of the air pollution and material losses associated with other conventional treatment methods.

  15. Immobilization of antimony waste slag by applying geopolymerization and stabilization/solidification technologies. (United States)

    Salihoglu, Güray


    During the processing of antimony ore by pyrometallurgical methods, a considerable amount of slag is formed. This antimony waste slag is listed by the European Union as absolutely hazardous waste with a European Waste Catalogue code of 10 08 08. Since the levels of antimony and arsenic in the leachate of the antimony waste slag are generally higher than the landfilling limits, it is necessary to treat the slag before landfilling. In this study, stabilization/solidification and geopolymerization technologies were both applied in order to limit the leaching potential of antimony and arsenic. Different combinations ofpastes by using Portland cement, fly ash, clay, gypsum, and blast furnace slag were prepared as stabilization/solidification or geopoljymer matrixes. Sodium silicate-sodium hydroxide solution and sodium hydroxide solution at 8 M were used as activators for geopolymer samples. Efficiencies of the combinations were evaluated in terms of leaching and unconfined compressive strength. None of the geopolymer samples prepared with the activators yielded arsenic and antimony leaching below the regulatory limit at the same time, although they yielded high unconfined compressive strength levels. On the other hand, the stabilization/solidification samples prepared by using water showed low leaching results meeting the landfilling criteria. Use of gypsum as an additive was found to be successful in immobilizing the arsenic and antimony.

  16. In Vitro Antiparasitic and Apoptotic Effects of Antimony Sulfide Nanoparticles on Leishmania infantum

    Directory of Open Access Journals (Sweden)

    Saied Soflaei


    Full Text Available Visceral leishmaniasis is one of the most important sever diseases in tropical and subtropical countries. In the present study the effects of antimony sulfide nanoparticles on Leishmania infantum in vitro were evaluated. Antimony sulfide NPs (Sb2S5 were synthesized by biological method from Serratia marcescens bacteria. Then the cytotoxicity effects of different concentrations (5, 10, 25, 50, and 100 μg/mL of this nanoparticle were assessed on promastigote and amastigote stages of L. infantum. MTT method was used for verification results of promastigote assay. Finally, the percentages of apoptotic, necrotic, and viable cells were determined by flow cytometry. The results indicated the positive effectiveness of antimony sulfide NPs on proliferation of promastigote form. The IC50 (50% inhibitory concentration of antimony sulfide NPs on promastigotes was calculated 50 μg/mL. The cytotoxicity effect was dose-dependent means by increasing the concentration of antimony sulfide NPs, the cytotoxicity curve was raised and the viability curve of the parasite dropped simultaneously. Moreover, the IC50 of antimony sulfide NPs on amastigote stage was calculated 25 μg/mL. On the other hand, however, antimony sulfide NPs have a low cytotoxicity effect on uninfected macrophages but it can induce apoptosis in promastigote stage at 3 of 4 concentrations.

  17. The potential DNA toxic changes among workers exposed to antimony trioxide. (United States)

    El Shanawany, Safaa; Foda, Nermine; Hashad, Doaa I; Salama, Naglaa; Sobh, Zahraa


    Occupational exposure to antimony has gained much interest when specific toxic effects were noticed among workers processing antimony. Thus, the aim of the present work was to investigate the potential DNA oxidative damage occurring among Egyptian workers occupationally exposed to antimony trioxide. The study was conducted on 25 subjects exposed to antimony trioxide while working in the polymerization process of polyester in Misrayon and Polyester Fiber Company, KafrEldawwar, Beheira, Egypt. Urinary antimony levels were assessed using inductive coupled plasma-optical emission spectrometry (ICP-OES) and considered as a biological exposure index. DNA damage and total oxidant capacity (TOC) were assessed using ELISA. DNA damage was detected in the form of increased apurinic/apyrimidinic (AP) sites among antimony trioxide-exposed workers compared to control subjects, but it could not be explained by oxidative mechanisms due to lack of significant correlation between DNA damage and measured TOC. Antimony trioxide might have a genotoxic impact on occupationally exposed workers which could not be attributed to oxidative stress in the studied cases.

  18. Behaviour of antimony during thermal treatment of Sb-rich halogenated waste

    Energy Technology Data Exchange (ETDEWEB)

    Klein, J. [Laboratoire Gestion des Risques et Environnement, 25 rue de Chemnitz, 68200 Mulhouse (France); Dorge, S., E-mail: [Laboratoire Gestion des Risques et Environnement, 25 rue de Chemnitz, 68200 Mulhouse (France); Trouve, G. [Laboratoire Gestion des Risques et Environnement, 25 rue de Chemnitz, 68200 Mulhouse (France); Venditti, D.; Durecu, S. [TREDI Departement de Recherche, Technopole de Nancy-Brabois, 9 avenue de la Foret de Haye, BP 184, 54505 Vandoeuvre-les-Nancy (France)


    Antimony compounds have a wide range of industrial applications, particularly as additives in flame retardants. To ensure environmentally friendly waste incineration of Sb-rich wastes, it is essential to strengthen the knowledge about the fate of antimony and the potential formation of harmful species. Investigations should be conducted particularly in relation with the main operational parameters controlling the process, chiefly temperature, residence time and air supply in the oven and in the post-combustion zone, prior final adapted cleaning of the flue-gas stream. Experimental studies focusing on antimony behaviour were undertaken through laboratory-scale thermal treatment at 850 deg. C and 1100 deg. C of a Sb-rich halogenated waste, originating from the sector of flame retardants formulation. The configuration of our laboratory experimental device allowed to achieve only low oxidative conditions in the waste bed, but high oxidative strength coupled with high temperature and sufficient gas residence time in the post-combustion zone, as prescribed during the incineration of hazardous wastes. Atomic absorption spectroscopy was used to assess the partition of antimony in the different compartments of the process. The oxidation degree of antimony in the gas-phase was determined by the use of electrochemical techniques, namely polarography coupled with anodic stripping voltamperometry. The partition of antimony between the residual ash and the gas-phase under moderate oxidative conditions in the waste bed was constant, whatever the temperature: the volatilization rate for antimony was {approx}64%, while a {approx}36% fraction remained in the residual bottom ashes. But interestingly, while at 850 {sup o}C, antimony was mainly present in the gas-phase at a +III oxidation degree, an increase in temperature of 250 {sup o}C favoured the presence of antimony to its highest oxidation degree +V in the flue-gas stream, a valence known to be involved in less toxic species.

  19. Synthesis, characterisation and electrochemical evaluation of reduced graphene oxide modified antimony nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Silwana, Bongiwe; Horst, Charlton van der [Natural Resources and the Environment (NRE), Council for Scientific and Industrial Research (CSIR), Stellenbosch 7600 (South Africa); SensorLab, Department of Chemistry, University of the Western Cape, Bellville 7535 (South Africa); Iwuoha, Emmanuel [SensorLab, Department of Chemistry, University of the Western Cape, Bellville 7535 (South Africa); Somerset, Vernon, E-mail: [Natural Resources and the Environment (NRE), Council for Scientific and Industrial Research (CSIR), Stellenbosch 7600 (South Africa)


    This paper demonstrates some aspects on the synthesis and characterisation of nanoparticles of metallic alloys using polyvinyl alcohol as a stabiliser, which combines high surface area and superior hybrid properties. The present experimental design was to synthesise a nanocomposite of reduced graphene oxide and antimony nanoparticles to be used as thin films for macro- and micro-carbon electrodes for enhancing sensing of different toxic metal pollutants in the environment. The synthetic process of reduced graphene oxide was done using the modified Hummers method while antimony pentachloride was reduced with sodium borohydride into nanoparticles of antimony using polyvinyl-alcohol as a stabiliser. The systematic investigation of morphology was done by scanning electron microscopy and high resolution-transmission electron microscope, which revealed the synthesis of a product, consists of reduced graphene oxide antimony nanoparticles. The electrochemical behaviour of the reduced graphene oxide antimony nanoparticles coated on a glassy carbon electrode was performed using voltammetric and impedance techniques. Electrochemical impedance measurements showed that the overall resistance, including the charge–transfer resistance, was smaller with reduced graphene oxide antimony nanoparticles than reduced graphene oxide and antimony nanoparticles, on their own. Evaluation of the reduced graphene oxide antimony nanoparticle sensor in the stripping voltammetry has shown a linear working range for concentration of platinum (II) between 6.0 × 10{sup −6}–5.4 × 10{sup −5} μg L{sup −1} with limit of detection of 6 × 10{sup −6} μg L{sup −1} (signal-to-noise ratio = 3), which is below the World Health Organisation guidelines for freshwater. - Highlights: • Reduced graphene oxide modified antimony nanoparticles were chemically synthesised. • TEM results show rGO-Sb nanoparticles with a diameter range of between 2 and 20 nm. • Impedance results confirm

  20. An investigation of inorganic antimony species and antimony associated with soil humic acid molar mass fractions in contaminated soils

    International Nuclear Information System (INIS)

    Steely, Sarah; Amarasiriwardena, Dulasiri; Xing Baoshan


    The presence of antimony compounds is often suspected in the soil of apple orchards contaminated with lead arsenate pesticide and in the soil of shooting ranges. Nitric acid (1 M) extractable Sb from the shooting range (8300 μg kg -1 ) and the apple orchard (69 μg kg -1 ) had considerably higher surface Sb levels than the control site ( -1 ), and Sb was confined to the top ∼30 cm soil layer. Sb(V) was the principal species in the shooting range and the apple orchard surface soils. Size exclusion chromatography-inductively coupled plasma-mass spectrometry (SEC-ICP-MS) analysis of humic acids isolated from the two contaminated soils demonstrated that Sb has complexed to humic acid molar mass fractions. The results also indicate that humic acids have the ability to arrest the mobility of Sb through soils and would be beneficial in converting Sb(III) to a less toxic species, Sb(V), in contaminated areas. - The soil surface and depth distribution Sb(V) and Sb(III) species in a contaminated apple orchard and a shooting range, and the effect soil humic acids on inorganic antimony species is reported

  1. Varicella zoster virus reactivation during or immediately following treatment of tegumentary leishmaniasis with antimony compounds

    Directory of Open Access Journals (Sweden)

    Andrea Barbieri Barros


    Full Text Available Antimony compounds are the cornerstone treatments for tegumentary leishmaniasis. The reactivation of herpes virus is a side effect described in few reports. We conducted an observational study to describe the incidence of herpes zoster reactivation during treatment with antimony compounds. The global incidence of herpes zoster is approximately 2.5 cases per 1,000 persons per month (or 30 cases per 1,000 persons per year. The estimated incidence of herpes zoster in patients undergoing antimony therapy is higher than previously reported.

  2. Antimony(V) and Bismuth(V) Complexes of Lapachol: Synthesis, Crystal Structure and Cytotoxic Activity


    Cynthia Demicheli; Carlos A. de Simone; Frédéric Frézard; Eufrânio N. da Silva Júnior; Cláudio L. Donnici; Elene C. Pereira-Maia; Ludmila G. de Oliveira; Meiriane M. Silva; Flávia C. S. de Paula


    Antimony(V) and bismuth(V) complexes of lapachol have been synthesized by the reaction of Ph3SbCl2 or Ph3BiCl2 with lapachol (Lp) and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V) complex is a monomeric derivative, (Lp)(Ph3Sb)OH, and the bismuth(V) complex is a dinuclear compound bridged by an oxygen atom, (Lp)2(Ph3Bi)2O. Both compounds inhibited ...

  3. Silicon quantum dots with counted antimony donor implants (United States)

    Singh, Meenakshi; Pacheco, Jose; Perry, Daniel; Wendt, Joel; Manginell, Ronald; Dominguez, Jason; Pluym, Tammy; Luhman, Dwight; Bielejec, Edward; Lilly, Michael; Carroll, Malcolm

    Antimony donor implants next to silicon quantum dots have been detected with integrated solid-state diode detectors with single ion precision. Devices with counted number of donors have been fabricated and low temperature transport measurements have been performed. Charge offsets, indicative of donor ionization and coupling to the quantum dot, have been detected in these devices. The number of offsets corresponds to 10-50% of the number of donors counted. We will report on tunneling time measurements and spin readout measurements on the donor offsets. This work was performed, in part, at the Center for Integrated Nanotechnologies, a U.S. DOE Office of Basic Energy Sciences user facility. The work was supported by Sandia National Laboratories Directed Research and Development Program. Sandia National Laboratories is a multi-program laboratory operated by Sandia Corporation, a Lockheed-Martin Company, for the U. S. Department of Energy under Contract No. DE-AC04-94AL85000.

  4. Fluoride and oxyfluoride compounds and niobium, antimony and tellurium

    International Nuclear Information System (INIS)

    Corbin, Odile.


    This paper is a detailed bibliographic report on fluoride and oxyfluoride compounds and niobium, antimony and tellurium oxides. Compounds identified to date are: NbF 3 , NbF 4 , NbF 5 , NbF 6 , NbO 2 F, NbOF 3 , Nb 3 O 7 F, SbF 3 , SbF 5 , SbOF, SbOF 3 , SbO 2 F, Sb 2 O 3 , Sb 2 O 4 , TeF 4 , Te 2 F 10 , TeF 6 , Te 2 OF 10 , Te 3 O 2 F 14 , Te 6 F 26 O 5 , TeO, TeO 2 , TeO 3 . Synthesis processes, physical properties and chemical properties are given for each of the above compounds [fr

  5. Calcium metal as a scavenger for antimony from aluminum alloys

    Energy Technology Data Exchange (ETDEWEB)

    Bonsignore, P.V.; Daniels, E.J.; Wu, C.T.


    Previous work has shown that trace amounts of antimony (Sb) can affect the mechanical properties of strontium (Sr) modified aluminum castings. ANL has been investigating technology to remove or neutralize Sb to reduce its negative effect on the physical properties of those alloys. Review of past work on processing and recovery of scrap aluminum inferred that calcium (Ca) is an effective scavenger of Sb, bismuth, lead and cadmium. Following up on that lead, we have found that Ca is, indeed, effective for removing Sb from molten aluminum alloys although its effectiveness can be compromised by a wide range of processing conditions. A minimum ratio of about four to one, by weight, of Ca to Sb appears necessary to insure an effective scavenging of contained 356 aluminum alloys.

  6. Antimony Accumulation Risk in Lettuce Grown in Brazilian Urban Gardens

    Directory of Open Access Journals (Sweden)

    Silvia Mancarella


    Full Text Available More than 80% of the Brazilian population inhabits urban areas. Diffused poverty and the lack of fresh vegetables have generated malnutrition and unbalanced diets. Thus, the interest in growing food locally, in urban allotments and community gardens, has increased. However, urban agriculture may present some risks caused by the urban pollution. Road traffic is considered the biggest source of heavy metals in urban areas. Hence, the objective of the study was the assessment of the accumulation of heavy metals in an urban garden in the city of Recife, at different distances from a road with high traffic burden. The results showed that the distance from the street decreased the accumulation of many potentially toxic elements. Furthermore, the human health risk was estimated, revealing that greater danger was associated with the accumulation of antimony. Concentration of other elements in the leaf tissues were within previously reported thresholds.

  7. Antimony as a global dilemma: Geochemistry, mobility, fate and transport. (United States)

    Herath, Indika; Vithanage, Meththika; Bundschuh, Jochen


    Elevated concentrations of antimony (Sb) in environmental, biological and geochemical systems originating from natural, geological and anthropogenic sources are of particular global concern. This review presents a critical overview of natural geochemical processes which trigger the mobilization of Sb from its host mineral phases and related rocks to the surrounding environments. The primary source of Sb contamination in the environment is geogenic. The geochemical characteristics of Sb are determined by its oxidation states, speciation and redox transformation. Oxidative dissolution of sulfide minerals and aqueous dissolution are the most prevalent geochemical mechanisms for the release of Sb to the environment. Transformation of mobile forms of Sb is predominantly controlled by naturally occurring precipitation and adsorption processes. Oxyhydroxides of iron, manganese and aluminum minerals have been recognized as naturally occurring Sb sequestrating agents in the environment. Antimony is also immobilized in the natural environment via precipitation with alkali and heavy metals resulting extremely stable mineral phases, such as schafarzikite, tripuhyite and calcium antimonates. Many key aspects, including detection, quantification, and speciation of Sb in different environmental systems as well as its actual human exposure remain poorly understood. Identification of global distribution of most vulnerable Sb-contaminated regions/countries along with aquifer sediments is an urgent necessity for the installation of safe drinking water wells. Such approaches could provide the global population Sb-safe drinking and irrigation water and hinder the propagation of Sb in toxic levels through the food chain. Hence, raising awareness through the mobility, fate and transport of Sb as well as further transdisciplinary research on Sb from global scientific communities will be a crucial stage to establish a sustainable Sb mitigation on a global scale. Copyright © 2017 Elsevier


    Directory of Open Access Journals (Sweden)



    Full Text Available Five new S2- adducts with SbIII and SbV halides have been synthesized and studied by infrared. Discrete structures have been suggested, the environment around the antimony being tetrahedral, trigonal bipyramidal or octahedral.

  9. Antimony-based focal plane arrays for shortwave-infrared to visible applications, Phase I (United States)

    National Aeronautics and Space Administration — We propose to develop antimony-based focal plane arrays (FPAs) for NASA's imaging and spectroscopy applications in the spectral band from visible to...

  10. Antimony-Based Focal Plane Arrays for Shortwave-Infrared to Visible Applications, Phase II (United States)

    National Aeronautics and Space Administration — We propose to develop antimony-based focal plane arrays (FPAs) for NASA's imaging and spectroscopy applications in the spectral band from visible to...

  11. Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

    International Nuclear Information System (INIS)

    Bajo, S.; Wyttenbach, A.


    The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

  12. Exposure to antimony from polyethylene terephthalate (PET) trays used in ready-to-eat meals. (United States)

    Haldimann, M; Blanc, A; Dudler, V


    Antimony residues, a result of the use of a polycondensation catalyst in the production of polyethylene terephthalate (PET) oven-proof trays, were analysed in ready-to-eat meals. The toxicity of antimony has raised concerns about consumer safety; therefore, the migration of small fractions of these residues into ready meals and foods as a result of cooking directly in the PET trays was studied. A straightforward approach of measuring real samples was selected to obtain accurate exposure data. Background antimony concentration was determined separately from a series of lunch meals, which ranged from not detectable to 3.4 microg kg(-1). Microwave and conventional oven-cooking caused a distinct increase in the concentration of antimony in food and ready meals of 0-17 and 8-38 microg kg(-1), respectively, depending, to a certain extent, on the industrial preparations. The migrated quantities of antimony corresponded to 3-13 microg. For comparison, PET roasting bags and ready-made dough products in PET baking dishes were also evaluated. About half of the products prepared at a temperature of 180 degrees C exceeded the specific migration limit set for food contact material by the European Commission. However, the migrated amounts of antimony relative to the accepted tolerable daily intake (TDI) show that exposure from this type of food is currently not of toxicological concern.

  13. 7 CFR 1150.115 - Research. (United States)


    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Research. 1150.115 Section 1150.115 Agriculture... and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order Definitions § 1150.115 Research. Research means studies testing the effectiveness of market...

  14. 11 CFR 115.2 - Prohibition. (United States)


    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Prohibition. 115.2 Section 115.2 Federal Elections FEDERAL ELECTION COMMISSION GENERAL FEDERAL CONTRACTORS § 115.2 Prohibition. (a) It shall be... to any person for any political purpose or use. This prohibition does not apply to contributions or...

  15. 7 CFR 916.115 - Lot stamping. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Lot stamping. 916.115 Section 916.115 Agriculture... and Regulations § 916.115 Lot stamping. Except when loaded directly into railway cars, exempted under... Inspection Service lot stamp number, assigned by such Service, showing that such fruit has been USDA...

  16. 14 CFR 415.115 - Flight safety. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety. 415.115 Section 415.115... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.115 Flight safety. (a) Flight safety analysis. An applicant's...

  17. 23 CFR 660.115 - Maintenance. (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Maintenance. 660.115 Section 660.115 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS SPECIAL PROGRAMS (DIRECT FEDERAL) Forest Highways § 660.115 Maintenance. The cooperator having jurisdiction over a FH shall...

  18. 40 CFR 40.115-6 - State. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false State. 40.115-6 Section 40.115-6... DEMONSTRATION GRANTS § 40.115-6 State. (a) Under the Federal Water Pollution Control Act, a State, the District... Territory of the Pacific Islands. (b) Under the Resource Conservation and Recovery Act, a State, the...

  19. 46 CFR 403.115 - Accounting period. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting period. 403.115 Section 403.115 Shipping COAST GUARD (GREAT LAKES PILOTAGE), DEPARTMENT OF HOMELAND SECURITY GREAT LAKES PILOTAGE UNIFORM ACCOUNTING SYSTEM General § 403.115 Accounting period. Each Association subject to this part shall maintain...

  20. 21 CFR 131.115 - Concentrated milk. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Concentrated milk. 131.115 Section 131.115 Food... HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.115 Concentrated milk. (a) Description. Concentrated milk is the liquid food obtained by partial removal of water...

  1. 7 CFR 3015.115 - Budget revisions. (United States)


    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Budget revisions. 3015.115 Section 3015.115..., DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Programmatic Changes and Budget Revisions § 3015.115 Budget revisions. (a) Nonconstruction projects. (1) Except as provided in paragraph (a)(2) of...

  2. 46 CFR 115.804 - Machinery. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Machinery. 115.804 Section 115.804 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150 PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS INSPECTION AND CERTIFICATION Material Inspections § 115.804 Machinery. At each initia...

  3. 47 CFR 78.115 - Modulation limits. (United States)


    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Modulation limits. 78.115 Section 78.115... SERVICE Technical Regulations § 78.115 Modulation limits. (a) If amplitude modulation is employed, negative modulation peaks shall not exceed 100 percent modulation. [37 FR 3292, Feb. 12, 1972, as amended...

  4. 32 CFR 11.5 - Definitions. (United States)


    ... 32 National Defense 1 2010-07-01 2010-07-01 false Definitions. 11.5 Section 11.5 National Defense... BY MILITARY COMMISSION § 11.5 Definitions. (a) Combatant immunity. Under the law of armed conflict... intent or organization of the force with which the actor is associated is such that the act or attempted...

  5. 21 CFR 169.115 - French dressing. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false French dressing. 169.115 Section 169.115 Food and... § 169.115 French dressing. (a) Description. French dressing is the separable liquid food or the... fabricated shall be safe and suitable. French dressing contains not less than 35 percent by weight of...

  6. 29 CFR 825.115 - Continuing treatment. (United States)


    ... qualify for FMLA leave even though the employee or the covered family member does not receive treatment... 29 Labor 3 2010-07-01 2010-07-01 false Continuing treatment. 825.115 Section 825.115 Labor... AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.115 Continuing...

  7. 41 CFR 115-1.110 - Deviations. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviations. 115-1.110 Section 115-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.110 Deviations...

  8. 33 CFR 115.40 - Bridge repairs. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bridge repairs. 115.40 Section 115.40 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LOCATIONS AND CLEARANCES; ADMINISTRATIVE PROCEDURES § 115.40 Bridge repairs. Repairs to a bridge which do...

  9. 40 CFR 40.115-1 - Construction. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Construction. 40.115-1 Section 40.115-1... DEMONSTRATION GRANTS § 40.115-1 Construction. May include the preliminary planning to determine the economic and... action necessary to the construction of a facility, the erection, acquisition, alteration, remodeling...

  10. 23 CFR 645.115 - Construction. (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 645.115 Section 645.115 Highways FEDERAL... Relocations, Adjustments, and Reimbursement § 645.115 Construction. (a) Part 635, subpart B, of this title, Force Account Construction (justification required for force account work), states that it is cost...

  11. 34 CFR 668.115 - Prehearing conference. (United States)


    ... 34 Education 3 2010-07-01 2010-07-01 false Prehearing conference. 668.115 Section 668.115... Determinations and Program Review Determinations § 668.115 Prehearing conference. (a) In the event that the hearing official considers a prehearing conference necessary, he may convene a prehearing conference. (b...

  12. Simulation of antimony adsorption on nano-zero valent iron and kaolinite and analyzing the influencing parameters. (United States)

    Saeidnia, Setareh; Asadollahfardi, Gholamreza; Darban, Ahmad Khodadadi; Mohseni, Mehdi


    Antimony is one of the most toxic pollutants in industrial and mineral wastewaters threatening the life of humans and other creatures. We simulated the adsorption of antimony in the presence of nano-zero valent iron (nZVI) adsorbent, on kaolinite and in the presence of nZVI coated on kaolinite from mineral wastewater using VISUAL MINTEQ 3.1 software. Our aim was to determine the factors affecting the adsorption of antimony by applying simulation. The simulation was performed using an adsorption model of a diffuse layer model. The results of the simulation indicated that the nZVI concentration, initial concentrations of antimony and pH factor are effective on the adsorption of antimony. In the conducted stimulation, the optimum pH was 2-5 and the highest adsorption occurred in an acidic state. With increasing initial concentrations of antimony in the simulation, we concluded that nZVI had absorbed various concentrations above 90% and, by increasing the concentration of nZVI, antimony adsorption rate increased. The increased surface area of nZVI and the expansion of more interchangeable surfaces available for reaction with antimony ions causes more antimony ions to be adsorbed. In all cases, the coefficient of determination between the laboratory results and the model predictions that was obtained was more than 0.9.

  13. New fluorescent polymeric nanocomposites synthesized by antimony dodecyl-mercaptide thermolysis in polymer

    Directory of Open Access Journals (Sweden)


    Full Text Available In this work, the formation of semiconductive Sb2S3 nanoparticles inside amorphous polystyrene has been achieved by thermal degradation of the corresponding antimony dodecyl-mercaptide, Sb(SC12H253. The thermolysis of the dodecyl-mercaptide precursor was studied as both pure phase and mercaptide solution in polystyrene. The thermal decomposition of the antimony mercaptide precursor at 350°C, under vacuum, showed the formation of a mixture of antimony trisulfide (stibnite, Sb2S3 and zero-valent antimony (Sb phase. X-ray Powder Diffraction (XRD and Rietveld analysis carried out on the obtained nanostructured powder confirmed the presence of Sb and Sb2S3 phases in 10.4 wt% and 89.6 wt% amount, respectively. The same pyrolysis reaction was carried out in the polymer and the resulting nanocomposite material was characterized by X-ray diffraction (XRD, transmission electron microscopy (TEM, UV-VIS spectroscopy, and fluorescence spectroscopy. The nanocomposite structural characterization indicated the presence of well-dispersed nanoclusters of antimony and stibnite (15–30 nm in size inside the amorphous polymeric phase. Optical measurements on the obtained nanocomposite films showed a strong emission at 432 nm upon excitation at 371 nm, probably related to the presence of Sb2S3 nanoclusters.

  14. Predictors of an unsatisfactory response to pentavalent antimony in the treatment of American visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Santos Mácia A.


    Full Text Available Although treatment of visceral leishmaniasis with pentavalent antimony is usually successful, some patients require second-line drug therapy, most commonly with amphotericin B. To identify the clinical characteristics that predict an inadequate response to pentavalent antimony, a case-control study was undertaken in Teresina, Piaui, Brazil. Over a two-year period, there were 19 cases of VL in which the staff physicians of a hospital prescribed second-line therapy with amphotericin B after determining that treatment with pentavalent antimony had failed. The control group consisted of 97 patients that were successfully treated with pentavalent antimony. A chart review using univariate and multivariate analysis was performed. The cure rate was 90% with amphotericin B. The odds ratio for the prescription of amphotericin B was 10.2 for children less than one year old, compared with individuals aged over 10 years. Patients who presented coinfection had an OR of 7.1 while those on antibiotics had an OR of 2.8. These data support either undertaking a longer course of therapy with pentavalent antimony for children or using amphotericin B as a first-line agent for children and individuals with coinfections. It also suggests that chemoprophylaxis directed toward bacterial coinfection in small children with VL may be indicated.

  15. Mixed Antimony(V Complexes with Different Sugars to Modulate the Oral Bioavailability of Pentavalent Antimonial Drugs

    Directory of Open Access Journals (Sweden)

    Weverson A. Ferreira


    Full Text Available Previous studies have shown that the association of the drug meglumine antimoniate (MA with β-cyclodextrin can improve its bioavailability by the oral route. In this work, ribose and maltose were investigated for their ability to form mixed or association complexes with MA, release MA and modulate the serum levels of Sb after oral administration in mice. Analysis of the MA/ribose composition by high performance liquid chromatography coupled to mass spectrometry (LCMS-IT-TOF revealed the presence of mixed meglumine-Sb-ribose and Sb-ribose complexes. Analysis of the MA/maltose composition suggested the formation of MA-maltose association compounds. Circular dichroism characterization of these compositions following dilution in water at 37 °C suggested a partial and slow dissociation of the association compounds. When the MA/ribose composition was administered orally and compared to MA, the serum concentration of Sb was significantly lower after 1 h and greater after 3 h. On the other hand, the MA/maltose composition showed similar serum Sb concentration after 1 h and higher level of Sb after 3 h, when compared to MA. In conclusion, the present study has demonstrated the formation of mixed or association complexes of MA with sugars, such as maltose and ribose, which promoted sustained serum level of Sb after oral administration.

  16. A comparative study of antimony accumulation in plants growing in two mining areas in Iran, Moghanlo, and Patyar

    NARCIS (Netherlands)

    Hajiani, N.J.; Ghaderian, S.M.; Karimi, N.; Schat, H.


    Antimony occurs locally at high concentrations in some mineralized soils. Very little is known about behavior of antimony in plants. In this study, we analyzed the soil and vegetation of two mining areas in Iran, Patyar, and Moghanlo. Total Sb concentrations in soil were 358–3482 mg/kg in Moghanlo

  17. 34 CFR 97.115 - IRB records. (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false IRB records. 97.115 Section 97.115 Education Office of... of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.115 IRB records... the IRB and the investigators. (5) A list of IRB members in the same detail as described is § 97.103(b...

  18. Study of upscaling possibilities for antimony sulfide solid state sensitized solar cells (United States)

    Nikolakopoulou, Archontoula; Raptis, Dimitrios; Dracopoulos, Vasilios; Sygellou, Lamprini; Andrikopoulos, Konstantinos S.; Lianos, Panagiotis


    Solid state solar cells of inverted structure were constructed by successive deposition of nanoparticulate titania, antimony sulfide sensitizer and P3HT on FTO electrodes with PEDOT:PSS:Ag as counter electrode. Sensitized photoanode electrodes were characterized by XRD, Raman, XPS, FESEM and UV-vis. Small laboratory scale cells were first constructed and optimized. Functional cells were obtained by annealing the antimony sulfide film either in air or in inert atmosphere. High short-circuit currents were recorded in both cases with air-annealed sample producing more current but lower voltage. Small unit cells were combined to form cell modules. Connection of unit cells in parallel increased current but not proportionally to that of the unit cell. Connection in series preserved current and generated voltage multiplication. Cells were constructed and studied under ambient conditions, without encapsulation. The results encourage upscaling of antimony sulfide solar cells.

  19. Anodic stripping voltammetry of antimony using gold nanoparticle-modified carbon screen-printed electrodes

    International Nuclear Information System (INIS)

    Dominguez Renedo, Olga; Arcos Martinez, M. Julia


    Carbon screen-printed electrodes (CSPE) modified with gold nanoparticles present an interesting alternative in the determination of antimony using differential pulse anodic stripping voltammetry. Metallic gold nanoparticles deposits have been obtained by direct electrochemical deposition. Scanning electron microscopy measurements show that the electrochemically synthesized gold nanoparticles are deposited in aggregated form. Any undue effects caused by the presence of foreign ions in the solution were also analyzed to ensure that common interferents in the determination of antimony by ASV. The detection limit for Sb(III) obtained was 9.44 x 10 -10 M. In terms of reproducibility, the precision of the above mentioned method in %R.S.D. values was calculated at 2.69% (n = 10). The method was applied to determine levels of antimony in seawater samples and pharmaceutical preparations

  20. Conceptual design for treatment of mining and metallurgical wastewaters which contains arsenic and antimony

    Directory of Open Access Journals (Sweden)

    Željko Kamberović


    Full Text Available This paper presents a preliminary design for treatment of mining and metallurgical wastewaters (MMW from the basin of antimony “Zajača“, which contains high concentrations of arsenic and antimony. MMW have been investigated in laboratory, due to large difference in concentrations of pollutants. Metallurgical wastewaters were treated using iron (II-sulfate and lime milk used to adjust the pH value at 7. After chemical treatment of metallurgical wastewater and its joining with mining wastewater, residual amount of arsenic in water was below maximum allowed concentrations, while the concentration of antimony, remained above the maximum allowed value. The final phase of purification process was performed using ion exchange resin. After treatment of MMW, they can be used as technical water in the smelting process of secondary raw lead materials.

  1. Enhanced Photoelectrochemical Response from Copper Antimony Zinc Sulfide Thin Films on Transparent Conducting Electrode

    Directory of Open Access Journals (Sweden)

    Prashant K. Sarswat


    Full Text Available Copper antimony sulfide (CAS is a relatively new class of sustainable absorber material, utilizing cost effective and abundant elements. Band gap engineered, modified CAS thin films were synthesized using electrodeposition and elevated temperature sulfurization approach. A testing analog of copper zinc antimony sulfide (CZAS film-electrolyte interface was created in order to evaluate photoelectrochemical performance of the thin film of absorber materials. Eu3+/Eu2+ redox couple was selected for this purpose, based on its relative band offset with copper antimony sulfide. It was observed that zinc has a significant effect on CAS film properties. An enhanced photocurrent was observed for CAS film, modified with zinc addition. A detailed investigation has been carried out by changing stoichiometry, and corresponding surface and optical characterization results have been evaluated. A summary of favorable processing parameters of the films showing enhanced photoelectrochemical response is presented.

  2. Antimony(V) and bismuth(V) complexes of lapachol: synthesis, crystal structure and cytotoxic activity. (United States)

    Oliveira, Ludmila G de; Silva, Meiriane M; Paula, Flávia C S de; Pereira-Maia, Elene C; Donnici, Cláudio L; Simone, Carlos A de; Frézard, Frédéric; Silva, Eufrânio N da; Demicheli, Cynthia


    Antimony(V) and bismuth(V) complexes of lapachol have been synthesized by the reaction of Ph₃SbCl₂ or Ph₃BiCl₂ with lapachol (Lp) and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V) complex is a monomeric derivative, (Lp)(Ph₃Sb)OH, and the bismuth(V) complex is a dinuclear compound bridged by an oxygen atom, (Lp)₂(Ph₃Bi)₂O. Both compounds inhibited the growth of a chronic myelogenous leukemia cell line and the complex of Bi(V) was about five times more active than free lapachol. This work provides a rare example of an organo-Bi(V) complex showing significant cytotoxic activity.

  3. Antimony(V and Bismuth(V Complexes of Lapachol: Synthesis, Crystal Structure and Cytotoxic Activity

    Directory of Open Access Journals (Sweden)

    Cynthia Demicheli


    Full Text Available Antimony(V and bismuth(V complexes of lapachol have been synthesized by the reaction of Ph3SbCl2 or Ph3BiCl2 with lapachol (Lp and characterized by several physicochemical techniques such as IR, and NMR spectroscopy and X-ray crystallography. The compounds contain six-coordinated antimony and bismuth atoms. The antimony(V complex is a monomeric derivative, (Lp(Ph3SbOH, and the bismuth(V complex is a dinuclear compound bridged by an oxygen atom, (Lp2(Ph3Bi2O. Both compounds inhibited the growth of a chronic myelogenous leukemia cell line and the complex of Bi(V was about five times more active than free lapachol. This work provides a rare example of an organo-Bi(V complex showing significant cytotoxic activity.

  4. Genotoxicity studies of heavy metals: lead, bismuth, indium, silver and antimony. (United States)

    Asakura, Keiko; Satoh, Hiroshi; Chiba, Momoko; Okamoto, Masahide; Serizawa, Koji; Nakano, Makiko; Omae, Kazuyuki


    Many kinds of heavy metals are used in industry; thus, it is important for us to clarify their toxicity. For example, lead, which is a component of solder, is notorious for its neurotoxicity, and substitute materials have been sought for many years. Therefore, we examined the genotoxicity of lead and also those of metallic bismuth, indium, silver and antimony which are possible substitutes for lead in solder. Bacterial reverse mutation tests and chromosomal aberration tests in cultured mammalian cells were performed according to standard procedures. Antimony showed genotoxicity in both tests, and bismuth also showed positive results in the chromosomal aberration test. In contrast, lead, indium, and silver were considered to be inactive by the criteria of the present study. Although further studies are needed because of the difficulty of genotoxicity evaluation using an in vitro system, sufficient precautions should be made when antimony and bismuth are used.

  5. On-line lab-in-syringe cloud point extraction for the spectrophotometric determination of antimony. (United States)

    Frizzarin, Rejane M; Portugal, Lindomar A; Estela, José M; Rocha, Fábio R P; Cerdà, Victor


    Most of the procedures for antimony determination require time-consuming sample preparation (e.g. liquid-liquid extraction with organic solvents), which are harmful to the environment. Because of the high antimony toxicity, a rapid, sensitive and greener procedure for its determination becomes necessary. The goal of this work was to develop an analytical procedure exploiting for the first time the cloud point extraction on a lab-in-syringe flow system aiming at the spectrophotometric determination of antimony. The procedure was based on formation of an ion-pair between the antimony-iodide complex and H(+) followed by extraction with Triton X-114. The factorial design showed that the concentrations of ascorbic acid, H2SO4 and Triton X-114, as well as second and third order interactions were significant at the 95% confidence level. A Box-Behnken design was applied to obtain the response surfaces and to identify the critical values. System is robust at the 95% confidence level. A linear response was observed from 5 to 50 µg L(-1), described by the equation A=0.137+0.050C(Sb) (r=0.998). The detection limit (99.7% confidence level), the coefficient of variation (n=5; 15 µg L(-1)) and the sampling rate was estimated at 1.8 µg L(-1), 1.6% and 16 h(-1), respectively. The procedure allows quantification of antimony in the concentrations established by environmental legislation (6 µg L(-1)) and it was successfully applied to the determination of antimony in freshwater samples and antileishmanial drugs, yielding results in agreement with those obtained by HGFAAS at the 95% confidence level. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Purity and crystallinity of microwave synthesized antimony sulfide microrods

    Energy Technology Data Exchange (ETDEWEB)

    Martínez-Alonso, Claudia, E-mail: [Facultad de Química, Universidad Autónoma de Querétaro, Querétaro, Querétaro, 76010 (Mexico); Olivos-Peralta, Eliot U. [Instituto de Energías Renovables, Universidad NacionalAutónoma de México, Temixco, Morelos, 62580 (Mexico); Sotelo-Lerma, Mérida [Universidad de Sonora, Hermosillo, Sonora, 83000 (Mexico); Sato-Berrú, Roberto Y. [Centro de Ciencias Aplicadas y Desarrollo Tecnológico, Universidad Nacional Autónoma de México, MéxicoD.F., 04510 (Mexico); Mayén-Hernández, S.A. [Facultad de Química, Universidad Autónoma de Querétaro, Querétaro, Querétaro, 76010 (Mexico); Hu, Hailin, E-mail: [Instituto de Energías Renovables, Universidad NacionalAutónoma de México, Temixco, Morelos, 62580 (Mexico)


    Antimony sulfide (Sb{sub 2}S{sub 3}) is a promising semiconductor material for solar cell applications. In this work, microrods of Sb{sub 2}S{sub 3} were synthesized by microwave heating with different sulfur sources, solvents, temperature, heating rate, power, and solution concentration. It was found that 90% of stoichiometric Sb{sub 2}S{sub 3} can be obtained with thiourea (TU) or thioacetamide (TA) as sulfur sources and that their optical band gap values were within the range of 1.59–1.60 eV. The most crystalline Sb{sub 2}S{sub 3} were obtained by using TU. The morphology of the Sb{sub 2}S{sub 3} with TU the individual rods were exhibited, whereas rods bundles appeared in TA-based products. The solvents were ethylene glycol (EG) and dimethylformamide (DMF). EG generates more heat than DMF during the microwave synthesis. As a result, the Sb{sub 2}S{sub 3} obtained with EG contained a larger percentage of oxygen and smaller crystal sizes compared to those from DMF. On the other hand, the length and diameter of Sb{sub 2}S{sub 3} microrods can be increased by applying higher heating power although the crystal size did not change at all. In summary, pure and highly crystalline Sb{sub 2}S{sub 3} microrods of 6–10 μm long and 330–850 nm in diameter can be obtained by the microwave method with a careful selection of chemical and thermodynamic parameters of the synthesis. - Highlights: • Purity up to 90% of crystalline Sb{sub 2}S{sub 3} nanorods can be obtained by microwave heating. • The combination of solvent and sulfide type affects crystallinity & purity of Sb2S3. • The high pressure generated in microwave heating helps to form Sb{sub 2}S{sub 3} nanorods.

  7. Levels and risk factors of antimony contamination in human hair from an electronic waste recycling area, Guiyu, China. (United States)

    Huang, Yue; Ni, Wenqing; Chen, Yaowen; Wang, Xiaoling; Zhang, Jingwen; Wu, Kusheng


    The primitive electronic waste (e-waste) recycling has brought a series of environmental pollutants in Guiyu, China. Antimony is one of the important metal contaminants and has aroused the global concerns recently. We aimed to investigate concentrations of antimony in human hair from Guiyu and compared them with those from a control area where no e-waste recycling exists, and assessed the potential risk factors. A total of 205 human hair samples from Guiyu and 80 samples from Jinping were collected for analysis. All volunteers were asked to complete a questionnaire including socio-demographic characteristics and other possible factors related to hair antimony exposure. The concentrations of hair antimony were analyzed using atomic absorption spectrophotometer. Our results indicated that the level of hair antimony in volunteers from Guiyu (median, 160.78; range, 6.99-4412.59 ng/g) was significantly higher than those from Jinping (median, 61.74; range, 2.98-628.43 ng/g). The residents who engaged in e-waste recycling activities in Guiyu had higher hair antimony concentrations than others (P waste recycling. Multiple stepwise regression analysis indicated that hair antimony concentrations were associated with education level (β = -0.064), the time of residence in Guiyu (β = 0.112), living house also served as e-waste workshop (β = 0.099), the work related to e-waste (β = 0.169), and smoking (β = 0.018). The elevated hair antimony concentrations implied that the residents in Guiyu might be at high risk of antimony contamination, especially the e-waste recycling workers. Work related to e-waste recycling activities and long-time residence in Guiyu contributed to the high hair antimony exposure.

  8. Systemic Meglumine Antimoniate in Cutaneous Leishmaniasis of Children: Clinical and Laboratory Complications. (United States)

    Layegh, Pouran; Khademi, Zeinab; Afzal Aghaee, Monavar; Moghiman, Toktam


    Children account for 7%-20% of cutaneous leishmaniasis cases in Iran, but there are few safety data to guide pediatric antiparasitic therapy. We evaluated the clinical and laboratory tolerance of the systemic pentavalent antimonial compound meglumine antimoniate, in 70 Iranian children with cutaneous leishmaniasis. Adverse effects were similar to those seen in adults. © The Author 2014. Published by Oxford University Press on behalf of the Pediatric Infectious Diseases Society. All rights reserved. For Permissions, please e-mail:

  9. Redox speciation analysis of antimony in soil extracts by hydride generation atomic fluorescence spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Fuentes, Edwar; Pinochet, Hugo; Gregori, Ida de E-mail:; Potin-Gautier, Martine


    A sensitive atomic spectrometric method for the redox speciation analysis of antimony in soils is described. The method is based on the selective generation of stibine from Sb(III) in a continuous flow system using atomic fluorescence spectrometry for detection. Sb(V) is masked by citric or oxalic acid in HCl medium. The procedure was optimized with synthetic solutions of Sb(III) and Sb(V). The effect of carboxylic acid and HCl concentration on the recovery of Sb(III) and Sb(V) species from standard solutions, and on the fluorescence signal were studied. Both species were extracted from soil with H{sub 2}O, 0.05 mol l{sup -1} EDTA and 0.25 mol l{sup -1} H{sub 2}SO{sub 4}. Since the soil samples were collected from sites impacted by copper mining activities, the effect of Cu{sup 2+} on the determination of antimony in synthetic solutions and soil extracts was studied. Cu{sup 2+} decreased the Sb(III) signal, but had no effect on the total antimony determination. Therefore, the selective determination of Sb(III) was carried out in citric acid-HCl medium, using the analyte addition technique. Total antimony in soil extracts was determined using the standard calibration technique after reducing Sb(V) to Sb(III) at room temperature with KI-ascorbic acid. The Sb(V) concentration was calculated from the difference between total antimony and Sb(III). The limits of detection (PS Analytical, Excalibur Millennium model) were 17 and 10 ng l{sup -1} for Sb(III) and total antimony, respectively, and the R.S.D. at the 0.5-{mu}g l{sup -1} level were 2.5 and 2.4%, respectively. The total antimony concentration of soils is in the mg kg{sup -1} range; the Sb recovery from the different soils by the extracting solutions was between less than 0.02% and approximately 10%. Similar recoveries were obtained using EDTA and sulfuric acid solutions. Sb(V) was found to be the main antimony species extracted from soils.

  10. Co-doping with antimony to control phosphorous diffusion in germanium

    KAUST Repository

    Tahini, H. A.


    In germanium, phosphorous and antimony diffuse quickly and as such their transport must be controlled in order to design efficient n-typed doped regions. Here, density functional theory based calculations are used to predict the influence of double donor co-doping on the migration activation energies of vacancy-mediated diffusion processes. The migration energy barriers for phosphorous and antimony were found to be increased significantly when larger clusters involving two donor atoms and a vacancy were formed. These clusters are energetically stable and can lead to the formation of even larger clusters involving a number of donor atoms around a vacancy, thereby affecting the properties of devices.

  11. Reaction of Antimony-Uranium Composite Oxide in the Chlorination Treatment of Waste Catalyst - 13521

    International Nuclear Information System (INIS)

    Sawada, Kayo; Hirabayashi, Daisuke; Enokida, Youichi


    The effect of oxygen gas concentration on the chlorination treatment of antimony-uranium composite oxide catalyst waste was investigated by adding different concentrations of oxygen at 0-6 vol% to its chlorination agent of 0.6 or 6 vol% hydrogen chloride gas at 1173 K. The addition of oxygen tended to prevent the chlorination of antimony in the oxide. When 6 vol% hydrogen chloride gas was used, the addition of oxygen up to 0.1 vol% could convert the uranium contained in the catalyst to U 3 O 8 without any significant decrease in the reaction rate compared to that of the treatment without oxygen. (authors)

  12. 33 CFR 104.115 - Compliance. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Compliance. 104.115 Section 104... MARITIME SECURITY: VESSELS General § 104.115 Compliance. (a) Vessel owners or operators must ensure their vessels are operating in compliance with this part. (b) Owners or operators of foreign vessels must comply...

  13. 24 CFR 598.115 - Poverty rate. (United States)


    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Poverty rate. 598.115 Section 598... Requirements § 598.115 Poverty rate. (a) General. In order to be eligible for designation, an area's poverty... poverty rate must be not less than 20 percent; and (2) For at least 90 percent of the census tracts within...

  14. 21 CFR 516.115 - Definitions. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Definitions. 516.115 Section 516.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... the index. Transgenic animal means an animal whose genome contains a nucleotide sequence that has been...

  15. 38 CFR 75.115 - Risk analysis. (United States)


    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Risk analysis. 75.115...) INFORMATION SECURITY MATTERS Data Breaches § 75.115 Risk analysis. If a data breach involving sensitive... analysis or VA's Office of Inspector General conducts an independent risk analysis of the data breach. The...

  16. 46 CFR 115.806 - Electrical. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Electrical. 115.806 Section 115.806 Shipping COAST GUARD....806 Electrical. At each initial and subsequent inspection for certification of a vessel, the owner or managing operator shall be prepared to conduct tests and have the vessel ready for inspection of electrical...

  17. 24 CFR 700.115 - Program costs. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Program costs. 700.115 Section 700... PUBLIC AND INDIAN HOUSING PROGRAMS) CONGREGATE HOUSING SERVICES PROGRAM § 700.115 Program costs. (a) Allowable costs. (1) Allowable costs for direct provision of supportive services includes the provision of...

  18. 19 CFR 115.2 - Application. (United States)


    ... Customs Convention on Containers, 1972, may be accomplished by the competent authority of the country in... 19 Customs Duties 1 2010-04-01 2010-04-01 false Application. 115.2 Section 115.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO...

  19. 49 CFR 209.115 - Hearing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing. 209.115 Section 209.115 Transportation... Hearing. (a) When a hearing is requested and scheduled under § 209.113, a hearing officer designated by the Chief Counsel convenes and presides over the hearing. If requested by respondent and if...

  20. Influence of cooling rate and antimony addition content on graphite morphology and mechanical properties of a ductile iron

    Directory of Open Access Journals (Sweden)

    Liu Zhe


    Full Text Available Cooling rate and inoculation practice can greatly affect the graphite morphology of ductile irons. In the present research, the effects of the cooling rate and antimony addition on the graphite morphology and mechanical properties of ductile irons have been studied. Three ductile iron castings were prepared through solidification under cooling conditions S (slow, M (medium and F (fast. The cooling rates around the equilibrium eutectic temperature (1,150 ℃ for these cooling conditions (S, M and F were set at 0.21 ℃·min-1, 0.32 ℃·min-1 and 0.37 ℃·min-1, respectively. In addition, four ductile iron castings were prepared by adding 0.01%, 0.02%, 0.03% and 0.04% (by weight antimony, respectively under the slow cooling condition. The results show that the nodularity index, tensile strength and hardness of the ductile iron castings without antimony addition are all improved with the increase of cooling rate, while the ductile iron casting solidified under the medium cooling rate possesses the largest number of graphite nodules. Furthermore, for the four antimony containing castings, the graphite morphology and tensile strength are also improved by the antimony additions, and the effect of antimony addition is intensified when the addition increases from 0.01% to 0.03%. Moreover, the rare earth elements (REE/antimony ratio of 2 appears to be the most effective for fine nodular graphite formation in ductile iron.

  1. Effects of spark plasma sintering conditions on the anisotropic thermoelectric properties of bismuth antimony telluride

    DEFF Research Database (Denmark)

    Han, Li; Hegelund Spangsdorf, Steeven; Van Nong, Ngo


    Bismuth antimony telluride (BixSb2-xTe3, 0.4 room-temperature thermoelectric power generation. In this work, p-type Bi0.4Sb1.6Te3 samples were prepared under various conditions (temperature, holding time, and ramp...

  2. Mixing of phosphorus and antimony ions in silicon by recoil implantation

    International Nuclear Information System (INIS)

    Kwok, H.L.; Lam, Y.W.; Wong, S.P.; Poon, M.C.


    The effects of mixing phosphorus and antimony ions in silicon by recoil implantation were examined. The electrical properties after ion mixing were investigated, and the results were compared with those obtained using other techniques. Different degrees of activation were also studied, by investigating the annealing behaviour. (U.K.)

  3. Improvement of hydrogen storage kinetics in ball-milled magnesium doped with antimony

    Czech Academy of Sciences Publication Activity Database

    Čermák, Jiří; Král, Lubomír; Roupcová, Pavla


    Roč. 42, č. 9 (2017), s. 6144-6151 ISSN 0360-3199 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Hydrogen * Hydrogen storage * Storage capacity * Magnesium alloys * Antimony Subject RIV: JJ - Other Materials OBOR OECD: Materials engineering Impact factor: 3.582, year: 2016

  4. Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery. (United States)

    Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric


    Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi 2 Te 3 and (Bi 0,5 Sb 1,5 )Te 3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.


    Directory of Open Access Journals (Sweden)



    Full Text Available Eight new SbF3, SbCl5 and HgX2 (X = Cl, Br amine adducts have been synthesized and their infrared study carried out. Discrete structures have been suggested on the basis of elemental analysis and infrared data, the coordination number of antimony varying from five to nine, while the environment around Hg is tetrahedral.

  6. On the segregation behavior of tin and antimony at grain boundaries of polycrystalline bcc iron

    Czech Academy of Sciences Publication Activity Database

    Lejček, Pavel; Šandera, P.; Horníková, J.; Pokluda, J.; Godec, M.


    Roč. 363, Feb (2016), 140-144 ISSN 0169-4332 R&D Projects: GA ČR GAP108/12/0144 Institutional support: RVO:68378271 Keywords : grain boundary segregation * tin * antimony * Fe based alloy * AES quantification Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.387, year: 2016

  7. Morphology and photoresponse of crystalline antimony film grown on mica by physical vapor deposition

    Directory of Open Access Journals (Sweden)

    Shafa Muhammad


    Full Text Available Antimony is a promising material for the fabrication of photodetectors. This study deals with the growth of a photosensitive thin film by the physical vapor deposition (PVD of antimony onto mica surface in a furnace tube. The geometry of the grown structures was studied via scanning electron microscopy (SEM, X-ray diffraction (XRD, energy-dispersive X-ray spectroscopy (EDX and elemental diffraction analysis. XRD peaks of the antimony film grown on mica mostly matched with JCPDF Card. The formation of rhombohedral crystal structures in the film was further confirmed by SEM micrographs and chemical composition analysis. The Hall measurements revealed good electrical conductivity of the film with bulk carrier concentration of the order of 1022 Ω·cm-3 and mobility of 9.034 cm2/Vs. The grown film was successfully tested for radiation detection. The photoresponse of the film was evaluated using its current-voltage characteristics. These investigations revealed that the photosensitivity of the antimony film was 20 times higher than that of crystalline germanium.

  8. Reaction products and corrosion of molybdenum electrode in glass melt containing antimony oxides and sodium sulfate

    Czech Academy of Sciences Publication Activity Database

    Matěj, J.; Langrová, Anna


    Roč. 56, č. 3 (2012), s. 280-285 ISSN 0862-5468 Institutional support: RVO:67985831 Keywords : antimony oxides * corrosion * glass melt * Molybdenum electrode * sulfate Subject RIV: DD - Geochemistry Impact factor: 0.418, year: 2012

  9. Differences in antimony and arsenic releases from lead smelter fly ash in soils

    Czech Academy of Sciences Publication Activity Database

    Ettler, V.; Mihaljevič, M.; Šebek, O.; Valigurova, R.; Klementová, Mariana


    Roč. 72, Supp. 4 (2012), s. 15-22 ISSN 0009-2819 Institutional research plan: CEZ:AV0Z40320502 Keywords : Antimony * Arsenic * Lead smelting * Fly ash * Soil * Mobility Subject RIV: CA - Inorganic Chemistry Impact factor: 1.351, year: 2012

  10. Diel variation of arsenic, molybdenum and antimony in a stream draining natural As geochemical anomaly

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Nováková, B.; Matoušek, Tomáš; Mihaljevič, M.; Rohovec, Jan; Filippi, Michal


    Roč. 31, APR (2013), s. 84-93 ISSN 0883-2927 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:68081715 ; RVO:67985831 Keywords : arsenic * molybdenum * antimony * trace elements * diel cycle Subject RIV: CB - Analytical Chemistry, Separation; DD - Geochemistry (GLU-S) Impact factor: 2.021, year: 2013

  11. Rancangan Awal Kapal Pukat Cincin 115 Grt


    Halim, Suryadi; Masengi, Kawilarang WA; Pamikiran, Revols DCh


    Merancang kapal merupakan tahapan dalam pembuatan kapal penangkap ikan, termasuk kapal pukat cincin. Penelitian ini dilakukan dengan tujuan memetakan tahapan pem­buatan kapal pukat cincin 115 GRT yang dimulai dengan perancangan awal. Informasi cara perencanaan untuk pembuatan kapal baru sulit didapatkan. Untuk itu diperlukan beberapa hal yang perlu dijawab antara lain bagaimana cara mendesain baru kapal pukat cincin berkapasitas 115 GRT, kecepatan 11 knot dan jumlah pendega 10 orang, serta me...


    Directory of Open Access Journals (Sweden)



    Full Text Available Friday, 27.06.2014 1600-1800 Session 1 „115 Ani de Balneologie la Techirghiol” 1600 – 1620 Drd. Liliana Elena Stanciu, medic specialist Recuperare, Medicină Fizică şi Balneologie, S.B.R.Techirghiol, „Sanatoriul Balnear şi de Recuperare Techirghiol – Unitate sanitară de reper naţional şi internaţional a balneologiei romaneşti” - L. E. Stanciu, C. Oprea, V. Rusu, E. V. Ionescu 1620 - 1640 Director de îngrijiri Carmen Oprea, doctorand kinetoterapeut „Politici de calitate la Sanatoriul Balnear şi de Recuperare Techirghiol” - C. Oprea, L. E. Stanciu, V. Rusu, E. V. Ionescu 1640 - 1700 Conf. Univ. Olga Surdu, medic primar Recuperare, Medicină Fizică şi Balneologie, doctor în Medicină, Universitatea Ovidiu Constanţa, Facultatea de Medicină, S.B.R.Techirghiol „Techirghiol – Privire retrospectivă asupra activităţii ştiinţifice din ultimii 10 ani” - O. Surdu, L. E. Stanciu, V. Marin, T-V Surdu, M. Surdu 1700 - 1730 Adrian Viorel Stan - primar Techirghiol - “Staţiunea Techirghiol – proiecte de dezvoltare” Saturday, 28.06.2014 900 – 1200 Session II „Mud therapy – international scientific news” 900 – 920 Prof.Mufit – Zeki Karagulle, Department of Medical Ecology and Hydroclimatology, Istanbul University, Istanbul Medical Faculty, Turkey “Mud therapy in the management of rheumatic diseases; our experience” - Mine Karagülle* and Müfit Zeki Karagülle** 920 – 940 Prof. Dr. Francisco Maraver - Professional School of Medical Hydrology, Faculty of Medicine, Universidad Complutense de Madrid, Dept. of Physical Medicine and Rehabilitation. Medical Hydrology, Faculty of Medicine, Universidad Complutense Madrid, Thalasso Center, San Pedro del Pinatar-Murcia, Spain “Current state of balneotherapy in Spain” 940 – 1000Assist Prof. Dr.Antonella Fioravanti, Rheumatology Unit - Department of Medicine, Surgery and Neurosciences, University of Siena, Italy “One year effectiveness of mud bath

  13. Carbon paste electrodes modified with a reaction product obtained by hydrolysis of an antimony(III) salt


    Švancara, Ivan; Florescu, Monica; Stočes, Matěj; Baldrianová, Lucie; Svobodová, Eva; Badea, Mihaela


    In this article, a new type of antimony-modified electrode is described based on carbon-paste bulk dispersion of a precipitate obtained by hydrolysis of the respective Sb(III) salt. Subsequently, the resultant electrode (SbOL-CPE in two variants)  operated via the antimony film formed in nascenti at the electrode surface  was subjected to the basic characterisation with respect to its electroanalytical performance in the anodic stripping voltammetry of six heavy metal ions (Z...

  14. On the Effect of Antimony Segregation to the Electronic Properties of InAs/InAsSb Superlattices (Preprint) (United States)


    distribution at the hetero-interfaces engendered by Sb segregation. * Electronic mail: 2 I. INTRODUCTION Reuse After...AFRL-RX-WP-JA-2017-0231 ON THE EFFECT OF ANTIMONY SEGREGATION TO THE ELECTRONIC PROPERTIES OF INAS/INASSB SUPERLATTICES (PREPRINT...December 2016 Interim 11 September 2013 – 12 November 2016 4. TITLE AND SUBTITLE ON THE EFFECT OF ANTIMONY SEGREGATION TO THE ELECTRONIC

  15. Molecular Preadaptation to Antimony Resistance in Leishmania donovani on the Indian Subcontinent. (United States)

    Dumetz, F; Cuypers, B; Imamura, H; Zander, D; D'Haenens, E; Maes, I; Domagalska, M A; Clos, J; Dujardin, J-C; De Muylder, G


    Antimonials (Sb) were used for decades for chemotherapy of visceral leishmaniasis (VL). Now abandoned in the Indian subcontinent (ISC) because of Leishmania donovani resistance, this drug offers a unique model for understanding drug resistance dynamics. In a previous phylogenomic study, we found two distinct populations of L. donovani : the core group (CG) in the Gangetic plains and ISC1 in the Nepalese highlands. Sb resistance was only encountered within the CG, and a series of potential markers were identified. Here, we analyzed the development of resistance to trivalent antimonials (Sb III ) upon experimental selection in ISC1 and CG strains. We observed that (i) baseline Sb III susceptibility of parasites was higher in ISC1 than in the CG, (ii) time to Sb III resistance was higher for ISC1 parasites than for CG strains, and (iii) untargeted genomic and metabolomic analyses revealed molecular changes along the selection process: these were more numerous in ISC1 than in the CG. Altogether these observations led to the hypothesis that CG parasites are preadapted to Sb III resistance. This hypothesis was experimentally confirmed by showing that only wild-type CG strains could survive a direct exposure to the maximal concentration of Sb III The main driver of this preadaptation was shown to be MRPA , a gene involved in Sb III sequestration and amplified in an intrachromosomal amplicon in all CG strains characterized so far. This amplicon emerged around 1850 in the CG, well before the implementation of antimonials for VL chemotherapy, and we discuss here several hypotheses of selective pressure that could have accompanied its emergence. IMPORTANCE The "antibiotic resistance crisis" is a major challenge for scientists and medical professionals. This steady rise in drug-resistant pathogens also extends to parasitic diseases, with antimony being the first anti- Leishmania drug that fell in the Indian subcontinent (ISC). Leishmaniasis is a major but neglected infectious

  16. Selective speciation of inorganic antimony on tetraethylenepentamine bonded silica gel column and its determination by graphite furnace atomic absorption spectrometry. (United States)

    Mendil, Durali; Bardak, Hilmi; Tuzen, Mustafa; Soylak, Mustafa


    A speciation system for antimony (III) and antimony (V) ions that based on solid phase extraction on tetraethylenepentamine bonded silica gel has been established. Antimony was determined by graphite furnace atomic absorption spectrometry (GF-AAS). Analytical conditions including pH, sample volume, etc., were studied for the quantitative recoveries of Sb (III) and Sb (V). Matrix effects on the recovery were also investigated. The recovery values and detection limit for antimony (III) at optimal conditions were found as >95% and 0.020 μg L(-1), respectively. Preconcentration factor was calculated as 50. The capacity of adsorption for the tetraethylenepentamine bonded silica gel was 7.9 mg g(-1). The validation was checked by analysis of NIST SRM 1573a Tomato laves and GBW 07605 Tea certified reference materials. The procedure was successfully applied to speciation of antimony in tap water, mineral water and spring water samples. Total antimony was determined in refined salt, unrefined salt, black tea, rice, tuna fish and soil samples after microwave digestion and presented enrichment method combination. Copyright © 2013 Elsevier B.V. All rights reserved.

  17. Treatment of antimony mine drainage: challenges and opportunities with special emphasis on mineral adsorption and sulfate reducing bacteria. (United States)

    Li, Yongchao; Hu, Xiaoxian; Ren, Bozhi


    The present article summarizes antimony mine distribution, antimony mine drainage generation and environmental impacts, and critically analyses the remediation approach with special emphasis on iron oxidizing bacteria and sulfate reducing bacteria. Most recent research focuses on readily available low-cost adsorbents, such as minerals, wastes, and biosorbents. It is found that iron oxides prepared by chemical methods present superior adsorption ability for Sb(III) and Sb(V). However, this process is more costly and iron oxide activity can be inhibited by plenty of sulfate in antimony mine drainage. In the presence of sulfate reducing bacteria, sulfate can be reduced to sulfide and form Sb(2)S(3) precipitates. However, dissolved oxygen and lack of nutrient source in antimony mine drainage inhibit sulfate reducing bacteria activity. Biogenetic iron oxide minerals from iron corrosion by iron-oxidizing bacteria may prove promising for antimony adsorption, while the micro-environment generated from iron corrosion by iron oxidizing bacteria may provide better growth conditions for symbiotic sulfate reducing bacteria. Finally, based on biogenetic iron oxide adsorption and sulfate reducing bacteria followed by precipitation, the paper suggests an alternative treatment for antimony mine drainage that deserves exploration.

  18. Antimony Influence on Shape of Eutectic Silicium in Al-Si Based Alloys

    Directory of Open Access Journals (Sweden)

    Bolibruchová D.


    Full Text Available Liquid AI-Si alloys are usually given special treatments before they are cast to obtain finer or modified matrix and eutectic structures, leading to improved properties. For many years, sodium additions to hypoeutectic and eutectic AI-Si melts have been recognized as the most effective method of modifying the eutectic morphology, although most of the group IA or IIA elements have significant effects on the eutectic structure. Unfortunately, many of these approaches also have associated several founding difficulties, such as fading, forming dross in presence of certain alloying elements, reduced fluidity, etc. ln recent years, antimony additions to AI-Si castings have attracted considerable attention as an alternative method of refining the eutectic structure. Such additions eliminate many of the difficulties listed above and provide permanent (i.e. non-fading refining ability. In this paper, the authors summarize work on antimony treatment of Al-Si based alloys.

  19. A facile and fast route to prepare antimony (Sb) nanostructures without additives

    KAUST Repository

    Shah, M.A.


    Herein, we report a safe, low cost and reproducible approach for the synthesis of antimony (Sb) nanostructures with most of them having prism like morphology and having well defined faces in the range of ∼70210 nm. The organics free approach is based on a reaction of antimony powder and pure water at ∼210 °C without using any harmful additives and amines. The XRD pattern confirmed the composition and crystallinity of the grown nanostructures. The reported method besides being organics free is economical, fast and free of pollution, which will make it suitable for large scale production. Furthermore, it is well expected that such a technique could be extended to prepare many other important metal and metal oxide nanostructures. The prospects of the process are bright and promising. © 2012 Sharif University of Technology. Production and hosting by Elsevier B.V. All rights reserved.

  20. Evaluation of the efficiency of the processes of purification of antimony to semiconductor grade purity

    International Nuclear Information System (INIS)

    Walis, L.; Rowinska, L.; Panczyk, E.


    A complex of techniques for purification of antimony from arsenic has been examined with the aid of radiotracer 76 As. The investigated processes comprised vacuum distillation, zone melting and remelting of the metal under artificial slags. The purification efficiencies for the above processes were high and amounted to 94% (for 30% of the charge), 50% (for 50% of the charge) and 99.5% (for 60% of the charge), respectively. Attempts were made to determine the kinetics of the separation of arsenic from antimony by distillation. The application of the radioactive tracer made it possible to determine rapidly the distribution of impurities after each stage of the process within a wide concentration range (10 -2 -10 -7 g/g). (author). 7 refs, 4 figs, 6 tabs

  1. Determination by neutron activation analysis of loss of arsenic, antimony, bromine and mercury during lyophilization

    International Nuclear Information System (INIS)

    Carlson, M.; Litman, R.


    Neutron activation analysis has been used to monitor the loss of arsenic, as dimethylarsinic acid, (CH 3 ) 2 AsOOH, or as sodium arsenate (Na 2 HAsO 4 .7H 2 O), antimony (as potassium antimony, tartrate, KSbC 4 O 7 .1/2H 2 O) and bromine (as bromide ion) during lyophilization of acidified and neutral aqueous synthetic and environmental samples. Losses of Sb and As ranged from zero to 60%, while losses of bromine were constant (at 91%) in acidic solutions. The variable losses of As and Sb were due solely to the presence of and partial decomposition of the (CH 3 ) 2 AsOOH. Electrochemical oxidation of Br - to Br 2 is responsible for the high losses of bromine. In addition losses of mercury (as methylmercuric chloride) were 1O0% in both acidic and neutral aqueous synthetic samples during lyophilization. (author)

  2. Reaction of Antimony-Uranium Composite Oxide in the Chlorination Treatment of Waste Catalyst - 13521

    Energy Technology Data Exchange (ETDEWEB)

    Sawada, Kayo [EcoTopia Science Institute (Japan); Hirabayashi, Daisuke; Enokida, Youichi [Department of Materials, Physics and Energy Engineering, Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8603 (Japan)


    The effect of oxygen gas concentration on the chlorination treatment of antimony-uranium composite oxide catalyst waste was investigated by adding different concentrations of oxygen at 0-6 vol% to its chlorination agent of 0.6 or 6 vol% hydrogen chloride gas at 1173 K. The addition of oxygen tended to prevent the chlorination of antimony in the oxide. When 6 vol% hydrogen chloride gas was used, the addition of oxygen up to 0.1 vol% could convert the uranium contained in the catalyst to U{sub 3}O{sub 8} without any significant decrease in the reaction rate compared to that of the treatment without oxygen. (authors)

  3. Synthesis and vibrational spectrum of antimony phosphate, SbPO4. (United States)

    Brockner, Wolfgang; Hoyer, Lars P


    SbPO4 was synthesized via a new route by reacting antimony metal with meta-phosphoric acid, (HPO3)n at high temperatures. The Raman and IR spectra of the title compound were recorded and the vibrational modes assigned on the basis of a factor group analysis. The internal vibrations are derived from tetrahedral PO4 units (approaching Sb[PO4]) by the correlation method, although the structure is polymeric and not ionic.

  4. Preconcentration and Determination of Antimony in Drinking Water Bottled by Modified Nano-Alumina

    Directory of Open Access Journals (Sweden)

    M Mohammad Zakizade


    Full Text Available Abstract Introduction: Antimony trioxide (Sb2O3 has been utilized as a catalyst in polyethylene terephtalate (PET production, and the studies conducted on the bottled water has demonstrated that antimony can be leached from PET bottles into drinking water. Methods: In this study, a simple method was applied in order to determine the trace amount of antimony in bottled drinking water based on preconcentration /solid phase extraction. The nano alumina modified with Schiff base ligand was used in regard with Sb preconcentration. The experiments were performed in a continuous system and HCI was used as eluent of Sb ion. Several chemical and flow variables were optimized for a quantitative preconcentration and determination of Sb ion. The atomic absorption spectroscopy was used to determine Sb ion concentration. In order to study the keeping conditions on the leaching of Sb ion from PET plastic, drinking water bottles were kept in different conditions(room temperature, sunny light and -18˚C. Results: The calibration graph was linear in the range of 0.5 to 15.0 ppm Sb with detection limit of 0.055 ppm. The flow rate of sample was optimized in range of 1.0-9.0 mLmin-1 and Sb ion can be quantitatively eluted at 90 Vsample: Veluent retio. Conclusion: The study results revealed that the modified nano alumina is an effective sorbent in regard with absorbing Sb ion from water and HCI 1M can be used as an appropriate eluent. Maximum leaching of Sb ion is observed when the bottled drinking water was exposed to the sun light. Keywords: Antimony; Bottled drinking water; Modified alumina; Preconcentration

  5. Optical switching property of a light-induced pinhole in antimony thin film (United States)

    Fukaya, Toshio; Tominaga, Junji; Nakano, Takashi; Atoda, Nobufumi


    Optical near-field recording, called a super-resolution near-field structure, records and retrieves small marks beyond the diffraction limit. A thin layer of an antimony (Sb) film, added to the usual phase-change optical disk, is the key material of this technique. Nonlinear optical properties of an Sb film, especially optical switching, were studied in the stationary state using a nanosecond pulse laser. Clear switching was observed under microscopic measurement.

  6. Antimony in the Contaminated Site of El Triunfo, Baja California Sur, Mexico

    Directory of Open Access Journals (Sweden)

    Marmolejo-Rodríguez A. J.


    Full Text Available Antimony has properties similar to arsenic with some of its compounds toxic to humans. Therefore it is necessary to control the wastes accumulated by anthropogenic activities, such as mining, where it is in tailings to be released to the environment. According to the Environment Protection Agency, the maximum value in sediments is 11.2 mg Sb kg–1 and the Earth’s crust average is 0.2 mg Sb kg–1. In this semiarid area, the drainage basin El Carrizal is impacted with wastes of an abandoned gold mine at the Mining District El Triunfo (MD – ET which have tailings with 17,600 mg kg–1 of antimony. In the main dry river (arroyo, the Sb content is between 0.6 and 122 mg kg–1. This element is transported from the source throughout the fluvial basin to discharge into the Pacific Ocean. In the arroyo mouth we collected one sedimentary core and the sediment from dunes (28.6 – 45.7 and 6.43 – 7.74 mg Sb kg–1. This research concluded the antimony is enriched in this semiarid system, with Normalized Enrichment Factors severely enriched mainly in arroyo sediments close to the MD-ET


    Directory of Open Access Journals (Sweden)

    Ganden Supriyanto


    Full Text Available A novel method is proposed for the hydride separation when determinining of arsenic and antimony by AAS. A chromatomembrane cell was used as preconcentration-, extraction- and separation-manifold instead of the U-tube phase separator, which is normally fitted in continuous flow vapour systems generating conventionaly the hydrides. The absorbances of the hydrides produced were measured by an atomic absorption spectrophotometer at 193.7 nm and 217.6 nm. Under optimized analytical conditions, the calibration plot for arsenic was linear from 50 to 500 ng.mL-1 (r2 = 0.9982. The precision for three subsequent measurements of 500 ng.mL-1 arsenic gave rise to a relative standard deviation of 0.4%. The detection limit was 15 ng.mL-1, which is much lower compared with that of the conventional hydride system (2000 ng.mL-1. A similar result was observed in case of antimony: the detection limit was 8 ng.mL-1 when the proposed method was applied. Consequently, the sensitivity of the novel method surpasses systems with conventional hydride generation, i.e. the precision and the acuracy increase whereas the standard deviation and the detection limit decrease. The proposed method was applied in pharmacheutial analysis and the certified As-content of a commercial product was very sufficiently confirmed.   Keywords: Chromatomembrane Cell, Hydride separation, Arsenic detection, Antimony detection, AAS

  8. Sequestration of Antimony on Calcite Observed by Time-Resolved Nanoscale Imaging. (United States)

    Renard, François; Putnis, Christine V; Montes-Hernandez, German; King, Helen E; Breedveld, Gijs D; Okkenhaug, Gudny


    Antimony, which has damaging effects on the human body and the ecosystem, can be released into soils, ground-, and surface waters either from ore minerals that weather in near surface environments, or due to anthropogenic releases from waste rich in antimony, a component used in batteries, electronics, ammunitions, plastics, and many other industrial applications. Here, we show that dissolved Sb can interact with calcite, a widespread carbonate mineral, through a coupled dissolution-precipitation mechanism. The process is imaged in situ, at room temperature, at the nanometer scale by using an atomic force microscope equipped with a flow-through cell. Time-resolved imaging allowed following the coupled process of calcite dissolution, nucleation of precipitates at the calcite surface and growth of these precipitates. Sb(V) forms a precipitate, whereas Sb(III) needs to be oxidized to Sb(V) before being incorporated in the new phase. Scanning-electron microscopy and Raman spectroscopy allowed identification of the precipitates as two different calcium-antimony phases (Ca 2 Sb 2 O 7 ). This coupled dissolution-precipitation process that occurs in a boundary layer at the calcite surface can sequester Sb as a solid phase on calcite, which has environmental implications as it may reduce the mobility of this hazardous compound in soils and groundwaters.

  9. Antimony sulfide thin films prepared by laser assisted chemical bath deposition

    Energy Technology Data Exchange (ETDEWEB)

    Shaji, S., E-mail: [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolás de los Garza, Nuevo León, 66455 (Mexico); CIIDIT—Universidad Autónoma de Nuevo León, Apodaca, Nuevo León (Mexico); Garcia, L.V. [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolás de los Garza, Nuevo León, 66455 (Mexico); Loredo, S.L. [Centro de Investigación en Materiales Avanzados (CIMAV), Unidad Monterrey, PIIT, Apodaca, Nuevo León (Mexico); Krishnan, B. [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolás de los Garza, Nuevo León, 66455 (Mexico); CIIDIT—Universidad Autónoma de Nuevo León, Apodaca, Nuevo León (Mexico); and others


    Highlights: • Antimony sulfide thin films were prepared by normal CBD and laser assisted CBD. • Characterized these films using XRD, XPS, AFM, optical and electrical measurements. • Accelerated growth was observed in the laser assisted CBD process. • These films were photoconductive. - Abstract: Antimony sulfide (Sb{sub 2}S{sub 3}) thin films were prepared by laser assisted chemical bath deposition (LACBD) technique. These thin films were deposited on glass substrates from a chemical bath containing antimony chloride, acetone and sodium thiosulfate under various conditions of normal chemical bath deposition (CBD) as well as in-situ irradiation of the chemical bath using a continuous laser of 532 nm wavelength. Structure, composition, morphology, optical and electrical properties of the Sb{sub 2}S{sub 3} thin films produced by normal CBD and LACBD were analyzed by X-Ray diffraction (XRD), Raman Spectroscopy, Atomic force microscopy (AFM), X-Ray photoelectron spectroscopy (XPS), UV–vis spectroscopy and Photoconductivity. The results showed that LACBD is an effective synthesis technique to obtain Sb{sub 2}S{sub 3} thin films for optoelectronic applications.

  10. pH-regulated antimony oxychloride nanoparticle formation on titanium oxide nanostructures: a photocatalytically active heterojunction

    KAUST Repository

    Buchholcz, Balázs


    Improving the catalytic activity of heterogeneous photocatalysts has become a hot topic recently. To this end, considerable progress has been made in the efficient separation of photogenerated charge carriers by e.g. the realization of heterojunction photocatalysts. V-VI-VII compound semiconductors, namely, bismuth oxyhalides, are popular photocatalysts. However, results on antimony oxyhalides [SbOX (X = Br, Cl, I)], the very promising alternatives to the well-known BiOX photomodifiers, are scarce. Here, we report the successful decoration of titanium oxide nanostructures with 8-11 nm diameter SbOX nanoparticles for the first time ever. The product size and stoichiometry could be controlled by the pH of the reactant mixture, while subsequent calcination could transform the structure of the titanate nanotube (TiONT) support and the prepared antimony oxychloride particles. In contrast to the ease of composite formation in the SbOX/TiONT case, anatase TiO could not facilitate the formation of antimony oxychloride nanoparticles on its surface. The titanate nanotube-based composites showed activity in a generally accepted quasi-standard photocatalytic test reaction (methyl orange dye decolorization). We found that the SbOCl/TiONT synthesized at pH = 1 is the most active sample in a broad temperature range.

  11. Increased parasite surface antigen-2 expression in clinical isolates of Leishmania donovani augments antimony resistance. (United States)

    Bhandari, Vasundhra; Kumar, Dhiraj; Verma, Sandeep; Srividya, Gurumurthy; Negi, Narendra Singh; Singh, Ruchi; Salotra, Poonam


    Resistance to sodium antimony gluconate (SAG) is a major cause of therapeutic failure in a large proportion of visceral leishmaniasis (VL) cases. Determinants of SAG resistance have been widely studied; however, the mechanism operating in clinical isolates is poorly understood. In the present study, expression of parasite surface antigen-2 (PSA-2) gene was studied in clinical isolates of Leishmania donovani comprising of antimony resistant (n=10) and sensitive (n=4) parasites. The expression of PSA-2 gene was found to be consistently high in SAG resistant clinical isolates (≥1.5-fold) at both transcript and protein level. Further, over-expression of PSA-2 in L. donovani isolates (LdPSA-2(++)) resulted in conversion of SAG sensitive phenotype to resistant. The LdPSA-2(++) parasites showed significantly decreased susceptibility towards SAG (>12-fold), amphotericin B (>4-fold) and miltefosine (>2.5-fold). Marked decrease in antimony accumulation and enhanced tolerance towards complement mediated lysis was evident in LdPSA-2(++) parasites. The study established the role of PSA-2 gene in SAG resistance and its potential as a biomarker to distinguish resistant and sensitive clinical isolates of L. donovani. Copyright © 2013 Elsevier Inc. All rights reserved.

  12. Parto prematuro após uso de antimonial pentavalente: relato de um caso Premature birth after the use of pentavalent antimonial: case report

    Directory of Open Access Journals (Sweden)

    Bruna Pinheiro Silveira


    Full Text Available Relata-se o caso de uma mulher de 19 anos, na 24ª semana de gravidez e com leishmaniose visceral. Tratada com antimonial pentavalente na posologia de 850mg/dia por 20 dias, ocorreu parto prematuro no quinto dia de tratamento e óbito da criança um dia após nascimento. Considerando a importância da protozoose no nosso meio e a raridade da associação com a gestação, julgamos de interesse a publicação do caso.A case is reported of a 19-year-old woman, at week 24 of gestation, with visceral leishmaniosis. She was treated with meglumine antimoniate at a dose of 850mg/day for 20 days. There occurred premature birth on day five of treatment and the neonate died one day after birth. Considering the importance of protozoiasis in our population and the rarity of the association with pregnancy, we resolved to publish the case.

  13. 27 CFR 21.115 - Kerosene (deodorized). (United States)


    ....115 Kerosene (deodorized). (a) Distillation range. No distillate should come over below 340 °F. and none above 570 °F. (b) Flash point. 155 °F. minimum. [T.D. ATF-133, 48 FR 24673, June 2, 1983...

  14. 40 CFR 1042.115 - Other requirements. (United States)


    ... 1042.115 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM NEW AND IN-USE MARINE COMPRESSION-IGNITION ENGINES AND VESSELS Emission... its useful life, except as follows: (1) Engines may discharge crankcase emissions to the ambient...

  15. Proceedings (Chemical Sciences) Volume 115, 2003

    Indian Academy of Sciences (India)


    Proceedings (Chemical Sciences). Volume 115, 2003. 800. AUTHOR INDEX. Abdullah A see Sen P. 499. Abinandanan T A see Chattopadhyay K. 727. Adinarayana M see Swaraga M Sudha. 123. Anand V G. Heptaphyrins: Expanded porphyrins with seven heterocyclic rings. 711. Ananthakrishnan G see Yashonath S. 543.

  16. 7 CFR 900.115 - Hearing. (United States)


    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Governing Meetings To Arbitrate and Mediate Disputes Relating to Sales of Milk or Its Products § 900.115... arbitrator may request the opinions of economists, marketing specialists, statisticians, lawyers, accountants...

  17. 45 CFR 46.115 - IRB records. (United States)


    ... following: (1) Copies of all research proposals reviewed, scientific evaluations, if any, that accompany the proposals, approved sample consent documents, progress reports submitted by investigators, and reports of... for Protection of Human Research Subjects § 46.115 IRB records. (a) An institution, or when...

  18. 40 CFR 26.115 - IRB records. (United States)


    ... IRB activities, including the following: (1) Copies of all research proposals reviewed, scientific evaluations, if any, that accompany the proposals, approved sample consent documents, progress reports... Policy for Protection of Subjects in Human Research Conducted or Supported by EPA § 26.115 IRB records...

  19. 40 CFR 40.115-4 - Municipality. (United States)


    ... 208 of the act. (b) Under the Resource Conservation and Recovery Act, a city, town, borough, county... subdivision thereof. (c) In all other cases, a city, town, borough, county, parish, district, or other public... DEMONSTRATION GRANTS § 40.115-4 Municipality. (a) Under the Federal Water Pollution Control Act, a city, town...

  20. 46 CFR 115.670 - Tailshaft examinations. (United States)


    ... Tailshaft Examinations § 115.670 Tailshaft examinations. (a) The marine inspector may require any part or all of the propeller shafting to be drawn for examination of the shafting and stern bearing of a vessel whenever the condition of the shafting and bearings are in question. (b) The marine inspector may...

  1. Screening and Diagnostic Mammographic Findings Of 115 ...

    African Journals Online (AJOL)

    Mammography is the technique of examination of the breast utility low energy radiation in the range 20- 35KV. At these energy ranges it is possible to obtain high resolution films on which fat can be clearly distinguished from other soft tissue densities. Mammographic findings in 115 consecutive Nigeria women aged 18 - 65 ...

  2. 24 CFR 35.115 - Exemptions. (United States)


    ... of “housing for the elderly” and “expected to reside” in § 35.110). (4) Residential property found... Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development LEAD... and Definitions for All Programs. § 35.115 Exemptions. (a) Subparts B through R of this part do not...

  3. 49 CFR 214.115 - Foot protection. (United States)


    ... shock or burns, or other hazardous condition. (b) Safety-toe footwear for railroad bridge workers shall conform to the national consensus standards for safety-toe footwear (American National Standards Institute..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Bridge Worker Safety Standards § 214.115 Foot...

  4. Increased biliary excretion of glutathione is generated by the glutathione-dependent hepatobiliary transport of antimony and bismuth. (United States)

    Gyurasics, A; Koszorús, L; Varga, F; Gregus, Z


    We have recently demonstrated that the hepatobiliary transport of arsenic is glutathione-dependent and is associated with a profound increase in biliary excretion of glutathione (GSH), hepatic GSH depletion and diminished GSH conjugation (Gyurasics A, Varga F and Gregus Z, Biochem Pharmacol 41: 937-944 and Gyurasics A, Varga F and Gregus Z, Biochem Pharmacol 42: 465-468, 1991). The present studies in rats aimed to determine whether antimony and bismuth, other metalloids in group Va of the periodic table, also possess similar properties. Antimony potassium tartrate (25-100 mumol/kg, i.v.) and bismuth ammonium citrate (50-200 mumol/kg, i.v.) increased up to 50- and 4-fold, respectively, the biliary excretion of non-protein thiols (NPSH). This resulted mainly from increased hepatobiliary transport of GSH as suggested by a close parallelism in the biliary excretion of NPSH and GSH after antimony or bismuth administration. Within 2 hr, rats excreted into bile 55 and 3% of the dose of antimony (50 mumol/kg, i.v.) and bismuth (150 mumol/kg, i.v.), respectively. The time courses of the biliary excretion of these metalloids and NPSH or GSH were strikingly similar suggesting co-ordinate hepatobiliary transport of the metalloids and GSH. However, at the peak of their excretion, each molecule of antimony or bismuth resulted in a co-transport of approximately three molecules of GSH. Diethyl maleate, indocyanine green and sulfobromophthalein (BSP), which decreased biliary excretion of GSH, significantly diminished excretion of antimony and bismuth into bile indicating that hepatobiliary transport of these metalloids is GSH-dependent. Administration of antimony, but not bismuth, decreased hepatic GSH level by 30% and reduced the GSH conjugation and biliary excretion of BSP. These studies demonstrate that the hepatobiliary transport of trivalent antimony and bismuth is GSH-dependent similarly to the hepatobiliary transport of trivalent arsenic. Proportionally to their biliary

  5. Biodistribution of meglumine antimoniate in healthy and Leishmania (Leishmania infantum chagasi-infected BALB/c mice

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema


    Full Text Available Pentavalent antimonials such as meglumine antimoniate (MA are the primary treatments for leishmaniasis, a complex disease caused by protozoan parasites of the genus Leishmania . Despite over 70 years of clinical use, their mechanisms of action, toxicity and pharmacokinetics have not been fully elucidated. Radiotracer studies performed on animals have the potential to play a major role in pharmaceutical development. The aims of this study were to prepare an antimony radiotracer by neutron irradiation of MA and to determine the biodistribution of MA in healthy and Leishmania (Leishmania infantum chagasi-infected mice. MA (Glucantime(r was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes, 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This irradiated compound presented anti-leishmanial activity similar to that of non-irradiated MA in both in vitro and in vivo evaluations. In the biodistribution studies, healthy mice showed higher uptake of antimony in the liver than infected mice and elimination occurred primarily through biliary excretion, with a small proportion of the drug excreted by the kidneys. The serum kinetic curve was bi-exponential, with two compartments: the central compartment and another compartment associated with drug excretion. Radiotracers, which can be easily produced by neutron irradiation, were demonstrated to be an interesting tool for answering several questions regarding antimonial pharmacokinetics and chemotherapy.

  6. Development of an analytical method for antimony speciation in vegetables by HPLC-hydride generation-atomic fluorescence spectrometry. (United States)

    Olivares, David; Bravo, Manuel; Feldmann, Jorg; Raab, Andrea; Neaman, Alexander; Quiroz, Waldo


    A new method for antimony speciation in terrestrial edible vegetables (spinach, onions, and carrots) was developed using HPLC with hydride generation-atomic fluorescence spectrometry. Mechanical agitation and ultrasound were tested as extraction techniques. Different extraction reagents were evaluated and optimal conditions were determined using experimental design methodology, where EDTA (10 mmol/L, pH 2.5) was selected because this chelate solution produced the highest extraction yield and exhibited the best compatibility with the mobile phase. The results demonstrated that EDTA prevents oxidation of Sb(III) to Sb(V) and maintains the stability of antimony species during the entire analytical process. The LOD and precision (RSD values obtained) for Sb(V), Sb(III), and trimethyl Sb(V) were 0.08, 0.07, and 0.9 microg/L and 5.0, 5.2, and 4.7%, respectively, for a 100 microL sample volume. The application of this method to real samples allowed extraction of 50% of total antimony content from spinach, while antimony extracted from carrots and onion samples ranged between 50 and 60 and 54 and 70%, respectively. Only Sb(V) was detected in three roots (onion and spinach) that represented 60-70% of the total antimony in the extracts.

  7. Separation of sup(115m)In from mother 115Cd

    International Nuclear Information System (INIS)

    Kersulis, V.J.


    The methods of the accelerated isolation of the metallic sup(115m)In from the mother solution of 115 Cd were worked out. The sample was dissolved in the concentrated HCl with the presence of H 2 O 2 . After the injection of 5 mg (recalculated for the metallic In) of the carrier, the solution was evaporated dry, the remainder was dissolved in 2n HCl. The obtained solution was lead through an ion-exchange column (9 mm in diameter and with the 250 mm height of the layer with the anionite Dowex 2x8 (50-100 mesh). The sup(115m)In was eluated by 0.15n HCl, and 115 Cd - by 1.5n HCl. Radiochemical purity of the sup(115m)In was not less than 99.99%. The isolation of the sup(115m)In from the eluent (alkalined up to ph=2.3) was carried out electrochemically during approximately 1 hour on the platinum cathode at high (400 mA/cm 2 ) cathode density of current

  8. Highly active and stable Pt electrocatalysts promoted by antimony-doped SnO2 supports for oxygen reduction reactions

    DEFF Research Database (Denmark)

    Yin, Min; Xu, Junyuan; Li, Qingfeng


    Alternative composite supports for platinum catalysts were synthesized from antimony doped tin dioxide (ATO) nanoparticles. In the range of the antimony content from 0 to 11mol%, the highest electrical conductivity of 1.1Scm-1 at 130°C was obtained for the 5mol% Sb ATO, from which composite suppo...

  9. Leishmaniose cutânea com desfecho fatal durante tratamento com antimonial pentavalente American cutaneous leishmaniasis with fatal outcome during pentavalent antimoniate treatment

    Directory of Open Access Journals (Sweden)

    Meiri Vanderlei Nogueira de Lima


    Full Text Available Os autores relatam o caso de paciente de 58 anos, hipertensa e diabética, com diagnóstico de leishmaniose tegumentar americana, tratada com antimoniato de N-metil-glucamina (15mg SbV/kg/dia, acompanhada pelo serviço de atenção básica em saúde e que evoluiu para óbito no 18º dia de tratamento.The authors report a case of a 58 years-old, hypertensive, diabetic female patient, with the diagnosis of American cutaneous leishmaniasis, undergoing treatment with Nmethyl glucamine antimoniate (15mg SbV/Kg/day. She was followed up by the basic health care service, but has died on the 18th treatment day.

  10. Development of 115Cd/115mln generator for industrial and environmental applications

    International Nuclear Information System (INIS)

    Camargo, Fernanda Cristina Fonseca


    Indium isotopes, 111 In, '1 13 ln and 115 In are widely used as radiotracers in industrial and environmental applications. 113m ln generators can be found in the international market. However they are manufactured by only a few companies worldwide, are rated at rather high prices and not always are available for sale (they are frequently manufactured only upon request). Hence it is of interest to produce the equipment in the country in which it will be used, especially if the parent nuclide can be also produced there. In Brazil, the ideal situation would be to produce a 115 Cd/ 115m In generator, whose target precursor is the '1 14 Cd. Preliminary tests using non-enriched and inactive CdO were developed. The parent and daughter nuclides were separated flowing the eluate containing the chemical species Cd (II) and In (III) through ion exchange resins, Ag11A8, Chelex100 and Oowex 1 x8. 0.1 M, 1 M and 2M HCI and 2M HCI + 0.1 M NH 4 CI solutions were tested as the eluant. The amount of Cd (l I) and In (III) eluted were determined by ICP-AES. The irradiation conditions of the target 114 CdO were defined according to the neutron flux provided TRIGA MARK-I-R IPR reactor and the nuclear properties the of target. After to preliminary tests with the 115 Cd/ 115m In pair, column experiments were developed. Analyses were accomplished by gamma spectrometry to determine the presence of the 115 Cd and 115m ln nuclides in the fractions eluted. Tests using the resin AG IIA8 and HCI I M eluent solution resulted in 100% adsorption of the Cd (11) and nearly 50% elution of In (III), corresponding to the best conditions for elution. Exposure to radiation can damage the resins, as the decrease in ion exchange capacity and change in volume of the polymer grains. Thus, columns packed with the chosen resin were exposed to radiation doses from 15 to 200 Gy, and eluted with the most effective eluent. The results showed that radiation does not change the adsorption capacity of Cd (II) by the

  11. Synthesis, characterization and single crystal X-ray analysis of chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III

    Directory of Open Access Journals (Sweden)

    H.P.S. Chauhan


    Full Text Available The title compound chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III has been prepared in distilled acetonitrile and characterized by physicochemical [melting point and molecular weight determination, elemental analysis (C, H, N, S & Sb], spectral [FT–IR, far IR, NMR (1H & 13C] studies. The crystal and molecular structure was further confirmed using single crystal X-ray diffraction analysis which features a five-coordinate geometry for antimony(III within a ClS4 donor set. The distortion in the co-planarity of ClSbS3 evidences the stereochemical influence exerts by the lone pair of electrons on antimony(III. Two centrosymmetrically related molecule held together via C–H···Cl secondary interaction result in molecular aggregation of the compound.

  12. Selective liquid-liquid extraction of antimony(III from hydrochloric acid media by N-n-octylaniline in xylene

    Directory of Open Access Journals (Sweden)

    M. A. ANUSE


    Full Text Available N-n-Octylaniline in xylene was used for the extraction separation of antimony(III from hydrochloric acid media. Antimony(III was extracted quantitatively with 10 mL 4 % N-n-octylaniline in xylene. It was stripped from the organic phase with 0.5 M ammonia and estimated photometrically by the iodide method. The effect of metal ion, acid, reagent concentration and various foreign ions was investigated. The method affords binary and ternary separation of antimony(III from tellurium(IV, selenium(IV, lead(II, bismuth(III, tin(IV, germanium(IV, copper(II, gold(III, iron(III and zinc(II. The method is applicable for the analysis of synthetic mixtures, alloys and semiconductor thin films. It is fast, accurate and precise.

  13. Nanoscaled hydrated antimony (V oxide as a new approach to first-line antileishmanial drugs

    Directory of Open Access Journals (Sweden)

    Franco AMR


    Full Text Available Antonia MR Franco,1 Iryna Grafova,2 Fabiane V Soares,1,3 Gennaro Gentile,4 Claudia DC Wyrepkowski,1,3 Marcos A Bolson,5 Ézio Sargentini Jr,5 Cosimo Carfagna,4 Markku Leskelä,2 Andriy Grafov2 1Laboratory of Leishmaniasis and Chagas Disease, National Institute of Amazonian Research (INPA, Manaus, Amazonas, Brazil; 2Department of Chemistry, University of Helsinki, Helsinki, Finland; 3Multi-Institutional Post-Graduate Program in Biotechnology, Federal University of Amazonas, Manaus, Amazonas, Brazil; 4Institute for Polymers, Composites, and Biomaterials, National Research Council, Pozzuoli, Naples Province, Italy; 5Laboratory of Environmental Chemistry, National Institute of Amazonian Research (INPA, Manaus, Amazonas, Brazil Background: Coordination compounds of pentavalent antimony have been, and remain, the first-line drugs in leishmaniasis treatment for >70 years. Molecular forms of Sb (V complexes are commercialized as sodium stibogluconate (Pentostam® and meglumine antimoniate (MA (Glucantime®. Ever-increasing drug resistance in the parasites limits the use of antimonials, due to the low drug concentrations being administered against high parasitic counts. Sb5+ toxicity provokes severe side effects during treatment. To enhance therapeutic potency and to increase Sb (V concentration within the target cells, we decided to try a new active substance form, a hydrosol of Sb2O5⋅nH2O nanoparticles (NPs, instead of molecular drugs. Methodology/principal findings: Sb2O5⋅nH2O NPs were synthesized by controlled SbCl5 hydrolysis in a great excess of water. Sb2O5⋅nH2O phase formation was confirmed by X-ray diffraction. The surface of Sb (V NPs was treated with ligands with a high affinity for target cell membrane receptors. The mean particle size determined by dynamic light scattering and transmission electron microscopy was ~35–45 nm. In vitro tests demonstrated a 2.5–3 times higher antiparasitic activity of Sb (V nanohybrid hydrosols

  14. Leachability of antimony from energy ashes. Total contents, leachability and remedial suggestions; Lakning av antimon fraan energiaskor. Totalhalter, lakbarhet samt foerslag till aatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Baeckstroem, Mattias [Oerebro Univ. (Sweden)


    In the current project total concentrations for antimony in 31 energy ashes have been compiled. The average concentration of antimony in boiler fly ash and grate boiler fly ash is 192 and 1,140 mg/kg, respectively. The corresponding antimony concentrations for boiler ashes and grate bottom ashes are 86,5 and 61,8 mg/kg, respectively. Multivariate calculations clearly pointed out waste as the major source for antimony in ashes. The difference between total antimony concentration in fly ash and bottom ash is greatest for grate boilers, in average 18 times higher in the fly ash. The difference for CFB/BFB-boilers is only slightly more than 2. However, based on amount, 75% of the total antimony inventory is recovered in the fly ashes for both CFB/BFB and grate boilers. Eleven (eight of which were bottom ashes) out of the 31 samples exceeded the guidelines for inert waste. It is clear that the higher ionic strength in the solutions from the fly ashes contribute to decrease the solubility for critical minerals retaining antimony. In addition, the fly ashes have considerably larger effective surface able to sorb trace elements. A clear and positive covariance was discovered between aluminium and antimony. Furthermore, it was noted that antimony showed no typical anionic behaviour despite the fact that it according to the geochemical calculations should be present as SbO{sub 3}{sup -}. At L/S 10, a maximum of 1% of the total antimony concentration is leached. This should be compared to chloride that had 94% of the total concentration leached at L/S 10. There was no correlation between the leached antimony concentrations and the total antimony concentrations. The sequential extractions also suggest a low leachability for antimony from the ashes. In average only 9,6% is released at pH 7, 7,3% at pH 5, 3,6% during reducing conditions and 3,2% during oxidising conditions. In total, only 24% of the total antimony concentrations is released during the four extraction steps. The

  15. Field-portable-XRF reveals the ubiquity of antimony in plastic consumer products. (United States)

    Turner, Andrew; Filella, Montserrat


    Very little systematic information exists on the occurrence and concentrations of antimony (Sb) in consumer products. In this study, a Niton XL3t field-portable-X-ray fluorescence (FP-XRF) spectrometer was deployed in situ and in the laboratory to provide quantitative information on Sb dissipated in plastic items and fixtures (including rubber, textile and foamed materials) from the domestic, school, vehicular and office settings. The metalloid was detected in 18% of over 800 measurements performed, with concentrations ranging from about 60 to 60,000μgg -1 . The highest concentrations were encountered in white, electronic casings and in association with similar concentrations of Br, consistent with the use of antimony oxides (e.g. Sb 2 O 3 ) as synergistic flame retardants. Concentrations above 1000μgg -1 , and with or without Br, were also encountered in paints, piping and hosing, adhesives, whiteboards, Christmas decorations, Lego blocks, document carriers, garden furniture, upholstered products and interior panels of private motor vehicles. Lower concentrations of Sb were encountered in a wide variety of items but its presence (without Br) in food tray packaging, single-use drinks bottles, straws and small toys were of greatest concern from a human health perspective. While the latter observations are consistent with the use of antimony compounds as catalysts in the production of polyethylene terephthalate, co-association of Sb and Br in many products not requiring flame retardancy suggests that electronic casings are widely recycled. Further research is required into the mobility of Sb when dissipated in new, recycled and aged polymeric materials. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Dual mode antimony electrode for simultaneous measurements of PO2 and pH. (United States)

    Sjöberg, F; Nilsson, G


    In biomedical research and clinical medicine there is a demand for potent sensors to measure the components that make up blood gas analyses. Today, as when the electrochemical PO2, PCO2 and pH electrodes were first introduced, these measurements are usually made with the same type of sensor technology. The aims of the present study were, firstly, to find out whether the platinum cathode in the Clark electrode can be replaced by antimony for oxygen measurements (amperometry (A)); secondly, whether, during oxygen measurements, the inherent corrosion potential of the antimony metal can be used for measurement of pH in the same measurement area (potentiometry (P)). An electrode of purified, crystallographically orientated monocrystalline antimony (COMA) connected to a reference electrode (silver-silver chloride) was used for the P measurements. Measurements of A (at -900 mV) and P were made in an aqueous environment regulated for oxygen, pH, and temperature. Reproducible oxygen sensitivities of 0.925 nA/% oxygen (2% CV (coefficient of variation)) (A), 10.7 mV/% (P), and 0.7 mV/% (P) were found in the oxygen range: 0-21%, <5%, and above 5%, respectively. The pH sensitivity was 57 mV/pH unit (P). Oxygen and pH measurements were less accurate at oxygen concentrations close to 0%. Both the oxygen and pH part of the composite electrode signal can be identified by this dual mode technique (A and P). The sensor seems to be promising as it provides measurements of two separate variables (oxygen and pH) and also has the desirable characteristics of a solid state sensor.

  17. Development and pharmacokinetic of antimony encapsulated in liposomes of phosphatidylserine using radioisotopes in experimental leishmaniasis

    International Nuclear Information System (INIS)

    Borborema, Samanta Etel Treiger


    Leishmaniasis are a complex of parasitic diseases caused by intra macrophage protozoa of the genus Leishmania, and is fatal if left untreated. Pentavalent antimonials, though toxic and their mechanism of action being unclear, remain the first-line drugs for treatment. Effective therapy could be achieved by delivering antileishmanial drugs to these sites of infection. Liposomes are phospholipid vesicles that promote improvement in the efficacy and action of drugs in target cell. Liposomes are taken up by the cells of mononuclear phagocytic system (MPS). The purpose of this study was to develop a preparation of meglumine antimonate encapsulated in liposomes of phosphatidylserine and to study its pharmacokinetic in healthy mice to establish its metabolism and distribution. Quantitative analysis of antimony from liposomes demonstrated that Neutron Activation Analysis was the most sensitive technique with almost 100 % of accuracy. All liposome formulations presented a mean diameter size of 150 nm. The determination of IC 50 in infected macrophage showed that liposome formulations were between 10 - 63 fold more effective than the free drug, indicating higher selectivity index. By fluorescence microscopy, an increased uptake of fluorescent-liposomes was seen in infected macrophages during short times of incubation compared with non-infected macrophages. Biodistribution studies showed that meglumine antimonate irradiated encapsulated in liposomes of phosphatidylserine promoted a targeting of antimony for MPS tissues and maintained high doses in organs for a prolonged period. In conclusion, these data suggest that meglumine antimonate encapsulated in liposomes showed higher effectiveness than the non-liposomal drug against Leishmania infection. The development of liposome formulations should be a new alternative for the chemotherapy of infection diseases, especially Leishmaniasis, as they are used to sustain and target pharmaceuticals to the local of infection. (author)

  18. Pharmacokinetics and tissue distribution of Antimony after multiple intramuscular administrations in the Hamster

    International Nuclear Information System (INIS)

    Al-Jaser, May H.; Radwan, Mahasen A.; Zaghloul, Imam Y.


    The fate of pentavalent antimony (Sb) in different tissues in the body after intramuscular administration is of great interest for the future study of Sb therapy in different sitting. Pharmacokinetics and tissue distribution of antimony (Sb) were studied in the hamster after daily dose of sodium stibogluconate equivalent to 120 mg kg of Sb, administered intramuscularly for two weeks. Liver, spleen, heart, kidney and skin tissues were isolated after blood collection at the specified time. Antimony was measured in these tissues after suitable treatment, ashing and processing, by flame less atomic absorption spectrophotometry. The concentration of Sb time profile in blood showed a linear raid decline with elimination half life (tz1/2) of 1.7h. The concentration of drug (ug/gm) declined in a biphasic manner from almost all tissues. However, the concentrations of Sb were declined in slower fashion from the hamster tissues than from the blood. The maximum concentration of Sb was determined in the kidney tissues (3416+-631ug/gm) while the lowest concentration was in the spleen (209+-187ug/gm). The maximum concentration of Sb in the kidney (ug/gm) was more than 25 fold higher than that measured from blood (ug/ml). The AUC of Sb in the studied tissues was in this rank: kidney>liver>skin>spleen>heart>blood. Surprisingly, the heart, spleen and liver showed a similar t1/2 of 5.2-6.2h while the kidney and skin had a t1/2 of about 3h. Therefore, disposition of Sb seems to kinetically follow multicompartmental compartmental model. The kidneys got the highest concentration of drug which may lead to nephrotoxicity on long term therapy. (author)

  19. Antimony Adsorption from Zarshouran Gold Mineral Processing Plant Wastewater by Nano Zero Valent Iron Coated on Bentonite

    Directory of Open Access Journals (Sweden)

    nader nosrati


    Full Text Available The effluent from Zarshouran gold mineral processing plant contains high quantities of arsenic, antimony, mercury, and bismuth. These metals and metalloids are soluble in water and very toxic when they enter the environment. Their solubility in water causes the polluted area to extend beyond their point of origin. In this article, different methods of antimony removal from water and wastewater were reviewed and the zero-valent iron nanoparticles coated on Bentonite were selected as an effective and low cost material for removing antimony from wastewater. For the purposes of this study, zero-valent iron nanoparticles of 40-100 nanometers in size were synthesized by dropwise addition of sodium borohydride solution to an Iron (III aqueous solution at  ambient temperature and mixed with nitrogen gas. To avoid particle agglomeration and to enhance the product’s environmentally safe application, the  nanoparticles were coated on Bentonite and characterized by SEM/EDAX and BET. The experiments were carried out by intense mixing of the adsorbent with 10ml of real/synthtic wastewater samples in 20ml bottles.  The effects of pH, contact time, temperature, and adsorbent dosage on antimony removal efficiency were investigated under intense mixing using a magnetic mixer. Finally, the effluents were filtered upon completion of the experiments and used for atomic adsorption analysis. The results of the experiments showed that the adsorption isotherms of the synthesized nanoparticles obeyed the Langmuir and Freundlich models. The experiments carried out on real samples showed that antimony adsorption capacity for B-nZVI was 2.6 mg/g of the adsorbent and that the highest antimony removal efficiency was 99.56%.

  20. Photodegradation of Naphthol green B in the presence of semiconducting antimony trisulphide - SHORT COMMUNICATION

    Directory of Open Access Journals (Sweden)



    Full Text Available Different methods of wastewater treatment are being used for the removal of dyes from their solution, but in most of the cases, either homogeneous catalysts or different adsorbents are used. These methods have their own merits and demerits. In the present work, antimony trisulphide was used as a heterogeneous catalyst. The effects of different parameters on the rate of the reaction were observed, such as pH, concentration of dye, amount of semiconductor and light intensity. A tentative mechanism is proposed in which the role of hydroxyl radical as an active oxidizing species is shown for degradation of Naphthol green B.

  1. Determination of arsenic, selenium and antimony by neutron activation analysis. Application to hair samples

    International Nuclear Information System (INIS)

    Das, H.A.; Hoede, D.; Nieuwendijk, B.J.T.; Sloot, H.A. van der; Teunissen, G.J.A.; Woittiez, J.R.W.


    A fast rabbit system for instrumental activation analysis with reactor neutrons is described. Its use in the determination of selenium in hair is discussed. A survey is given of the correction factors which are inherent to the use of short-lived radionuclides. An alternative to INAA is NAA based on the separation of arsenic, selenium and antimony by hydride evaporation and adsorption to active carbon. Data for some Standard Reference Materials are given. This work was done under research contract 2440/RI/RB with the IAEA

  2. Direct Band Gap Gallium Antimony Phosphide (GaSbxP1−x) Alloys


    H. B. Russell; A. N. Andriotis; M. Menon; J. B. Jasinski; A. Martinez-Garcia; M. K. Sunkara


    Here, we report direct band gap transition for Gallium Phosphide (GaP) when alloyed with just 1?2 at% antimony (Sb) utilizing both density functional theory based computations and experiments. First principles density functional theory calculations of GaSbxP1?x alloys in a 216 atom supercell configuration indicate that an indirect to direct band gap transition occurs at x?=?0.0092 or higher Sb incorporation into GaSbxP1?x. Furthermore, these calculations indicate band edge straddling of the h...

  3. Synthesis, characterization and electrochemical performances of new antimony-containing graphite compounds used as anodes for lithium-ion batteries

    International Nuclear Information System (INIS)

    Dailly, A.; Willmann, P.; Billaud, D.


    Graphite intercalation intercalated with metal alloys able to alloy reversibly lithium constitute a large set of new anodic materials for lithium-ion batteries of significantly improved reversible capacities. Especially, graphite intercalated with cesium-antimony alloys can be used as materials for anodes in lithium-ion batteries. Electrochemical insertion of lithium in such chemically modified precursors shows that lithium both intercalates in the empty van der Waals spaces of graphite and alloys reversibly with antimony. The total electrochemical reversible capacities, measured between 0 and 2 V vs Li + /Li, close to 700 mAh g -1 have been currently obtained

  4. 49 CFR 213.115 - Rail end mismatch. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Rail end mismatch. 213.115 Section 213.115..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Track Structure § 213.115 Rail end mismatch. Any mismatch... mismatch of rails at joints may not be more than the following— On the tread of the rail ends (inch) On the...

  5. 49 CFR 230.115 - Feed water tanks. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Feed water tanks. 230.115 Section 230.115... Tenders Steam Locomotive Tanks § 230.115 Feed water tanks. (a) General provisions. Tanks shall be... water. Feed water tanks shall be equipped with a device that permits the measurement of the quantity of...

  6. 29 CFR 1915.115 - Hoisting and hauling equipment. (United States)


    ... Equipment for Rigging and Materials Handling § 1915.115 Hoisting and hauling equipment. The provisions of... on wingwalls of floating drydocks, and are used to transfer materials or equipment from or to a... 29 Labor 7 2010-07-01 2010-07-01 false Hoisting and hauling equipment. 1915.115 Section 1915.115...

  7. 42 CFR 84.115 - Breathing tubes; minimum requirements. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Breathing tubes; minimum requirements. 84.115 Section 84.115 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL... § 84.115 Breathing tubes; minimum requirements. Flexible breathing tubes used in conjunction with gas...

  8. 49 CFR 215.115 - Defective roller bearing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Defective roller bearing. 215.115 Section 215.115... § 215.115 Defective roller bearing. (a) A railroad may not place or continue in service a car, if the car has— (1) A roller bearing that shows signs of having been overheated as evidenced by— (i...

  9. 7 CFR 1160.115 - Milk marketing area. (United States)


    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Milk marketing area. 1160.115 Section 1160.115 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Order Definitions § 1160.115 Milk marketing area. Milk marketing area means each area within which milk...

  10. 46 CFR 115.812 - Pressure vessels and boilers. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Pressure vessels and boilers. 115.812 Section 115.812... CERTIFICATION Material Inspections § 115.812 Pressure vessels and boilers. (a) Pressure vessels must be tested... testing requirements for boilers are contained in § 61.05 in subchapter F of this chapter. [CGD 85-080, 61...

  11. 25 CFR 115.102 - Adults under legal disability. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Adults under legal disability. 115.102 Section 115.102... AND INDIVIDUAL INDIANS IIM Accounts § 115.102 Adults under legal disability. The funds of an adult who is non compos mentis or under other legal disability may be disbursed for his benefit for such...

  12. 13 CFR 115.34 - Minimization of Surety's Loss. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Minimization of Surety's Loss. 115.34 Section 115.34 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND GUARANTEE... strategy in maximizing recovery. See also § 115.17(b). ...

  13. 40 CFR 51.115 - Air quality data and projections. (United States)


    ... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Air quality data and projections. 51.115 Section 51.115 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS REQUIREMENTS FOR PREPARATION, ADOPTION, AND SUBMITTAL OF IMPLEMENTATION PLANS Control Strategy § 51.115 Air quality data and projections. (a) Each...

  14. 24 CFR 115.206 - Performance assessments; Performance standards. (United States)


    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Performance assessments; Performance standards. 115.206 Section 115.206 Housing and Urban Development Regulations Relating to Housing... AGENCIES Certification of Substantially Equivalent Agencies § 115.206 Performance assessments; Performance...

  15. 47 CFR 97.115 - Third party communications. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Third party communications. 97.115 Section 97.115 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES AMATEUR RADIO SERVICE Station Operation Standards § 97.115 Third party communications. (a) An amateur...

  16. 7 CFR 1220.115 - Net market price. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Net market price. 1220.115 Section 1220.115... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.115 Net market price. The term net market price means— (a) except as provided in paragraph (b) of this section, the sales price, or...

  17. 28 CFR 11.5 - Delegation of authority. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Delegation of authority. 11.5 Section 11.5 Judicial Administration DEPARTMENT OF JUSTICE DEBT COLLECTION Administration of Debt Collection § 11.5 Delegation of authority. Authority to conduct the following activities is hereby delegated to heads of Department organizations with respect to...

  18. 41 CFR 115-1.103 - Temporary-type FPMR. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Temporary-type FPMR. 115-1.103 Section 115-1.103 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

  19. 41 CFR 115-1.100 - Scope of subpart. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Scope of subpart. 115-1.100 Section 115-1.100 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.100 Scope...

  20. 41 CFR 115-1.106 - Applicability of FPMR. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability of FPMR. 115-1.106 Section 115-1.106 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

  1. 41 CFR 115-1.104 - Publication of FPMR. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of FPMR. 115-1.104 Section 115-1.104 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

  2. 41 CFR 115-1.109 - Numbering in FPMR system. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Numbering in FPMR system. 115-1.109 Section 115-1.109 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

  3. 41 CFR 115-1.104-50 - Publication of EPPMR. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of EPPMR. 115-1.104-50 Section 115-1.104-50 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...

  4. 19 CFR 115.14 - Meeting on program. (United States)


    ... Administration § 115.14 Meeting on program. If determined necessary by Customs, each Certifying Authority's... 19 Customs Duties 1 2010-04-01 2010-04-01 false Meeting on program. 115.14 Section 115.14 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY...

  5. Spectroscopy of element 115 decay chains. (United States)

    Rudolph, D; Forsberg, U; Golubev, P; Sarmiento, L G; Yakushev, A; Andersson, L-L; Di Nitto, A; Düllmann, Ch E; Gates, J M; Gregorich, K E; Gross, C J; Heßberger, F P; Herzberg, R-D; Khuyagbaatar, J; Kratz, J V; Rykaczewski, K; Schädel, M; Åberg, S; Ackermann, D; Block, M; Brand, H; Carlsson, B G; Cox, D; Derkx, X; Eberhardt, K; Even, J; Fahlander, C; Gerl, J; Jäger, E; Kindler, B; Krier, J; Kojouharov, I; Kurz, N; Lommel, B; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Papadakis, P; Ragnarsson, I; Runke, J; Schaffner, H; Schausten, B; Thörle-Pospiech, P; Torres, T; Traut, T; Trautmann, N; Türler, A; Ward, A; Ward, D E; Wiehl, N


    A high-resolution α, x-ray, and γ-ray coincidence spectroscopy experiment was conducted at the GSI Helmholtzzentrum für Schwerionenforschung. Thirty correlated α-decay chains were detected following the fusion-evaporation reaction 48Ca + 243Am. The observations are consistent with previous assignments of similar decay chains to originate from element Z=115. For the first time, precise spectroscopy allows the derivation of excitation schemes of isotopes along the decay chains starting with elements Z>112. Comprehensive Monte Carlo simulations accompany the data analysis. Nuclear structure models provide a first level interpretation.

  6. Structural and optical study on antimony-silicate glasses doped with thulium ions. (United States)

    Dorosz, D; Zmojda, J; Kochanowicz, M; Miluski, P; Jelen, P; Sitarz, M


    Structural, spectroscopic and thermal properties of SiO₂-Al₂O₃-Sb₂O₃-Na₂O glass system doped with 0.2 mol% Tm₂O₃ have been presented. Synthesis of antimony-silicate glasses with relatively low phonon energy (600 cm(-1), which implicates a small non-radiative decay rate) was performed by conventional high-temperature melt-quenching methods. The effect of SiO₂/Sb₂O₃ ratio in fabricated Tm(3+) doped glass on thermal, structural and luminescence properties was investigated. On the basis of structural investigations decomposition of absorption bands in the infrared FTIR region was performed, thus determining that antimony ions are the only glass-forming ions, setting up the lattice of fabricated glasses. Luminescence band at the wavelength of 1.8 μm corresponding to (3)F₄→(3)H₆ transition in thulium ions was obtained under 795 nm laser pumping. It was observed that combination of relatively low phonon energy and greater separation of optically active centers in the fabricated glasses influenced in decreasing the luminescence intensity at 1800 nm. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Determination of Trace Antimony (III by Adsorption Voltammetry at Carbon Paste Electrode

    Directory of Open Access Journals (Sweden)

    Nongyue He


    Full Text Available This work presents a sensitive method for the determination of trace antimonybased on the antimony-pyrogallol red (PGR adsorption at a carbon paste electrode (CPE.The optimal conditions were to use an electrode containing 25% paraffin oil and 75%high purity graphite powder as working electrode, a 0.10 mol/L HCl solution containing3.0×10-5 mol/L PGR as accumulation medium and a 0.20 mol/L HCl solution aselectrolyte with an accumulation time of 150 s and a reduction time of 60 s at -0.50 Vfollowed with a sweep from -0.50 V to 0.20 V. The mechanism of the electrode reactionwas discussed. Interferences of other metal ions were studied as well. The detection limitwas 1×10-9 mol/L. The linear range was from 2.0×10-9 mol/L to 5.0×10-7 mol/L.Application of the proposed method to the determination of antimony in water andhuman hair samples gave good results.

  8. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium

    Directory of Open Access Journals (Sweden)

    Rajmund Michalski


    Full Text Available Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemical cycles of chemical compounds, determination of toxicity and ecotoxicity of selected elements, quality control of food products, control of medicines and pharmaceutical products, technological process control, research on the impact of technological installation on the environment, examination of occupational exposure, and clinical analysis. Conventional methods are usually labor intensive, time consuming, and susceptible to interferences. The hyphenated techniques, in which separation method is coupled with multidimensional detectors, have become useful alternatives. The main advantages of those techniques consist in extremely low detection and quantification limits, insignificant interference, influence as well as high precision and repeatability of the determinations. In view of their importance, the present work overviews and discusses different hyphenated techniques used for arsenic, antimony, and thallium species analysis, in different clinical, environmental and food matrices.

  9. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium (United States)

    Michalski, Rajmund; Szopa, Sebastian; Jabłońska, Magdalena; Łyko, Aleksandra


    Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemical cycles of chemical compounds, determination of toxicity and ecotoxicity of selected elements, quality control of food products, control of medicines and pharmaceutical products, technological process control, research on the impact of technological installation on the environment, examination of occupational exposure, and clinical analysis. Conventional methods are usually labor intensive, time consuming, and susceptible to interferences. The hyphenated techniques, in which separation method is coupled with multidimensional detectors, have become useful alternatives. The main advantages of those techniques consist in extremely low detection and quantification limits, insignificant interference, influence as well as high precision and repeatability of the determinations. In view of their importance, the present work overviews and discusses different hyphenated techniques used for arsenic, antimony, and thallium species analysis, in different clinical, environmental and food matrices. PMID:22654649

  10. Migration of antimony from PET containers into regulated EU food simulants. (United States)

    Sánchez-Martínez, María; Pérez-Corona, Teresa; Cámara, Carmen; Madrid, Yolanda


    Antimony migration from polyethylene terephthalate (PET) containers into aqueous (distilled water, 3% acetic acid, 10% and 20% ethanol) and fatty food simulants (vegetable oil), as well as into vinegar, was studied. Test conditions were according to the recent European Regulation 10/2011 (EU, 2011). Sb migration was assayed by ICP-MS and HG-AFS. The results showed that Sb migration values ranged from 0.5 to 1.2μg Sb/l, which are far below the maximum permissible migration value for Sb, 40μg Sb/kg, (EU, Regulation 10/2011). Parameters as temperature and bottle re-use influence were studied. To assess toxicity, antimony speciation was performed by HPLC-ICP-MS and HG-AFS. While Sb(V) was the only species detected in aqueous simulants, an additional species (Sb-acetate complex) was measured in wine vinegar. Unlike most of the studies reported in the literature, migration tests were based on the application of the EU directive, which enables comparison and harmonisation of results. Copyright © 2013 Elsevier Ltd. All rights reserved.

  11. Antimonial Therapy Induces Circulating Proinflammatory Cytokines in Patients with Cutaneous Leishmaniasis (United States)

    Kocyigit, Abdurrahim; Gur, Selahaddin; Gurel, Mehmet S.; Bulut, Vedat; Ulukanligil, Mustafa


    The objective of this study was to evaluate the association between antimonial therapy and circulating levels of proinflammatory cytokines in patients with cutaneous leishmaniasis (CL). Patients were treated with conventional chemotherapy by using pentavalent antimonium salts (Glucantime) for 3 weeks. Circulating plasma levels of the proinflammatory cytokines interleukin-1β (IL-1β), IL-6, IL-8, and tumor necrosis factor alpha (TNF-α) were determined for CL patients and healthy subjects before and 3 weeks after the treatment was started. Plasma IL-1β, IL-6, IL-8, and TNF-α levels were significantly higher for pretreatment CL patients than for healthy subjects. Proinflammatory cytokines significantly increased after 21 days postinfection compared to levels for the pretreatment patients. These increments were approximately 3-fold for IL-1β and TNF-α levels, 10-fold for IL-6 levels, and 20-fold for IL-8 levels in patients with CL. Taken together these results indicate that circulating proinflammatory cytokine levels were increased in patients with CL as a consequence of host defense strategies, and antimonial therapy may induce these cytokines by affecting the macrophage or other components of the host defense system. PMID:12438329

  12. Meglumine antimoniate is more effective than sodium stibogluconate in the treatment of cutaneous leishmaniasis. (United States)

    Yesilova, Yavuz; Surucu, Hacer Altın; Ardic, Nurittin; Aksoy, Mustafa; Yesilova, Abdullah; Oghumu, Steve; Satoskar, Abhay R


    Sodium stibogluconate (SSG, Pentostam) and meglumine antimoniate (MA, Glucantime) are two antimonials that are widely used to treat cutaneous leishmaniasis (CL), but the relative efficacies of these treatments are not clear. The aim of this study is to compare the efficacy of intralesional SSG with intralesional MA therapy in the treatment of CL. One month after completion of the therapy, 1431 of 1728 patients (82%) who received intralesional MA showed complete clinical cure compared to 1157 of 1728 patients (67%) in the SSG group. Patients who did not respond to the first round of therapy were re-administered the same treatment but with twice weekly injections. Following completion of the second course of therapy, 237 of 297 patients (80%) in the MA group and 407 of 561 patients (72%) in the SSG group healed their lesions by 1-month post-treatment. At both times, the differences in cure rates between MA and SSG groups were statistically significant (p < 0.05). Cure rates in the MA group were always significantly higher than SSG groups irrespective of other parameters including age, gender, lesion site and type of lesion. Intralesional MA is more effective than intralesional SSG in the treatment of CL.

  13. Growth of antimony doped P-type zinc oxide nanowires for optoelectronics

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Zhong Lin; Pradel, Ken


    In a method of growing p-type nanowires, a nanowire growth solution of zinc nitrate (Zn(NO.sub.3).sub.2), hexamethylenetetramine (HMTA) and polyethylenemine (800 M.sub.w PEI) is prepared. A dopant solution to the growth solution, the dopant solution including an equal molar ration of sodium hydroxide (NaOH), glycolic acid (C.sub.2H.sub.4O.sub.3) and antimony acetate (Sb(CH.sub.3COO).sub.3) in water is prepared. The dopant solution and the growth solution combine to generate a resulting solution that includes antimony to zinc in a ratio of between 0.2% molar to 2.0% molar, the resulting solution having a top surface. An ammonia solution is added to the resulting solution. A ZnO seed layer is applied to a substrate and the substrate is placed into the top surface of the resulting solution with the ZnO seed layer facing downwardly for a predetermined time until Sb-doped ZnO nanowires having a length of at least 5 .mu.m have grown from the ZnO seed layer.

  14. High levels of antimony in dust from e-waste recycling in southeastern China

    International Nuclear Information System (INIS)

    Bi, Xiangyang; Li, Zhonggen; Zhuang, Xiaochun; Han, Zhixuan; Yang, Wenlin


    Environmental contamination due to uncontrolled e-waste recycling is an emerging global issue. Antimony (Sb) is a toxic element used in semiconductor components and flame retardants for circuit board within electronic equipment. When e-waste is recycled, Sb is released and contaminates the surrounding environment; however, few studies have characterized the extent of this problem. In this study, we investigated Sb and arsenic (As) distributions in indoor dust from 13 e-waste recycling villages in Guiyu, Guangdong Province, southeastern China. Results revealed significantly elevated concentrations of Sb (6.1-232 mg/kg) in dust within all villages, which were 3.9-147 times higher than those from the non e-waste sites, indicating e-waste recycling was an important source of Sb pollution. On the contrary, As concentrations (5.4-17.7 mg/kg) in e-waste dusts were similar to reference values from the control sites. Therefore, dusts emitted from e-waste recycling may be characterized by high Sb/As ratios, which may help identify the contamination due to the e-waste recycling activities. - Highlights: → Antimony and arsenic concentrations in dust from e-waste recycling were investigated. → E-waste recycling is an important emerging source of Sb pollution. → Sb/As ratios may help identify the e-waste contamination.

  15. Antimony trioxide-induced apoptosis is dependent on SEK1/JNK signaling. (United States)

    Mann, Koren K; Davison, Kelly; Colombo, Myrian; Colosimo, April L; Diaz, Zuanel; Padovani, Alessandra M S; Guo, Qi; Scrivens, P James; Gao, Wenli; Mader, Sylvie; Miller, Wilson H


    Very little is known concerning the toxicity of antimony, despite its commercial use as a flame retardant and medical use as a treatment for parasitic infections. Our previous studies show that antimony trioxide (Sb(2)O(3)) induces growth inhibition in patient-derived acute promyelocytic leukemia (APL) cell lines, a disease in which a related metal, arsenic trioxide (As(2)O(3)), is used clinically. However, signaling pathways initiated by Sb(2)O(3) treatment remain undefined. Here, we show that Sb(2)O(3) treatment of APL cells is associated with increased apoptosis as well as differentiation markers. Sb(2)O(3)-induced reactive oxygen species (ROS) correlated with increased apoptosis. In addition, when we decreased the buffering capacity of the cell by depleting glutathione, ROS production and apoptosis was enhanced. Arsenic-resistant APL cells with increased glutathione levels exhibited increased cross-resistance to Sb(2)O(3). Based on studies implicating c-jun kinase (JNK) in the mediation of the response to As(2)O(3), we investigated the role for JNK in Sb(2)O(3)-induced apoptosis. Sb(2)O(3) activates JNK and its downstream target, AP-1. In fibroblasts with a genetic deletion in SEK1, an upstream regulator of JNK, Sb(2)O(3)-induced growth inhibition as well as JNK activation was decreased. These data suggest roles for ROS and the SEK1/JNK pathway in the cytotoxicity associated with Sb(2)O(3) exposure.

  16. Leaching of the antimony and accompanying of elements Sb2S3 in the alkaline medium

    Directory of Open Access Journals (Sweden)

    Dagmar Remeteiová


    Full Text Available This paper presents results of the laboratory investigation of alkaline leaching of stibnite that is an important mineral occuring in the antimony-bearing raw materials. The following components were present in stibnite: Sb2S3, SiO2, ZnS, FeS2. The aim of this study was to establish the effect of composition of the aqueous alkaline leaching medium (1 % NaOH, 1 % NaOH + 1 % Na2S2O3, 1 % NaOH + 1 % Na2S on the recoveries of Sb, Fe, Pb, Zn, Cu, Ni and Hg. The antimony recoveries in the leaching solutions NaOH and NaOH + Na2S2O3 solutions were lower in comparison with the leaching in NaOH + Na2S. The Fe, Pb, Zn recoveries in alkaline solutions were found to decrease in the following order: Fe, Pb, Zn. The mercury recovery in the leaching test with the solution containing 1 % NaOH+1 % Na2S was 3,7 %.

  17. Evaluation of antimony microparticles supported on biochar for application in the voltammetric determination of paraquat. (United States)

    Gevaerd, Ava; de Oliveira, Paulo R; Mangrich, Antonio S; Bergamini, Márcio F; Marcolino-Junior, Luiz H


    This work describes the construction and application of carbon paste electrodes modified with biochar and antimony microparticles (SbBCPE) for voltammetric determination of paraquat using a simple and sensitive procedure based on voltammetric stripping analysis. Some parameters such as amount of biochar and antimony used in the composition of the carbon paste and instrumental parameters were examined in detail. Under optimized conditions, an analytical curve was obtained for paraquat determination employing SbBCPE, which showed a linear response ranging from 0.2 to 2.9 μmol L(-1), with limit of detection and quantification of 34 nmol L(-1) and 113 nmol L(-1), respectively, after paraquat pre-concentration of 120 s. The repeatability study presented a RSD=2.0% for 10 consecutive measurements using the same electrode surface and the reproducibility study showed a RSD=2.7% for measurements with 10 different electrode surfaces. The proposed sensor was successfully applied for paraquat determination in tap water and citric fruit juice spiked samples and good recoveries were obtained without any sample pre-treatment, showing its promising analytical performance. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Determination of antimony in nail and hair by thermal neutron activation analysis

    International Nuclear Information System (INIS)

    Katayama, Yukio; Ishida, Norio


    The concentration of antimony in nail and hair was determined by thermal neutron activation analysis. Samples were collected from the workers of an antimony refinery, inhabitants near the refinery, and residents in control area. They were irradiated by Kyoto University 5000 kW Reactor for 1 h, and cooled for 30 to 100 days. After cooling, the concentration of Sb in nail and hair was estimated by measuring the intensity of γ-ray from 124 Sb of the samples, then the samples were washed by 0.1 % aqueous solution of nonionic surface active agent in an ultrasonic cleaner. The γ-ray spectrometry was done again (after washing). The concentration of Sb in nail before washing was 730 ppm for the workers, 2.46 ppm for habitants near the refinery, and 0.19 ppm for the control; after washing, it became 230 ppm for the workers, 0.63 ppm for habitants, and 0.09 ppm for the control. The concentration of Sb in hair before and after washing was 222 ppm and 196 ppm for the workers, and 0.21 ppm and 0.15 ppm for the control, respectively. (author)

  19. Distributions and impact factors of antimony in topsoils and moss in Ny-Ålesund, Arctic

    International Nuclear Information System (INIS)

    Jia Nan; Sun Liguang; He Xin; You Kehua; Zhou Xin; Long Nanye


    The distribution of antimony (Sb) in topsoil and moss (Dicranum angustum) in disturbed and undisturbed areas, as well as coal and gangue, in Ny-Ålesund, Arctic was examined. Results show that the weathering of coal bed could not contribute to the increase of Sb concentrations in topsoil and moss in the study area. The distribution of Sb is partially associated with traffic and historical mining activities. The occurrence of the maximum Sb concentration is due to the contribution of human activities. In addition, the decrease of Sb content in topsoil near the coastline may be caused by the washing of seawater. Compared with topsoils, moss could be a useful tool for monitoring Sb in both highly and lightly polluted areas. - Highlights: ► We examined the distribution of antimony in topsoil and moss in Ny-Ålesund, Arctic. ► The distribution of Sb is associated with traffic and historical mining activities. ► The weathering of coal bed cannot lead to the Sb increase in the surface environment. ► The distribution of Sb in moss could reflect the accumulation of Sb pollution. ► Moss can be a useful tool for monitoring Sb in highly and lightly polluted areas. - The distribution of Sb in Ny-Ålesund is partially associated with traffic and historical mining activities, and moss can be a useful tool for monitoring Sb in both highly and lightly polluted areas.

  20. Glass and antimony electrodes for long-term pH monitoring: a dynamic in vitro comparison

    NARCIS (Netherlands)

    Geus, W. P.; Smout, A. J.; Kooiman, J. C.; Lamers, C. B.; Gues, J. W.


    OBJECTIVE: To compare the performance of combined glass microelectrodes with monocrystalline and polycrystalline antimony electrodes with external reference in a 24-h dynamic in vitro study. DESIGN AND METHODS: In an artificial stomach, the pH of the contents titrated from pH1-7 and back by NaOH and

  1. Ambulatory oesophageal pH monitoring: a comparison between antimony, ISFET, and glass pH electrodes

    NARCIS (Netherlands)

    Hemmink, Gerrit J. M.; Weusten, Bas L. A. M.; Oors, Jac; Bredenoord, Albert J.; Timmer, Robin; Smout, André J. P. M.


    BACKGROUND AND AIM: Ambulatory oesophageal pH-impedance monitoring is a widely used test to evaluate patients with reflux symptoms. Several types of pH electrodes are available: antimony, ion sensitive field effect transistor (ISFET), and glass electrodes. These pH electrodes have not been compared

  2. Health and ecological risk assessment of heavy metals pollution in an antimony mining region: a case study from South China. (United States)

    Fei, Jiang-Chi; Min, Xiao-Bo; Wang, Zhen-Xing; Pang, Zhi-Hua; Liang, Yan-Jie; Ke, Yong


    In recent years, international research on the toxicity of the heavy metal, antimony, has gradually changed focus from early medical and pharmacological toxicology to environmental toxicology and ecotoxicology. However, little research has been conducted for sources identification and risk management of heavy metals pollution by long-term antimony mining activities. In this study, a large number of investigations were conducted on the temporal and spatial distribution of antimony and related heavy metal contaminants (lead, zinc, and arsenic), as well as on the exposure risks for the population for the Yuxi river basin in the Hunan province, China. The scope of the investigations included mine water, waste rock, tailings, agricultural soil, surface water, river sediments, and groundwater sources of drinking water. Health and ecological risks from exposure to heavy metal pollution were evaluated. The main pollution sources of heavy metals in the Yuxi River basin were analyzed. Remediation programs and risk management strategies for heavy metal pollution were consequently proposed. This article provides a scientific basis for the risk assessment and management of heavy metal pollution caused by antimony basin ore mining.

  3. Comparative phytotoxicity of methylated and inorganic arsenic- and antimony species to Lemna minor, Wolffia arrhiza and Selenastrum capricornutum

    NARCIS (Netherlands)

    Duester, L.; van der Geest, H.G.; Moelleken, S.; Hirner, A.V.; Kueppers, K.


    The alkylation of metalloids through the transfer of methyl groups is an important factor in the biogeochemical cycling of elements like arsenic and antimony. In the environment, many different organic and inorganic forms of these elements can therefore be found in soils, sediments or organisms.

  4. Effect of Annealing on the Properties of Antimony Telluride Thin Films and Their Applications in CdTe Solar Cells

    Directory of Open Access Journals (Sweden)

    Zhouling Wang


    Full Text Available Antimony telluride alloy thin films were deposited at room temperature by using the vacuum coevaporation method. The films were annealed at different temperatures in N2 ambient, and then the compositional, structural, and electrical properties of antimony telluride thin films were characterized by X-ray fluorescence, X-ray diffraction, differential thermal analysis, and Hall measurements. The results indicate that single phase antimony telluride existed when the annealing temperature was higher than 488 K. All thin films exhibited p-type conductivity with high carrier concentrations. Cell performance was greatly improved when the antimony telluride thin films were used as the back contact layer for CdTe thin film solar cells. The dark current voltage and capacitance voltage measurements were performed to investigate the formation of the back contacts for the cells with or without Sb2Te3 buffer layers. CdTe solar cells with the buffer layers can reduce the series resistance and eliminate the reverse junction between CdTe and metal electrodes.

  5. American cutaneous leishmaniasis caused by Leishmania (Viannia braziliensis resistant to meglumine antimoniate, but with good response to pentamidine: a case report

    Directory of Open Access Journals (Sweden)

    Maria Inês Fernandes Pimentel


    Full Text Available This is a case report of a Brazilian soldier with cutaneous leishmaniasis. The lesion relapsed following two systemic treatments with meglumine antimoniate. The patient was treated with amphotericin B, which was interrupted due to poor tolerance. Following isolation of Leishmania sp., six intralesional infiltrations of meglumine antimoniate resulted in no response. Leishmania sp promastigotes were again isolated. The patient was submitted to intramuscular 4mg/kg pentamidine. Parasites from the first and second biopsies were identified as Leishmania (Viannia braziliensis; those isolated from the first biopsy were more sensitive to meglumine antimoniate in vitro than those isolated from the second biopsy. No relapse was observed.

  6. Speciation of Sb(III) and Sb(V) in meglumine antimoniate pharmaceutical formulations by PSA using carbon nanotube electrode. (United States)

    Santos, Vivian Silva; Santos, Wilney de Jesus Rodrigues; Kubota, Lauro Tatsuo; Tarley, César Ricardo Teixeira


    A new and simple electroanalytical method for speciation of Sb(III) and Sb(V) in pharmaceutical formulation by potentiometric stripping analysis (PSA) using a multiwall carbon nanotube paste electrode was developed. All instrumental and chemical parameters influencing the performance of the method were carefully assessed and optimized. Trivalent antimony was determined in acid medium (pH 3.6) under the optimized condition (deposition potential of -0.7 V, deposition time of 180 s, ionic strength of 0.3M and oxidant mercury concentration of 10 mg l(-1)). Total antimony was determined after quantitative reduction of Sb(V) with l-cysteine (1.5%, w/v) and its concentration was calculated from difference between the total antimony and Sb(III). The developed method provided two distinct linear calibration one ranging from 10 up to 50 microg l(-1) and other from 100 up to 800 microg l(-1) with respective correlation coefficient of 0.9978 and 0.9993, presenting a detection limit of 6.2 microg l(-1). Repeatability for the six independent samples expressed in terms of relative standard deviation was found to be 3.01 and 1.39% for 40.0 and 300.0 microg l(-1) antimony concentration, respectively. Results on the effect of foreign substances [Al(III), Mg(II), Fe(III), Cd(II), Zn(II) and meglumine] on analytical signal of antimony showed no interference even using high content of foreign ions in the analyte:interferent ratio up to 1:100. The proposed method was successfully applied for the speciation of Sb(III) and Sb(V) in pharmaceutical formulation and the accuracy was assessed from addition and recovery tests as well as comparing with graphite furnace atomic absorption spectrometry (GF AAS) technique used as reference analytical method.

  7. Lithium-antimony-lead liquid metal battery for grid-level energy storage. (United States)

    Wang, Kangli; Jiang, Kai; Chung, Brice; Ouchi, Takanari; Burke, Paul J; Boysen, Dane A; Bradwell, David J; Kim, Hojong; Muecke, Ulrich; Sadoway, Donald R


    The ability to store energy on the electric grid would greatly improve its efficiency and reliability while enabling the integration of intermittent renewable energy technologies (such as wind and solar) into baseload supply. Batteries have long been considered strong candidate solutions owing to their small spatial footprint, mechanical simplicity and flexibility in siting. However, the barrier to widespread adoption of batteries is their high cost. Here we describe a lithium-antimony-lead liquid metal battery that potentially meets the performance specifications for stationary energy storage applications. This Li||Sb-Pb battery comprises a liquid lithium negative electrode, a molten salt electrolyte, and a liquid antimony-lead alloy positive electrode, which self-segregate by density into three distinct layers owing to the immiscibility of the contiguous salt and metal phases. The all-liquid construction confers the advantages of higher current density, longer cycle life and simpler manufacturing of large-scale storage systems (because no membranes or separators are involved) relative to those of conventional batteries. At charge-discharge current densities of 275 milliamperes per square centimetre, the cells cycled at 450 degrees Celsius with 98 per cent Coulombic efficiency and 73 per cent round-trip energy efficiency. To provide evidence of their high power capability, the cells were discharged and charged at current densities as high as 1,000 milliamperes per square centimetre. Measured capacity loss after operation for 1,800 hours (more than 450 charge-discharge cycles at 100 per cent depth of discharge) projects retention of over 85 per cent of initial capacity after ten years of daily cycling. Our results demonstrate that alloying a high-melting-point, high-voltage metal (antimony) with a low-melting-point, low-cost metal (lead) advantageously decreases the operating temperature while maintaining a high cell voltage. Apart from the fact that this

  8. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Directory of Open Access Journals (Sweden)

    Zhimeng Liu


    Full Text Available A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2/carbon aerogel (CA for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  9. Synthesis and optical properties of antimony oxide glasses doped with holmium trioxide

    Energy Technology Data Exchange (ETDEWEB)

    Raghunatha, S.; Eraiah, B., E-mail: [Department of physics, Bangalore University, Bengaluru – 560 056. India (India)


    Holmium doped lithium-antimony-lead borate glasses having 1 mol% AgNO{sub 3} with composition 50B{sub 2}O{sub 3}-20PbO-25Sb{sub 2}O{sub 3}-5Li{sub 2}O have been prepared using single step melt quenching technique. The XRD spectrum confirms amorphous nature of glasses. The optical absorbance studies were carried out on these glasses. The optical direct band gap energies were found to be in the range of 3.10 eV to 3.31 eV and indirect band gap energies were found to be in the range of 2.28 eV to 3.00 eV. The refractive indexes have been calculated by using Lorentz-Lorenz formula and the calculated values in the range of 2.31 to 2.37.

  10. Mid-infrared optical properties of chalcogenide glasses within tin-antimony-selenium ternary system. (United States)

    Lin, Ruiqiang; Chen, Feifei; Zhang, Xiaoyu; Huang, Yicong; Song, Baoan; Dai, Shixun; Zhang, Xianghua; Ji, Wei


    In this work, we investigated the mid-infrared (MIR) optical properties of selenide (Se-based) chalcogenide glasses (ChGs) within an As- and Ge-free system, namely the environment-friendly and low-cost tin-antimony-selenium (Sn-Sb-Se, SSS) ternary system, which has not been systematically studied to the best of our knowledge. As compared to ChGs within those conventional Se-based systems, SSS ChGs were found to exhibit extended infrared transmittance range as well as larger linear refractive index (n 0 ). Femtosecond Z-scan measurements show the presence of evident three-photon absorption from Urbach absorption of the SSS ChGs at MIR wavelength, which resonantly enhanced the nonlinear refractive behavior and resulted in large nonlinear refractive index (n 2 ).

  11. Microbial diversity and community structure in an antimony-rich tailings dump. (United States)

    Xiao, Enzong; Krumins, Valdis; Dong, Yiran; Xiao, Tangfu; Ning, Zengping; Xiao, Qingxiang; Sun, Weimin


    To assess the impact of antimony (Sb) on microbial community structure, 12 samples were taken from an Sb tailings pile in Guizhou Province, Southwest China. All 12 samples exhibited elevated Sb concentrations, but the mobile and bioaccessible fractions were small in comparison to total Sb concentrations. Besides the geochemical analyses, microbial communities inhabiting the tailing samples were characterized to investigate the interplay between the microorganisms and environmental factors in mine tailings. In all samples, Proteobacteria and Actinobacteria were the most dominant phyla. At the genus level, Thiobacillus, Limnobacter, Nocardioides, Lysobacter, Phormidium, and Kaistobacter demonstrated relatively high abundances. The two most abundant genera, Thiobacillus and Limnobacter, are characterized as sulfur-oxidizing bacteria and thiosulfate-oxidizing bacteria, respectively, while the genus Lysobacter contains arsenic (As)-resistant bacteria. Canonical correspondence analysis (CCA) indicates that TOC and the sulfate to sulfide ratio strongly shaped the microbial communities, suggesting the influence of the environmental factors in the indigenous microbial communities.

  12. The electronic structure of the antimony chalcogenide series: Prospects for optoelectronic applications

    International Nuclear Information System (INIS)

    Carey, John J.; Allen, Jeremy P.; Scanlon, David O.; Watson, Graeme W.


    In this study, density functional theory is used to evaluate the electronic structure of the antimony chalcogenide series. Analysis of the electronic density of states and charge density shows that asymmetric density, or ‘lone pairs’, forms on the Sb III cations in the distorted oxide, sulphide and selenide materials. The asymmetric density progressively weakens down the series, due to the increase in energy of valence p states from O to Te, and is absent for Sb 2 Te 3 . The fundamental and optical band gaps were calculated and Sb 2 O 3 , Sb 2 S 3 and Sb 2 Se 3 have indirect band gaps, while Sb 2 Te 3 was calculated to have a direct band gap at Γ. The band gaps are also seen to reduce from Sb 2 O 3 to Sb 2 Te 3 . The optical band gap for Sb 2 O 3 makes it a candidate as a transparent conducting oxide, while Sb 2 S 3 and Sb 2 Se 3 have suitable band gaps for thin film solar cell absorbers. - Graphical abstract: A schematic illustrating the interaction between the Sb III cations and the chalcogenide anions and the change in their respective energy levels down the series. - Highlights: • The electronic structure of the antimony chalcogenide series is modelled using DFT. • Asymmetric density is present on distorted systems and absent on the symmetric telluride system. • Asymmetric density is formed from the mixing of Sb 5s and anion p states, where the anti-bonding combination is stabilised by the Sb 5p states. • The asymmetric density weakens down the series due to the increase in energy of chalcogenide p states. • The increase in energy of the anion p states reduces the fundamental and optical band gaps

  13. Successful treatment of feline leishmaniosis using a combination of allopurinol and N-methyl-glucamine antimoniate

    Directory of Open Access Journals (Sweden)

    Maria Alexandra Basso


    Full Text Available Case summary This work describes the diagnosis and successful treatment of a 2-year-old domestic cat infected with Leishmania species and presenting fever, and ulcerative and nodular skin lesions after being treated for pyodermatitis for 1 year without clinical improvement. After anamnesis the cat was submitted to a complete clinical examination. Blood was collected for determination of haematological and biochemical parameters, detection of feline leukaemia virus (FeLV, feline immunodeficiency virus (FIV, feline coronavirus (FCoV and Leishmania amastigotes. Fine-needle aspiration puncture from the skin nodules was also performed. After definitive diagnosis the animal was treated and followed up over a 2 year period. The animal tested negative for FIV-specific antibodies, FeLV antigen and feline coronavirus RNA. Leishmania amastigotes in the skin nodules were confirmed by cytology and molecular diagnosis. Treatment was initiated with allopurinol, resulting in a slight clinical improvement. Thus, N-methyl-glucamine antimoniate was added and administered for 30 days, with complete closure of the ulcerative lesions in the hindlimbs requiring a surgical approach. Close monitoring of the patient in the following 24 months indicated that combined therapy was safe and clinical cure was achieved without further relapses or side effects. Relevance and novel information Considering the increasing number of feline leishmaniosis cases and the inconsistent results of most therapeutic protocols described in the literature, the use of new approaches, especially in refractory cases, is essential. Although the use of allopurinol and N-methyl-glucamine antimoniate is off-label in cats, in this case the combination treatment was followed by an extensive analytical monitoring, supporting their safety and effectiveness.

  14. Dicty_cDB: CFG115 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

  15. Toxicity Assessments of Antimony, Barium, Beryllium, and Manganese for Development of Ecological Soil Screening Levels (ECO-SSL) Using Earthworm (Eisenia Fetida) Benchmark Values

    National Research Council Canada - National Science Library

    Simini, Michael


    ... soil that supports relatively high bioavailability of barium (Ba), beryllium (Be), manganese (Mn), and antimony (Sb). For the metals tested, cocoon production was a more sensitive endpoint than was survival...

  16. Differential pulse polarographic determination of trace antimony in standard biological samples after preconcentration using 2-nitroso-1-naphthol-4-sulfonic acid

    International Nuclear Information System (INIS)

    Taher, M. A.


    A highly selective, rapid and economical differential polarographic method has been developed for the determination of trace amounts of antimony in various standard alloys and biological samples after of its 2-naphthol-4 sulfonic acid tetradecyl dimethylbenzylammonium chloride on microcrystalline naphthalene in the ph range of 7.5-11.0. After filtration, the solid mass is shaken with 8-10 ml of 1 M hydrochloric acid (with preconcentration factor of 10) and antimony is determined by differential pulse polarography. Antimony can alternatively be quantitatively absorbed on 2-nitroso-1-naphthol-4-sulfonic acid tetradecyl dimethylbenzylammonium-naphthalene absorbed packed in a column (with preconcentration factor of 30) and determined similarly. In this case, 1.5 μg of antimony can be concentrated in a column from 300 ml of aqueous sample, where its concentration is as low as 5 ng/ml. Characterization of the electro active process included an examination of the degree of reversibility. The results show that the irreversibility of antimony. Various parameters such as the effect of ph, volume of aqueous phase, HCl concentration, reagent concentration, naphthalene concentration, shaking time and interference of a number of metal ions on the determination of antimony have been studied in detail to optimize the conditions for determination in standard alloys and standard biological samples

  17. Remediation of antimony-rich mine waters: Assessment of antimony removal and shifts in the microbial community of an onsite field-scale bioreactor. (United States)

    Sun, Weimin; Xiao, Enzong; Kalin, Margarete; Krumins, Valdis; Dong, Yiran; Ning, Zengping; Liu, Tong; Sun, Min; Zhao, Yanlong; Wu, Shiliang; Mao, Jianzhong; Xiao, Tangfu


    An on-site field-scale bioreactor for passive treatment of antimony (Sb) contamination was installed downstream of an active Sb mine in Southwest China, and operated for one year (including a six month monitoring period). This bioreactor consisted of five treatment units, including one pre-aerobic cell, two aerobic cells, and two microaerobic cells. With the aerobic cells inoculated with indigenous mine water microflora, the bioreactor removed more than 90% of total soluble Sb and 80% of soluble antimonite (Sb(III)). An increase in pH and decrease of oxidation-reduction potential (Eh) was also observed along the flow direction. High-throughput sequencing of the small subunit ribosomal RNA (SSU rRNA) gene variable (V4) region revealed that taxonomically diverse microbial communities developed in the bioreactor. Metal (loid)-oxidizing bacteria including Ferrovum, Thiomonas, Gallionella, and Leptospirillum, were highly enriched in the bioreactor cells where the highest total Sb and Sb(III) removal occurred. Canonical correspondence analysis (CCA) indicated that a suite of in situ physicochemical parameters including pH and Eh were substantially correlated with the overall microbial communities. Based on an UPGMA (Unweighted Pair Group Method with Arithmetic Mean) tree and PCoA (Principal Coordinates Analysis), the microbial composition of each cell was distinct, indicating these in situ physicochemical parameters had an effect in shaping the indigenous microbial communities. Overall, this study was the first to employ a field-scale bioreactor to treat Sb-rich mine water onsite and, moreover, the findings suggest the feasibility of the bioreactor in removing elevated Sb from mine waters. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. A Flow Method for Chemiluminescence Determination of Antimony(III) and Antimony(V) Using a Rhodamine B-Cetyltrimethylammonium Chloride Reversed Micelle System Following On-Line Extraction. (United States)

    Hasanin, Tamer H A; Yamamoto, Tomoyuki; Okamoto, Yasuaki; Ishizaka, Shoji; Fujiwara, Terufumi


    A rapid and sensitive flow method, based on the combination of on-line solvent extraction with reversed micellar mediated chemiluminescence (CL) detection using rhodamine B (RB), was developed for the determination of antimony(III) and antimony(V) in aqueous samples. The on-line extraction procedure involved ion-pair formation of the antimony(V) chloro-complex anion with the protonated RBH(+) ion and its extraction from an aqueous hydrochloric acid solution into toluene, followed by phase separation using a microporous membrane. When in a flow cell of a detector, the ion-pair in the extract driven was mixed with the reversed micellar solution of cetyltrimethylammonium chloride in 1-hexanol-cyclohexane/water (0.60 mol dm(-3) H2SO4) containing cerium(IV), its uptake by the reversed micelles and the subsequent CL oxidation of RB with Ce(IV) occurred easily, then the produced CL signal was measured. Using the proposed flow method under the optimized experimental conditions, a detection limit (DL) of 0.35 μmol dm(-3) and a linear calibration graph with a dynamic range from DL to 16 μmol dm(-3) were obtained for Sb(V) with a precision of 1.4% relative standard deviation (n = 5) at the Sb(V) concentration of 8.2 μmol dm(-3). The present method was successfully applied to the determination of Sb(V) in water samples and to the differential determination of Sb(III) and Sb(V) in copper electrolyte industrial samples, where total antimony Sb(III) + Sb(V) was determined after oxidation of Sb(III) to Sb(V) with Ce(IV) and Sb(III) was calculated by difference, for which the DL was almost the same as that for Sb(V).

  19. 13 CFR 115.20 - Insolvency of Surety. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Insolvency of Surety. 115.20 Section 115.20 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND GUARANTEE... requirement. The trustee or receiver must submit to SBA quarterly status reports accounting for all funds...

  20. 45 CFR 400.115 - Establishing legal responsibility. (United States)


    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Establishing legal responsibility. 400.115 Section... Child Welfare Services § 400.115 Establishing legal responsibility. (a) A State must ensure that legal responsibility is established, including legal custody and/or guardianship, as appropriate, in accordance with...

  1. 13 CFR 115.16 - Determination of Surety's Loss. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Determination of Surety's Loss. 115.16 Section 115.16 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND... generally accepted accounting principles; and (2) Amounts actually paid by the Surety for court costs and...

  2. 13 CFR 115.15 - Underwriting and servicing standards. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Underwriting and servicing standards. 115.15 Section 115.15 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SURETY BOND... underwriting and the Surety's principles and practices on unguaranteed bonds. The Principal must satisfy the...

  3. 45 CFR 149.115 - Cost threshold and cost limit. (United States)


    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Cost threshold and cost limit. 149.115 Section 149.115 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH CARE ACCESS... percentage increase in the Medical Care Component of the Consumer Price Index for all urban consumers...

  4. 33 CFR 115.70 - Advance approval of bridges. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Advance approval of bridges. 115... BRIDGES BRIDGE LOCATIONS AND CLEARANCES; ADMINISTRATIVE PROCEDURES § 115.70 Advance approval of bridges. (a) The General Bridge Act of 1946 requires the approval of the location and plans of bridges prior...

  5. 9 CFR 3.115 - Food and drinking water requirements. (United States)


    ... would jeopardize the good health and well-being of the animals. (b) Marine mammals being transported in... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Food and drinking water requirements. 3.115 Section 3.115 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE...

  6. 21 CFR 136.115 - Enriched bread, rolls, and buns. (United States)


    ... such food contains in each pound 1.8 milligrams of thiamin, 1.1 milligrams of riboflavin, 15 milligrams... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched bread, rolls, and buns. 136.115 Section 136.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  7. 46 CFR 184.115 - Applicability to existing vessels. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Applicability to existing vessels. 184.115 Section 184... 100 GROSS TONS) VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT General Provisions § 184.115 Applicability to existing vessels. (a) An existing vessel need not comply with §§ 184.402(c), 184.404, 184.410...

  8. 19 CFR 181.115 - Intervention in importer's protest. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Intervention in importer's protest. 181.115... Marking Decisions § 181.115 Intervention in importer's protest. (a) Conditional right to intervene. An...'s protest. Such intervention shall not affect any time limits applicable to the protest or delay...

  9. 19 CFR 115.40 - Technical requirements for containers. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Technical requirements for containers. 115.40...; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS CONVENTIONS Procedures for Approval of Containers After Manufacture § 115.40 Technical requirements for...

  10. 40 CFR 300.115 - Regional Response Teams. (United States)


    ... 40 Protection of Environment 27 2010-07-01 2010-07-01 false Regional Response Teams. 300.115... PLAN Responsibility and Organization for Response § 300.115 Regional Response Teams. (a) Regional... ACPs with the RCP and NCP. (b) The two principal components of the RRT mechanism are a standing team...

  11. 14 CFR 1245.115 - Action by the Administrator. (United States)


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Action by the Administrator. 1245.115... INTELLECTUAL PROPERTY RIGHTS Patent Waiver Regulations § 1245.115 Action by the Administrator. (a) After receiving the transmittal from the Board, the Administrator shall determine, in accordance with the policy...

  12. 27 CFR 11.5 - Delegations of the Administrator. (United States)


    ... Administrator. 11.5 Section 11.5 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Administrator. Most of the regulatory authorities of the Administrator contained in this part are delegated to... Administrator's Authorities in 27 CFR Part 11, Consignment Sales. You may obtain a copy of this order by...

  13. 19 CFR 115.13 - Records to be furnished Customs. (United States)



  14. 19 CFR 115.17 - Appeal to Commissioner of Customs. (United States)



  15. 40 CFR 152.115 - Conditions of registration. (United States)


    ... Section 152.115 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.115 Conditions of... later than the time such data are required to be submitted for similar pesticide products already...

  16. 10 CFR 63.115 - Requirements for multiple barriers. (United States)


    ... Requirements for multiple barriers. Demonstration of compliance with § 63.113(a) must: (a) Identify those design features of the engineered barrier system, and natural features of the geologic setting, that are... 10 Energy 2 2010-01-01 2010-01-01 false Requirements for multiple barriers. 63.115 Section 63.115...

  17. 24 CFR 583.115 - Grants for leasing. (United States)


    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Grants for leasing. 583.115 Section... DEVELOPMENT COMMUNITY FACILITIES SUPPORTIVE HOUSING PROGRAM Assistance Provided § 583.115 Grants for leasing... costs of leasing a structure or structures, or portions thereof, used to provide supportive housing or...

  18. 19 CFR 115.55 - Termination of approval. (United States)


    ... vehicle by a major repair or alteration of any of the essential features required in § 115.51. Repairs by... TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS CONVENTIONS Procedures for Approval of Individual Road Vehicles § 115.55 Termination of approval. Approval of a road...

  19. 15 CFR 930.115 - Termination of mediation. (United States)


    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Termination of mediation. 930.115... MANAGEMENT FEDERAL CONSISTENCY WITH APPROVED COASTAL MANAGEMENT PROGRAMS Secretarial Mediation § 930.115 Termination of mediation. Mediation shall terminate: (a) At any time the Federal and State agencies agree to a...

  20. 46 CFR 115.700 - Permission for repairs and alterations. (United States)


    ... replacement in kind, of electrical wiring, fuel lines, tanks, boilers and other pressure vessels, and steering... 46 Shipping 4 2010-10-01 2010-10-01 false Permission for repairs and alterations. 115.700 Section... AND CERTIFICATION Repairs and Alterations § 115.700 Permission for repairs and alterations. (a...

  1. 19 CFR 115.7 - Designation of additional Certifying Authorities. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Designation of additional Certifying Authorities. 115.7 Section 115.7 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS...

  2. 19 CFR 115.12 - Records maintained by Certifying Authority. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Records maintained by Certifying Authority. 115.12 Section 115.12 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS...

  3. 46 CFR 115.925 - Safety Management Certificate. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Safety Management Certificate. 115.925 Section 115.925... have a valid Safety Management Certificate and a copy of their company's valid Document of Compliance... Safety Management Certificate is issued for a period of not more than 60 months. [CGD 95-073, 62 FR 67515...

  4. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    International Nuclear Information System (INIS)

    Sehmel, G.A.


    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, ΔG/sub f,298//sup o/, ΔH/sub f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction (ΔH/sub r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs

  5. First report of the use of meglumine antimoniate for treatment of canine leishmaniasis in a pregnant dog. (United States)

    Spada, Eva; Proverbio, Daniela; Groppetti, Debora; Perego, Roberta; Grieco, Valeria; Ferro, Elisabetta


    Canine leishmaniasis during pregnancy is rarely reported, even in countries where the infection in dogs is endemic. The authors report a case of a 4 yr old bitch with leishmaniasis treated with meglumine antimoniate during pregnancy. The pregnancy and delivery were normal and the bitch presented improvement of the infection during treatment. Three puppies died within 2 days of birth and tested negative via real-time PCR for L. infantum. The two surviving puppies were followed clinically, serologically, and by real-time PCR until 1 yr of age with no evidence of congenital leishmaniasis. L. infantum DNA was detected with real-time PCR analysis of uterine tissue from the bitch at the time of ovariohysterectomy. PCR analysis was performed after an ovariohysterectomy of the bitch that was performed two months after parturition. Meglumine antimoniate use in the pregnant bitch may have prevented vertical transmission of leishmaniasis.

  6. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate


    Perez-Franco, Jairo E.; Cruz-Barrera, M?nica L.; Robayo, Marta L.; Lopez, Myriam C.; Daza, Carlos D.; Bedoya, Angela; Mari?o, Maria L.; Saavedra, Carlos H.; Echeverry, Maria C.


    Background American cutaneous leishmaniasis (ACL) is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate) under systemic administration. According to different authors, pentavalent antim...

  7. Migration of antimony from PET bottles into beverages: determination of the activation energy of diffusion and migration modelling compared with literature data. (United States)

    Welle, F; Franz, R


    Plastics bottles made from polyethylene terephthalate (PET) are increasingly used for soft drinks, mineral water, juices and beer. In this study a literature review is presented concerning antimony levels found both in PET materials as well as in foods and food simulants. On the other hand, 67 PET samples from the European bottle market were investigated for their residual antimony concentrations. A mean value of 224 ± 32 mg kg(-1) was found, the median was 220 mg kg(-1). Diffusion coefficients for antimony in PET bottle materials were experimentally determined at different temperature between 105 and 150°C. From these data, the activation energy of diffusion for antimony species from the PET bottle wall into beverages and food simulants was calculated. The obtained value of 189 kJ mol(-1) was found to be in good agreement with published data on PET microwave trays (184 kJ mol(-1)). Based on these results, the migration of antimony into beverages was predicted by mathematical migration modelling for different surface/volume ratios and antimony bottle wall concentrations. The results were compared with literature data as well as international legal limits and guidelines values for drinking water and the migration limit set from food packaging legislation. It was concluded that antimony levels in beverages due to migration from PET bottles manufactured according to the state of the art can never reach or exceed the European-specific migration limit of 40 microg kg(-1). Maximum migration levels caused by room-temperature storage even after 3 years will never be essentially higher than 2.5 microg kg(-1) and in any case will be below the European limit of 5 microg kg(-1) for drinking water. The results of this study confirm that the exposure of the consumer by antimony migration from PET bottles into beverages and even into edible oils reaches approximately 1% of the current tolerable daily intake (TDI) established by World Health Organisation (WHO). Having


    Directory of Open Access Journals (Sweden)

    Marcelo Rosandiski LYRA

    Full Text Available SUMMARY American tegumentary leishmaniasis is an infectious disease caused by a protozoan of the genus Leishmania. Pentavalent antimonials are the first choice drugs for cutaneous leishmaniasis (CL, although doses are controversial. In a clinical trial for CL we investigated the occurrence of pancreatic toxicity with different schedules of treatment with meglumine antimoniate (MA. Seventy-two patients were allocated in two different therapeutic groups: 20 or 5 mg of pentavalent antimony (Sb5+/kg/day for 20 or 30 days, respectively. Looking for adverse effects, patients were asked about abdominal pain, nausea, vomiting or anorexia in each medical visit. We performed physical examinations and collected blood to evaluate serum amylase and lipase in the pre-treatment period, and every 10 days during treatment and one month post-treatment. Hyperlipasemia occurred in 54.8% and hyperamylasemia in 19.4% patients. Patients treated with MA 20 mg Sb5+ presented a higher risk of hyperlipasemia (p = 0.023. Besides, higher MA doses were associated with a 2.05 higher risk ratio (p = 0.003 of developing more serious (moderate to severe hyperlipasemia. The attributable fraction was 51% in this group. Thirty-six patients presented abdominal pain, nausea, vomiting or anorexia but only 47.2% of those had hyperlipasemia and/ or hyperamylasemia. These findings suggest the importance of the search for less toxic therapeutic regimens for the treatment of CL.

  9. Antimony speciation analysis in sediment reference materials using high-performance liquid chromatography coupled to hydride generation atomic fluorescence spectrometry

    International Nuclear Information System (INIS)

    Potin-Gautier, M.; Pannier, F.; Quiroz, W.; Pinochet, H.; Gregori, I. de


    This work presents the development of suitable methodologies for determination of the speciation of antimony in sediment reference samples. Liquid chromatography with a post-column photo-oxidation step and hydride generation atomic fluorescence spectrometry as detection system is applied to the separation and determination of Sb(III), Sb(V) and trimethylantimony species. Post-column decomposition and hydride generation steps were studied for sensitive detection with the AFS detector. This method was applied to investigate the conditions under which speciation analysis of antimony in sediment samples can be carried out. Stability studies of Sb species during the extraction processes of solid matrices, using different reagents solutions, were performed. Results demonstrate that for the extraction yield and the stability of Sb species in different marine sediment extracts, citric acid in ascorbic acid medium was the best extracting solution for antimony speciation analysis in this matrix (between 55% and 65% of total Sb was recovered from CRMs, Sb(III) being the predominant species). The developed method allows the separation of the three compounds within 6 min with detection limits of 30 ng g -1 for Sb(III) and TMSbCl2 and 40 ng g -1 for Sb(V) in sediment samples

  10. Antimony speciation analysis in sediment reference materials using high-performance liquid chromatography coupled to hydride generation atomic fluorescence spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Potin-Gautier, M. [Laboratoire de Chimie Analytique, BioInorganique et Environnement LCABIE (UMR CNRS 3054), Universite de Pau et des pays de l' Adour, 64000 Pau (France); Pannier, F. [Laboratoire de Chimie Analytique, BioInorganique et Environnement LCABIE (UMR CNRS 3054), Universite de Pau et des pays de l' Adour, 64000 Pau (France)]. E-mail:; Quiroz, W. [Laboratoire de Chimie Analytique, BioInorganique et Environnement LCABIE (UMR CNRS 3054), Universite de Pau et des pays de l' Adour, 64000 Pau (France); Laboratorio de Quimica Analitica y Ambiental, Instituto de Quimica, Pontificia Universidad catolica de Valparaiso (Chile); Pinochet, H. [Laboratorio de Quimica Analitica y Ambiental, Instituto de Quimica, Pontificia Universidad catolica de Valparaiso (Chile); Gregori, I. de [Laboratorio de Quimica Analitica y Ambiental, Instituto de Quimica, Pontificia Universidad catolica de Valparaiso (Chile)


    This work presents the development of suitable methodologies for determination of the speciation of antimony in sediment reference samples. Liquid chromatography with a post-column photo-oxidation step and hydride generation atomic fluorescence spectrometry as detection system is applied to the separation and determination of Sb(III), Sb(V) and trimethylantimony species. Post-column decomposition and hydride generation steps were studied for sensitive detection with the AFS detector. This method was applied to investigate the conditions under which speciation analysis of antimony in sediment samples can be carried out. Stability studies of Sb species during the extraction processes of solid matrices, using different reagents solutions, were performed. Results demonstrate that for the extraction yield and the stability of Sb species in different marine sediment extracts, citric acid in ascorbic acid medium was the best extracting solution for antimony speciation analysis in this matrix (between 55% and 65% of total Sb was recovered from CRMs, Sb(III) being the predominant species). The developed method allows the separation of the three compounds within 6 min with detection limits of 30 ng g{sup -1} for Sb(III) and TMSbCl2 and 40 ng g{sup -1} for Sb(V) in sediment samples.

  11. Evaluation of potential dietary toxicity of heavy metals in some common Nigerian beverages: A look at antimony, tin and mercury

    Directory of Open Access Journals (Sweden)

    I.I. Roberts


    Full Text Available There is currently little information on the composition of heavy metals in beverages imported and locally produced in Nigeria. The study quantitatively determined the composition of antimony (Sb, tin (Sn and mercury (Hg in 50 different beverage samples and evaluated the extent of violation of guideline values. Analysis of the beverage samples for the presence of Sb, Sn, and Hg was carried out using an atomic absorption spectrophotometer (AAS 929. The mean values detected for mercury, tin and antimony (±SE in fruit juices and soft drinks were 2.39±0.25, 3.66±0.22 and 0.49±0.048 μg/l; 2.93±0.34, 3.60±0.46 and 0.49±0.10 μg/l in dairy drinks and 0.94±0.02, 4.34±0.48 and 0.48±0.05 μg/l in bottled water samples respectively. While antimony detected in all products was below guideline values, mercury and tin were above the acceptable levels established by the World Health Organization, United States Environmental Protection Agency and European Union in most samples tested.

  12. Functioning of antimony film electrode in acid media under cyclic and anodic stripping voltammetry conditions. (United States)

    Sebez, Bine; Ogorevc, Bozidar; Hocevar, Samo B; Veber, Marjan


    New insights into the functioning, i.e. electrochemical behaviour and analytical performance, of in situ prepared antimony film electrodes (SbFEs) under square-wave anodic stripping (SW-ASV) and cyclic (CV) voltammetry conditions are presented by studying several key operational parameters using Pb(II), Cd(II) and Zn(II) as model analyte ions. Five different carbon- and metal-based substrate transducer electrodes revealed a clear advantage of the former ones while the concentration of the precursor Sb(III) ion exhibited a distinct influence on the ASV functioning of the SbFE. Among six acids examined as potential supporting electrolytes the HNO3 was demonstrated to yield nearly identical results in conducting ASV experiments with SbFE as so far almost exclusively used HCl. This is extremely important as HNO3 is commonly employed acidifying agent in trace metal analysis, especially in elemental mass spectrometry measurements. By carrying out a systematic CV and ASV investigation using a medium exchange protocol, we confirmed the formation of poorly soluble oxidized Sb species at the substrate electrode surface at the end of each stripping step, i.e. at the potentials beyond the anodic dissolution of the antimony film. Hence, the significance of the cleaning and initializing the surface of a substrate electrode after accomplishing a stripping step was thoroughly studied in order to find conditions for a complete removal of the adhered Sb-oxides and thus to assure a memory-free functioning of the in situ prepared SbFE. Finally, the practical analytical application of the proposed ASV method was successfully tested and evaluated by measuring the three metal analytes in ground (tap) and surface (river) water samples acidified with HNO3. Our results approved the appropriateness of the SbFE and the proposed method for measuring low μg L(-1) levels of some toxic metals, particularly taking into account the possibility of on-field testing and the use of low cost

  13. Comparative study of hematological responses to platinum group metals, antimony and silver nanoparticles in animal models. (United States)

    Newkirk, Catherine E; Gagnon, Zofia E; Pavel Sizemore, Ioana E


    Research was conducted to examine the hematological effects of heavy metals (platinum (Pt ((IV))), palladium (Pd ((II))), rhodium (Rh ((III))), antimony (Sb ((III)) and Sb ((V))), and silver nanoparticles (AgNPs)) on white blood cells in mammalian (rat) and avian (chick embryo) models. These metals are used in many everyday products and are accumulating in our environment. Six-week old Sprague-Dawley female rats were treated daily by gavage and six-day old, fertile, specific pathogen-free white leghorn strain chick embryos' eggs were injected on days 7 and 14 of incubation with 0.0, 1.0, 5.0 or 10.0 ppm concentrations of Pt ((IV)) and a platinum group metal (PGM) mix of Pt ((IV)), Pd ((II)) and Rh ((III)). Chick embryos were also tested with 1.0 or 5.0 ppm of antimony compounds (Sb ((III)) and Sb ((V))) and 0.0, 15.0, 30.0, 60.0, or 100.0 ppm of silver nanoparticles (AgNPs). After 8 weeks of treatment, blood was obtained from the rats by jugular cut down and from chick embryos on day 20 of incubation by heart puncture. Blood smears were made and stained and a differential white cell count was performed on each. Examination of the smears revealed unconventional dose responses, stimulation of the immune response, and decreases in leukocyte production with various metals and concentrations. Chick embryos responded differently than rats to Pt and the PGM mix; suggesting that species differences and/or stage of development are important components of response to heavy metals. Route of administration of the metals might also influence the response. All of the heavy metals tested affected the immune responses of the tested animals as demonstrated by changes in the types and numbers of leukocytes. Our findings warrant further research to determine the mechanism of these effects and to understand and prevent toxicological effects in humans and other living organisms.

  14. Data Quality Objectives Report for the 115-B Gas Tunnel

    International Nuclear Information System (INIS)

    Bauer, R.G.


    This workbook assisted the Data Quality Objectives Team in implementing the Data Quality Objectives Process through the use of a template which lists the important elements of the DQO. The completion of this workbook is a required element of the BHI-EE-01, Procedure 1.2, 'Data Quality Objectives.' The objective of this project is to define the sampling and analysis requirements for isolation and decontamination and decommissioning release of the 115- B Gas Tunnel. The 115-B Gas Tunnel is an underground concrete pipe tunnel that houses piping used to recirculate helium gas between the 105-B Reactor Building and the 115-B/C Gas Recirculation System

  15. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, J.T. [Department of Geological Sciences, The University of Texas, Austin, TX 78759 (United States); Bennett, P.C., E-mail: [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States); Engel, A.S. [Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803 (United States); Alsina, M.A.; Pasten, P.A. [Departamento de Ingenieria Hidraulica y Ambiental, Pontificia Universidad Catolica de Chile, Santiago (Chile); Milliken, K. [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States)


    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with {approx}0.45 and 0.021 mmol L{sup -1} total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb{sub 2}O{sub 3}. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  16. Retardation of grain boundary self-diffusion in nickel doped with antimony and tin

    International Nuclear Information System (INIS)

    Padgett, R.A.; White, C.L.


    Many important metallurgical phenomena are strongly influenced or controlled by grain boundary mass transport. There is also much evidence that the composition of grain boundaries is often significantly different from the overall composition of metals and alloys, owing to strong segregation of residual (and often undetected) impurities. This segregation, which does not always advertise its presence through grain boundary brittleness, may vary markedly from heat to heat, and occasionally from specimen to specimen within a given heat. Unfortunately, there are relatively few experimental observations of how such segregation affects grain boundary mass transport, and even less fundamental understanding of how these effects occur. In this paper we present autoradiographic results on self-diffusion of 63 Ni in nickel and nickel doped with antimony and tin. While these results do not permit a quantitative evaluation of the grain boundary diffusivity, D, they qualitatively illustrate the dramatic effect that these solute elements have on the ability of nickel grain boundaries to act as preferential paths for mass transport

  17. Excitation functions for alpha-particle-induced reactions with natural antimony

    Energy Technology Data Exchange (ETDEWEB)

    Singh, N. L.; Shah, D. J.; Mukherjee, S.; Chintalapudi, S. N. [Vadodara, M. S. Univ. of Baroda (India). Fac. of Science. Dept. of Physics


    Stacked-foil activation technique and {gamma} - rays spectroscopy were used for the determination of the excitation functions of the {sup 121}Sb [({alpha}, n); ({alpha}, 2n); ({alpha},4 n); ({alpha}, p3n); ({alpha}, {alpha}n)]; and Sb [({alpha}, 3n); ({alpha}, 4n); ({alpha}, {alpha}3n)] reactions. The excitation functions for the production of {sup 124}I, {sup 123}I, {sup 121}I, {sup 121}Te and {sup 120}Sb were reported up to 50 MeV. The reactions {sup 121} Sb ({alpha}, {alpha}n) + {sup 123} Sb ({alpha}, {alpha}3n) are measured for the first time. Since natural antimony used as the target has two odd mass stable isotopes of abundances 57.3 % ({sup 121}Sb), their activation in some cases gives the same product nucleus through different reaction channels but with very different Q-values. In such cases, the individual reaction cross-sections are separated with the help of theoretical cross-sections. The experimental cross-sections were compared with the predictions based on hybrid model of Blann. The high-energy part of the excitation functions are dominated by the pre-equilibrium reaction mechanism and the initial exciton number n{sub 0} = 4 (4 p 0 h) gives fairly good agreement with presently measured results.

  18. Synthesis of Water-Soluble Antimony Sulfide Quantum Dots and Their Photoelectric Properties (United States)

    Zhu, Jiang; Yan, Xuelian; Cheng, Jiang


    Antimony sulfide (Sb2S3) has been applied in photoelectric devices for a long time. However, there was lack of information about Sb2S3 quantum dots (QDs) because of the synthesis difficulties. To fill this vacancy, water-soluble Sb2S3 QDs were prepared by hot injection using hexadecyltrimethylammonium bromide (CTAB) and sodium dodecyl sulfate (SDS) mixture as anionic-cationic surfactant, alkanol amide (DEA) as stabilizer, and ethylenediaminetetraacetic acid (EDTA) as dispersant. Photoelectric properties including absorbing and emission were characterized by UV-Vis-IR spectrophotometer and photoluminescence (PL) spectroscopic technique. An intensive PL emission at 880 nm was found, indicating Sb2S3 QDs have good prospects in near-infrared LED and near-infrared laser application. Sb2S3 QD thin films were prepared by self-assembly growth and then annealed in argon or selenium vapor. Their band gaps ( E g s) were calculated according to transmittance spectra. The E g of Sb2S3 QD thin film has been found to be tunable from 1.82 to 1.09 eV via annealing or selenylation, demonstrating the good prospects in photovoltaic application.

  19. Synthesis and evaluation of lead telluride/bismuth antimony telluride nanocomposites for thermoelectric applications (United States)

    Ganguly, Shreyashi; Zhou, Chen; Morelli, Donald; Sakamoto, Jeffrey; Uher, Ctirad; Brock, Stephanie L.


    Heterogeneous nanocomposites of p-type bismuth antimony telluride (Bi 2- xSb xTe 3) with lead telluride (PbTe) nanoinclusions have been prepared by an incipient wetness impregnation approach. The Seebeck coefficient, electrical resistivity, thermal conductivity and Hall coefficient were measured from 80 to 380 K in order to investigate the influence of PbTe nanoparticles on the thermoelectric performance of nanocomposites. The Seebeck coefficients and electrical resistivities of nanocomposites decrease with increasing PbTe nanoparticle concentration due to an increased hole concentration. The lattice thermal conductivity decreases with the addition of PbTe nanoparticles but the total thermal conductivity increases due to the increased electronic thermal conductivity. We conclude that the presence of nanosized PbTe in the bulk Bi 2- xSb xTe 3 matrix results in a collateral doping effect, which dominates transport properties. This study underscores the need for immiscible systems to achieve the decreased thermal transport properties possible from nanostructuring without compromising the electronic properties.

  20. Phase diagram of antimony up to 31 GPa and 835 K (United States)

    Coleman, A. L.; Stevenson, M.; McMahon, M. I.; Macleod, S. G.


    X-ray powder diffraction experiments using resistively heated diamond anvil cells have been conducted in order to establish the phase behavior of antimony up to 31 GPa and 835 K. The dip in the melting curve at 5.7 GPa and 840 K is identified as the triple point between the Sb-I, incommensurate Sb-II, and liquid phases. No evidence of the previously reported simple cubic phase was observed. Determination of the phase boundary between Sb-II and Sb-III suggests the existence of a second triple point in the region of 13 GPa and 1200 K. The incommensurate composite structure of Sb-II was found to remain ordered to the highest temperatures studies—no evidence of disordering of the guest-atom chains was observed. Indeed, the modulation reflections that arise from interactions between the host and guest subsystems were found to be present to the highest temperatures, suggesting such interactions remain relatively strong in Sb even in the presence of increased thermal motion. Finally, we show that the incommensurately modulated structure recently reported as giving an improved fit to diffraction data from incommensurate Ba-IV can be rejected as the structure of Sb-II using a simple density argument.

  1. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells. (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya


    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells.

  2. Determination of antimony by using a quartz atom trap and electrochemical hydride generation atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Menemenlioglu, Ipek; Korkmaz, Deniz [Department of Chemistry, Middle East Technical University, 06531 Ankara (Turkey); Ataman, O. Yavuz [Department of Chemistry, Middle East Technical University, 06531 Ankara (Turkey)], E-mail:


    The analytical performance of a miniature quartz trap coupled with electrochemical hydride generator for antimony determination is described. A portion of the inlet arm of the conventional quartz tube atomizer was used as an integrated trap medium for on-line preconcentration of electrochemically generated hydrides. This configuration minimizes transfer lines and connections. A thin-layer of electrochemical flow through cell was constructed. Lead and platinum foils were employed as cathode and anode materials, respectively. Experimental operation conditions for hydride generation as well as the collection and revolatilization conditions for the generated hydrides in the inlet arm of the quartz tube atomizer were optimized. Interferences of copper, nickel, iron, cobalt, arsenic, selenium, lead and tin were examined both with and without the trap. 3{sigma} limit of detection was estimated as 0.053 {mu}g l{sup -1} for a sample size of 6.0 ml collected in 120 s. The trap has provided 18 fold sensitivity improvement as compared to electrochemical hydride generation alone. The accuracy of the proposed technique was evaluated with two standard reference materials; Trace Metals in Drinking Water, Cat CRM-TMDW and Metals on Soil/Sediment 4, IRM-008.

  3. Determination of antimony by using a quartz atom trap and electrochemical hydride generation atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Menemenlioglu, Ipek; Korkmaz, Deniz; Ataman, O. Yavuz


    The analytical performance of a miniature quartz trap coupled with electrochemical hydride generator for antimony determination is described. A portion of the inlet arm of the conventional quartz tube atomizer was used as an integrated trap medium for on-line preconcentration of electrochemically generated hydrides. This configuration minimizes transfer lines and connections. A thin-layer of electrochemical flow through cell was constructed. Lead and platinum foils were employed as cathode and anode materials, respectively. Experimental operation conditions for hydride generation as well as the collection and revolatilization conditions for the generated hydrides in the inlet arm of the quartz tube atomizer were optimized. Interferences of copper, nickel, iron, cobalt, arsenic, selenium, lead and tin were examined both with and without the trap. 3σ limit of detection was estimated as 0.053 μg l -1 for a sample size of 6.0 ml collected in 120 s. The trap has provided 18 fold sensitivity improvement as compared to electrochemical hydride generation alone. The accuracy of the proposed technique was evaluated with two standard reference materials; Trace Metals in Drinking Water, Cat CRM-TMDW and Metals on Soil/Sediment 4, IRM-008

  4. 90Y-labeled antimony trisulfide colloid as promising therapeutic agent: Physicochemical characterization and biological evaluation

    Directory of Open Access Journals (Sweden)

    Janković Drina Lj.


    Full Text Available Introduction The suitability of 90Y-labeled antimony trisulfide colloid (ATC for the preparation of therapeutic radiopharmaceutical was studied taking into accounts its physicochemical properties and biological behavior in rats. Material and methods The labeling efficiency of 90Y- and 99mTc-labeled colloid particles was investigated by ITLC-SG and paper chromatography, the in vitro stability of the colloid was tested in human serum, while in vivo experiments were performed on healthy Wistar rats. Analysis of the particles enclosed the size (TEM, determination of the zeta potential (Zetasizer Nano as well as radioactivity particle size distribution (filtration analysis. Results 90Y-labeled ATC can be prepared in high yield under investigated conditions Labeling efficiency was >95% and filtration analysis showed that more than 90% of radioactive particles were smaller than 20 nm. The particles with the size range of 6-22 nm were achieved by using polyvinyipyrrolidone (mol wt ~44,000. The 90Y-ATC was quite stable in vitro in human serum. Tissue distribution studies in rats confirmed that the liver and spleen uptake of 90Y-labeled colloid was three-fold lower in comparison with 99mTc-ATC, although the bone uptake was five-fold higher at 20 min post injection. Conclusions 90Y-labeled ATC showed high labeling efficiency and good stability, and might be well suited for therapeutic application in nuclear medicine.

  5. Carbon nanotubes modified with antimony nanoparticles: A novel material for electrochemical sensing

    International Nuclear Information System (INIS)

    Moraes, Fernando C.; Cesarino, Ivana; Cesarino, Vivian; Mascaro, Lucia H.; Machado, Sergio A.S.


    Highlights: ► A novel material for the electrochemical sensing was developed. ► Sensor based CNTs modified with Sb-nanoparticles was characterised and applied. ► The proposed sensor was suitable and sensitive for the determination of bisphenol A. - Abstract: In this study, a novel material for the electrochemical determination of bisphenol A using a nanocomposite based on multi-walled carbon nanotubes modified with antimony nanoparticles has been investigated. The morphology, structure, and electrochemical performance of the nanocomposite electrodes were characterised by field emission gun scanning electron microscopy, energy-dispersive X-ray spectroscopy, and cyclic voltammetry. A scan rate study and electrochemical impedance spectroscopy showed that the bisphenol A oxidation product is adsorbed on nanocomposite electrode surface. Differential pulse voltammetry in phosphate buffer solution at pH 6, allowed the development of a method to determine bisphenol A levels in the range of 0.5–5.0 μmol L −1 , with a detection limit of 5.24 nmol L −1 (1.19 μg L −1 ).

  6. Leaching of Antimony (Sb)from Municipal Solid Waste Incineration (MSWI) Residues

    Energy Technology Data Exchange (ETDEWEB)

    Herrmann, Inga


    The mobility of antimony (Sb) in municipal solid waste incineration (MSWI) residues often exceeds the limit values stipulated by the European Union. As an ash treatment by washing is conceivable, this work investigated the Sb release from Swedish bottom ash and fly ash when mixed with water. The leaching experiments revealed the factors significantly (a = 0.05) affecting Sb release from the ashes. The following factors were investigated: Liquid to solid ratio (L/S), time, pH, carbonation (treatment with CO{sub 2}), ultrasonics and temperature. The data were evaluated using multiple linear regression (MLR). The impact of the factors could be quantified. The maximum Sb release calculated was 13 mg/kg DM for bottom ash and 51 mg/kg DM for fly ash. The derived models explained the observed data well. Nevertheless, the calculated values were subject to a high uncertainty. For bottom ash, a lowering of the Sb total content of approximately 22% could be achieved. If this also involves a sufficient lowering of the Sb mobility to meet EU limit values could not yet be assessed. Chemical equilibrium calculations were performed to explain the empirical results. However, no solid phases controlling Sb release from the ashes could be identified.

  7. Synthesis and characterization of copper antimony tin sulphide thin films for solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Ali, N., E-mail: [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Department of Physics, Govt. Post Graduate Jehanzeb College Saidu Sharif, Swat, 19200 (Pakistan); Hussain, A. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Ahmed, R., E-mail: [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Wan Shamsuri, W.N. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, UTM Skudai, 81310 Johor (Malaysia); Fu, Y.Q., E-mail: [Department of Physics and Electrical Engineering, Faculty of Engineering & Environment, University of Northumbria, Newcastle upon Tyne, NE1 8ST (United Kingdom)


    Highlights: • A new and novel material for solar cell applications is demonstrated as a replacement for toxic and expansive compounds. • The materials used in this compound are abundant and low cost. • Compound exhibit unusual optical and electrical properties. • The band gap was found to be comparable with that of GaAs. - Abstract: Low price thin film modules based on Copper antimony tin sulphide (CATS) are introduced for solar harvesting to compete for the already developed compound semiconductors. Here, CATS thin films were deposited on soda lime glass by thermal evaporation technique followed by a rapid thermal annealing in an argon atmosphere. From Our XRD analysis, it was revealed that the annealed samples were poly-crystalline and their crystallinity was improved with increasing annealing temperature. The constituent elements and their corresponding chemical states were identified using X-ray photoelectron spectroscopy. The obtained optical band gap of 1.4 eV for CATS thin film is found nearly equal to GaAs – one of the highly efficient thin film material for solar cell technology. Furthermore, our observed good optical absorbance and low transmittance for the annealed CATS thin films in the visible region of light spectrum assured the aptness of the CATS thin films for solar cell applications.

  8. Capacity extended bismuth-antimony cathode for high-performance liquid metal battery (United States)

    Dai, Tao; Zhao, Yue; Ning, Xiao-Hui; Lakshmi Narayan, R.; Li, Ju; Shan, Zhi-wei


    Li-Bi based liquid metal batteries (LMBs) have attracted interest due to their potential for solving grid scale energy storage problems. In this study, the feasibility of replacing the bismuth cathode with a bismuth-antimony alloy cathode in lithium based LMBs is investigated. The influence of the Bi:Sb ratio on voltage characteristics is evaluated via the constant current discharge method and electrochemical titration. On observing the cross section of the electrode at various stages of discharge, it is determined that both Sb and Bi form solid intermetallics with Li on the cathode. Additionally, the addition of Bi not only reduces the melting temperature of the Bi:Sb intermetallic but also actively contributes to the electrode capacity. Thereafter, a Li|LiCl-LiF|Sb-Bi liquid metal battery with 3 A h nameplate capacity, assembled and cycled at 1 C rate, is found to possess a stable capacity for over 160 cycles. The overall performance of this battery is discussed in the context of cost effectiveness, energy and coulombic efficiencies.

  9. Effects of antimony trisulfide (Sb2S3) on sliding friction of automotive brake friction materials (United States)

    Lee, Wan Kyu; Rhee, Tae Hee; Kim, Hyun Seong; Jang, Ho


    The effect of antimony trisulfide (Sb2S3) on the tribological properties of automotive brake friction materials was investigated using a Krauss type tribometer and a 1/5 scale dynamometer with a rigid caliper. Results showed that Sb2S3 improved fade resistance by developing transfer films on the disc surface at elevated temperatures. On the other hand, the rubbing surfaces of the friction material exhibited contact plateaus with a broader height distribution when it contained Sb2S3, indicating fewer contact junctions compared to the friction material with graphite. The friction material with Sb2S3 also exhibited a lower stick-slip propensity than the friction material with graphite. The improved fade resistance with Sb2S3 is attributed to its lubricating capability sustained at high temperatures, while the lower stick-slip propensity of the friction material with Sb2S3 is associated with the slight difference between its static and kinetic coefficients of friction and high normal stiffness.

  10. Assessment and distribution of antimony in soils around three coal mines, Anhui, China (United States)

    Qi, C.; Liu, Gaisheng; Kang, Y.; Lam, P.K.S.; Chou, C.


    Thirty-three soil samples were collected from the Luling, Liuer, and Zhangji coal mines in the Huaibei and Huainan areas of Anhui Province, China. The samples were analyzed for antimony (Sb) by inductively coupled plasmaoptical emission spectrometry (ICP-OES) method. The average Sb content in the 33 samples was 4 mg kg-1, which is lower than in coals from this region (6.2 mg kg-1). More than 75% of the soils sampled showed a significant degree of Sb pollution (enrichment factors [EFs] 5-20). The soils collected near the gob pile and coal preparation plant were higher in Sb content than those collected from residential areas near the mines. The gob pile and tailings from the preparation plant were high in mineral matter content and high in Sb. They are the sources of Sb pollution in surface soils in the vicinity of coal mines. The spatial dispersion of Sb in surface soil in the mine region shows that Sb pollution could reach out as far as 350 m into the local environment conditions. Crops in rice paddies may adsorb some Sb and reduce the Sb content in soils from paddyfields. Vertical distribution of Sb in two soil profiles indicates that Sb is normally relatively immobile in soils. ?? 2011 Air & Waste Management Association.

  11. Adsorption of Antimony by Bagasse Fly Ash: Chemical Modification and Adsorption Mechanism. (United States)

    Leechart, Piyawan; Inthorn, Duangrat; Thiravetyan, Paitip

      Modification of bagasse fly ash (BFA) and the adsorption mechanism of antimony (Sb) by modified BFA were studied. It was found that BFA grafted with acrylic acid (BFAG) and BFA treated with hydrochloric acid (BFA/HCl) led to a decrease in the pH of the zero point of charge (pH zpc ) of the adsorbents. The pH zpc of BFA, BFAG, BFA/HCl and activated carbon (AC) were 8.3, 6.4, 6.2 and 8.2, respectively. The maximum adsorption capacities (Q max ) of Sb by BFA, BFAG, BFA/HCl and AC were 0.14, 0.34, 0.38 and 0.29 mg Sb/g adsorbent, respectively. Modified BFA had Q max higher than AC although the BET surface area of AC was the highest. This was due to the system pH of BFAG and BFA/HCl was 5.20-6.00 and the pH zpc of BFAG and BFA/HCl accounted for 6.4 and 6.2, respectively. Therefore, the adsorbent surface had a positive charge, resulting in increasing adsorption of Sb.

  12. Effective photoexcitation cross section of 115In(γ,γ′115mIn from photoactivation data

    Directory of Open Access Journals (Sweden)

    Versteegen M.


    Full Text Available Photoexcitation yields of the 115mIn metastable state were measured with Bremsstrahlung γ beams over a range of endpoint energies between 4.5 and 18 MeV. An effective cross section of the 115In(γ,γ′115mIn photoexcitation cross section was determinedto reproduce the data. This cross section is built from a cross section calculated with the TALYS code, to which an enhancement is added at about 8.5 MeV.

  13. 19 CFR 115.28 - Application for approval. (United States)


    ... the— (i) Type of construction; (ii) Dimensions; (iii) Material of construction; (iv) Coating system... before adoption; and (3) Each container will be marked with: (i) The metal plate required in § 115.32...

  14. 46 CFR 115.702 - Installation tests and inspections. (United States)


    ... CERTIFICATION Repairs and Alterations § 115.702 Installation tests and inspections. Whenever a launching appliance, survival craft, rescue boat, fixed gas fire extinguishing system, machinery, fuel tank, or...

  15. Speciation of very low amounts of antimony in waters using magnetic core-modified silver nanoparticles and electrothermal atomic absorption spectrometry. (United States)

    López-García, Ignacio; Rengevicova, Silvia; Muñoz-Sandoval, María J; Hernández-Córdoba, Manuel


    A micro-solid phase extraction procedure for the separation and preconcentration of antimony based in the use of magnetic particles covered with silver nanoparticles functionalized with the sodium salt of 2-mercaptoethane-sulphonate (MESNa) is discussed. After separation by means of a magnetic field, the solid phase is directly introduced into an electrothermal atomizer for antimony determination. Alternatively, the solid can be slurried and then injected into the atomizer. In all cases, palladium nitrate is used as a chemical modifier. The preconcentration factors are close to 205 and 325, with detection limits of 0.02 and 0.03µgL -1 antimony, for the slurry and solid sampling procedures, respectively. Speciation of Sb(III) and Sb(V) is achieved by means of two extractions carried out at different acidity. The results for total antimony are verified using certified reference materials. Water samples are analyzed for antimony speciation. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. 21 CFR 135.115 - Goat's milk ice cream. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Goat's milk ice cream. 135.115 Section 135.115... Goat's milk ice cream. (a) Description. Goat's milk ice cream is the food prepared in the same manner prescribed in § 135.110 for ice cream, and complies with all the provisions of § 135.110, except that the...

  17. Failure of both azithromycin and antimony to treat cutaneous leishmaniasis in Manaus, AM, Brazil Falha da azitromicina e do antimonial no tratamento da leishmaniose cutânea em Manaus, AM, Brasil

    Directory of Open Access Journals (Sweden)

    Alan César Teixeira


    Full Text Available A non-randomized controlled clinical trial was carried outin order to evaluate both azithromycin and antimony efficacy in cutaneous leishmaniasis in Manaus, AM, Brazil. Forty nine patients from both genders, aged 14 to 70, with cutaneous ulcers for less than three months and a positive imprint for Leishmania spp. amastigotes were recruited into two groups. Group I (26 patients received a daily-single oral dose of 500 mg of azithromycin for 20 days and Group II (23 patients received a daily-single intramuscular dose of 20 mg/kg of meglumine antimony, also for 20 days. Azithromycin cured three of 24 (12.5% patients on days 60, 90 and 120 respectively whereas therapeutic failure was considered in 21 of 24 (87.5% cases. In group II, antimony cured eight of 19 (42.1% cases as follows: three on day 30, one each on day 60 and day 90, and three on day 120. Therapeutic failure occurred in 11 of 19 (57.9% individuals. The efficacy of antimony for leishmaniasis was better than azithromycin but analysis for the intention-to-treat response rate did not show statistical difference between them. Although azithromycin was better tolerated, it showed a very low efficacy to treat cutaneous leishmaniasis in Manaus.Com o objetivo de avaliar a eficácia da azitromicina no tratamento da leishmaniose cutânea, foi realizado ensaio comparativo, em Manaus. Foram recrutados 49 pacientes de ambos os sexos, com idades entre 14 e 70 anos que apresentassem úlceras cutâneas com menos de três meses de evolução e que tivessem exame direto positivo para amastigotas de leishmânia. Estes pacientes foram alocados em dois grupos assim: Grupo I (26 recebeu uma dose diária de 500 mg de azitromicina pela via oral durante 20 dias e o Grupo II, recebeu uma dose diária de 20 mg/kg de antimoniato de meglumina por via intramuscular, durante 20 dias. Do grupo da azitromicina, três (12,5% de 24 pacientes curaram 60, 90 e 120 dias, respectivamente, enquanto, em 21 (87,5% de 24 houve

  18. Comparison of modification with strontium and the refining with antimony in A 356 aluminium alloys; Comparacao entre a modificacao com estroncio e o refino com antimonio em ligas de aluminio a 356

    Energy Technology Data Exchange (ETDEWEB)

    Fuoco, Ricardo; Correa, Edison Roberto; Correa, Alzira V.O.; Bocalini Junior, Mario


    Strontium and Antimony treated A356 aluminium alloy samples were metallographically characterized in the as cast and solution and aged conditions. Antimony treated alloy has shown slower spheroidizing kinetics of the Silicon particles during solution treatment, lower porosity level and higher tensile strength and elongation than Strontium treated one. (author) 26 refs., 13 figs., 2 tabs.

  19. Changes induced by gamma radiation in nanocomposites based on copper II and antimony sulfides in commercial poly(methyl methacrylate) matrix

    International Nuclear Information System (INIS)

    Albuquerque, M.C.C. de; Garcia, O.P.; Aquino, K.A.S.; Araujo, E.S.


    Poly (methyl methacrylate) (PMMA) is a polymer with wide application in the manufacture of medical devices that is exposed to gamma irradiation. Currently the use of composite materials has been disseminated and PMMA is an excellent polymer matrix to package various materials. This study aimed to analyze the changes induced by gamma irradiation (25 kGy) on the properties of PMMA nanocomposites with nanoparticles of copper II sulfide (250nm-900nm) and antimony sulfite (300-500 nm). The nanoparticles were added to the polymer in different concentrations and synthesized by ultrasonic irradiation from the corresponding chlorides with thioacetamide. Viscometric results showed a good radioprotective effect of nanoparticles of copper and antimony. It was found a good protection of nanoparticles on PMMA matrix in the concentration of 0.3% wt. The protections of 75% and 50% were calculated for nanoparticles of antimony and copper II, respectively. (author)

  20. Nuclear resonance scattering study of iridates, iridium and antimony based pyrochlores

    Energy Technology Data Exchange (ETDEWEB)

    Alexeev, P.


    on Ir nucleus have been determined for these compounds. In order to broaden the perspectives of NRS with the 73 keV resonance the first room temperature NRS on iridium metal is carried out. The results demonstrate NRS as a powerful research tool for the studies of iridium physics due to the high energy of the resonant photons and the high natural abundance of the {sup 193}Ir isotope under study, paving the way for studies of magnetism and electronic properties under extreme conditions. The second part of this work is dedicated to vibrational spectroscopy with Nuclear Inelastic Scattering (NIS). A sapphire backscattering monochromator was designed, installed and tested at the beamline. It provides high energy resolution due to the sub-mK temperature control, though the resolution is limited from theoretically proposed sub-meV to meV by the quality of currently available sapphire crystals. With this device the energy resolution of 1.3(1) meV at 23.88 keV and of 3.2(4) meV at 37.13 keV was achieved. Following this development, the vibrational spectra of antimony in defect pyrochlore Ag-Sb-O compounds have been measured by means of NIS at 37.13 keV. Density of phonon states for the Sb(III) and for the Sb(V) site has been unambiguously revealed. The difference in site-specific antimony modes illustrates the importance of lattice dynamics for the engineering of these compounds.

  1. Nuclear resonance scattering study of iridates, iridium and antimony based pyrochlores

    International Nuclear Information System (INIS)

    Alexeev, P.


    these compounds. In order to broaden the perspectives of NRS with the 73 keV resonance the first room temperature NRS on iridium metal is carried out. The results demonstrate NRS as a powerful research tool for the studies of iridium physics due to the high energy of the resonant photons and the high natural abundance of the 193 Ir isotope under study, paving the way for studies of magnetism and electronic properties under extreme conditions. The second part of this work is dedicated to vibrational spectroscopy with Nuclear Inelastic Scattering (NIS). A sapphire backscattering monochromator was designed, installed and tested at the beamline. It provides high energy resolution due to the sub-mK temperature control, though the resolution is limited from theoretically proposed sub-meV to meV by the quality of currently available sapphire crystals. With this device the energy resolution of 1.3(1) meV at 23.88 keV and of 3.2(4) meV at 37.13 keV was achieved. Following this development, the vibrational spectra of antimony in defect pyrochlore Ag-Sb-O compounds have been measured by means of NIS at 37.13 keV. Density of phonon states for the Sb(III) and for the Sb(V) site has been unambiguously revealed. The difference in site-specific antimony modes illustrates the importance of lattice dynamics for the engineering of these compounds.

  2. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate.

    Directory of Open Access Journals (Sweden)

    Jairo E Perez-Franco


    Full Text Available American cutaneous leishmaniasis (ACL is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate under systemic administration. According to different authors, pentavalent antimonial derivatives as treatment for ACL show a healing rate of about 75% and reasons for treatment failure are not well known.In order to characterise the clinical and parasitological features of patients with ACL that did not respond to Glucantime, a cross-sectional observational study was carried out in a cohort of 43 patients recruited in three of the Colombian Army National reference centers for complicated ACL. Clinical and paraclinical examination, and epidemiological and geographic information were recorded for each patient. Parasitological, histopathological and PCR infection confirmation were performed. Glucantime IC50 and in vitro infectivity for the isolated parasites were estimated.Predominant infecting Leishmania species corresponds to L. braziliensis (95.4% and 35% of the parasites isolated showed a significant decrease in in vitro Glucanatime susceptibility associated with previous administration of the medicament. Lesion size and in vitro infectivity of the parasite are negatively correlated with decline in Glucantime susceptibility (Spearman: r = (-0,548 and r = (-0,726; respectively.A negative correlation between lesion size and parasite resistance is documented. L. braziliensis was found as the main parasite species associated to lesion of patients that underwent treatment failure or relapse. The indication of a second round of treatment in therapeutic failure of ACL, produced by L. braziliensis, with pentavalent antimonial derivatives is discussable.

  3. First-line therapy for human cutaneous leishmaniasis in Peru using the TLR7 agonist imiquimod in combination with pentavalent antimony.

    Directory of Open Access Journals (Sweden)

    Cesar Miranda-Verastegui


    Full Text Available Current therapies for cutaneous leishmaniasis are limited by poor efficacy, long-term course of treatment, and the development of resistance. We evaluated if pentavalent antimony (an anti-parasitic drug combined with imiquimod (an immunomodulator was more effective than pentavalent antimony alone in patients who had not previously been treated.A randomized double-blind clinical trial involving 80 cutaneous leishmaniasis patients was conducted in Peru. The study subjects were recruited in Lima and Cusco (20 experimental and 20 control subjects at each site. Experimental arm: Standard dose of pentavalent antimony plus 5% imiquimod cream applied to each lesion three times per week for 20 days. Control arm: Standard dose of pentavalent antimony plus placebo (vehicle cream applied as above. The primary outcome was cure defined as complete re-epithelization with no inflammation assessed during the 12 months post-treatment period.Of the 80 subjects enrolled, 75 completed the study. The overall cure rate at the 12-month follow-up for the intention-to-treat analysis was 75% (30/40 in the experimental arm and 58% (23/40 in the control arm (p = 0.098. Subgroup analyses suggested that combination treatment benefits were most often observed at the Cusco site, where L. braziliensis is the prevalent species. Over the study period, only one adverse event (rash was recorded, in the experimental arm.The combination treatment of imiquimod plus pentavalent antimony performed better than placebo plus pentavalent antimony, but the difference was not statistically significant.Clinical NCT00257530.

  4. Synthesis and evaluation of lead telluride/bismuth antimony telluride nanocomposites for thermoelectric applications

    International Nuclear Information System (INIS)

    Ganguly, Shreyashi; Zhou Chen; Morelli, Donald; Sakamoto, Jeffrey; Uher, Ctirad; Brock, Stephanie L.


    Heterogeneous nanocomposites of p-type bismuth antimony telluride (Bi 2−x Sb x Te 3 ) with lead telluride (PbTe) nanoinclusions have been prepared by an incipient wetness impregnation approach. The Seebeck coefficient, electrical resistivity, thermal conductivity and Hall coefficient were measured from 80 to 380 K in order to investigate the influence of PbTe nanoparticles on the thermoelectric performance of nanocomposites. The Seebeck coefficients and electrical resistivities of nanocomposites decrease with increasing PbTe nanoparticle concentration due to an increased hole concentration. The lattice thermal conductivity decreases with the addition of PbTe nanoparticles but the total thermal conductivity increases due to the increased electronic thermal conductivity. We conclude that the presence of nanosized PbTe in the bulk Bi 2−x Sb x Te 3 matrix results in a collateral doping effect, which dominates transport properties. This study underscores the need for immiscible systems to achieve the decreased thermal transport properties possible from nanostructuring without compromising the electronic properties. - Graphical abstract: PbTe nanoparticles introduced into p-type Bi 2 Te 3 by incipient wetness results in decreased lattice thermal conductivity, but also acts as an electronic dopant, resulting in an overall decrease in thermoelectric performance. Highlights: ► Composites of PbTe nanoparticles in Bi 2−x Sb x Te 3 were formed by incipient wetness. ► PbTe nanoparticles leads to decreased κ l , consistent with phonon scattering. ► PbTe nanoparticles lead to decreased S and ρ, due to increased carriers. ► Collateral doping from PbTe leads to decreased ZT with increasing concentration. ► Immiscible systems are preferred for improved ZT.

  5. Antimony and arsenic leaching from secondary lead smelter air-pollution-control residues. (United States)

    Ettler, Vojtech; Mihaljevic, Martin; Sebek, Ondrej


    Environments in the vicinity of the lead (Pb) smelters are contaminated by emissions containing high concentrations of antimony (Sb) and arsenic (As). Air-pollution-control (APC) residues from bag-type filters from a secondary Pb smelter were subjected to leaching experiments to elucidate the controlling mechanisms of Sb and As release. Kinetic batch leaching tests at a liquid-to-solid (L/S) ratio of 10 L kg(- 1) within the time frame of 720 hours and batch leaching at various L/S ratios (ranging from 1 to 1000 L kg(-1)) were performed. In contrast to other inorganic contaminants (Pb, Cd, Zn), less than 1% of the total Sb and As content was leached from the residues. At a L/S ratio of 10, the As and Sb concentrations in the leachates exceeded the EU limit values for non-hazardous waste (0.2 and 0.07 mg L(-1) ). According to PHREEQC-2 calculations, the concentrations of As and Sb are controlled by the precipitation of complex arsenates and antimonates mainly at low L/S ratios. The washing and related chemical/mineralogical transformation of APC residues was suggested as a technological pre-treatment process before their re-smelting in a blast furnace. The Ferrox-like processing of the resulting contaminated process water/leachate was simulated using the PHREEQC-2 code. Significant reduction was obtained in the concentration of some key contaminants (As, Cu, Pb, Zn) related to sorption on newly formed hydrous ferric oxides, whereas Sb and Cd exhibited only limited attenuation.

  6. Deposition efficiency in the preparation of ozone-producing nickel and antimony doped tin oxide anodes

    Directory of Open Access Journals (Sweden)

    Staffan Sandin


    Full Text Available The influence of precursor salts in the synthesis of nickel and antimony doped tin oxide (NATO electrodes using thermal decomposition from dissolved chloride salts was investigated. The salts investigated were SnCl4×5H2O, SnCl2×2H2O, SbCl3 and NiCl2×6H2O. It was shown that the use of SnCl4×5H20 in the preparation process leads to a tin loss of more than 85 %. The loss of Sb can be as high as 90 % while no indications of Ni loss was observed. As a consequence, the concentration of Ni in the NATO coating will be much higher than in the precursor solution. This high and uncontrolled loss of precursors during the preparation process will lead to an unpredictable composition in the NATO coating and will have negative economic and environmental effects. It was found that using SnCl2×2H20 instead of SnCl4×5H2O can reduce the tin loss to less than 50 %. This tin loss occurs at higher temperatures than when using SnCl4×5H2O where the tin loss occurs from 56 – 147 °C causing the composition to change both during the drying (80 – 110 °C and calcination (460 -550 °C steps of the preparation process. Electrodes coated with NATO based on the two different tin salts were investigated for morphology, composition, structure, and ozone electrocatalytic properties.

  7. Intralesional Infiltration with Meglumine Antimoniate for the Treatment of Leishmaniasis Recidiva Cutis in Ecuador. (United States)

    Calvopiña, Manuel; Cevallos, William; Paredes, Yolanda; Puebla, Edison; Flores, Jessica; Loor, Richard; Padilla, José


    Meglumine Antimoniate (MA), administered intramuscularly for 21 continuous days is the recommended treatment of leishmaniases in Ecuador. However, because of its toxicity and requirement for intramuscular injections, treatment is frequently abandoned before completion. In addition, therapeutic failure and reactivation are not uncommon. Here we evaluate the efficacy and safety of MA administered intralesionally (IL) in leishmaniasis recidiva cutis (LRC). LRC is a special clinical variant of cutaneous leishmaniasis, characterized by reactivation at the edges of a primary cured lesion, presenting with active papules around the scar. Twenty-one patients were included in the study. All were diagnosed parasitologically by one of three diagnostic methods (smear, culture, and Leishmanin skin test). Each patient received MA intralesionally weekly for 4 weeks. Each papule was infiltrated until complete saturation. On average, patients received 1 mL of MA per administration. The criterion of cure was the complete resolution of the papules. Follow up was performed at 30, 90, and 180 days after treatment. At day 30 after treatment, 19 (90.5%) of 21 patients were clinically cured. The two patients, who did not heal by the fourth application, were cured on the seventh and eighth dose, achieving a clinical cure of 100% without subsequent reactivation. Mild to moderate local pain during infiltration was the only adverse reaction experienced by 81% of patients. In one case, subsequent infiltrations were discontinued because of a local allergic reaction. Complete compliance of patients to treatment and the small volume of drug administered make this method of administering MA an effective, safe, and inexpensive alternative. Consequently, IL could replace intramuscular administration in the treatment of LRC in Ecuador.

  8. TiO(2) crystal facet-dependent antimony adsorption and photocatalytic oxidation. (United States)

    Song, Jiaying; Yan, Li; Duan, Jinming; Jing, Chuanyong


    Anatase TiO 2 crystal facets are garnering increasing attention due to their unique surface property. However, no specific linear relationship had been derived between the facet exposed on TiO 2 and the surface adsorption capacity as well as photocatalytic performance. This study systematically explored the facet effects on antimony (Sb) adsorption and photocatalytic oxidation using high-index {201} and low-index {101}, {001}, and {100} TiO 2 . The results suggest that high-index {201} TiO 2 exhibits the best Sb(III) adsorption and photocatalytic activity compared to the low-index TiO 2 . Both the Sb(III) adsorption density and the amount of OH and O 2 - generated in solution were correlated to the magnitude of surface energy on TiO 2 facets. Photocatalytically generated OH and O 2 - were responsible for Sb(III) photooxidation as evidenced by radical-trapping experiments. The great contribution of OH was observed only on {201}, not on low-index TiO 2 . This phenomenon was found to be attributable to the high surface energy on {201}, which enables the generation of a large amount of photogeneration OH to compensate for the fast rate of OH dissipation. Therefore, the predominant participation of OH in Sb(III) photooxidation was only possible on high-index {201} TiO 2 , which resulted in an enhanced photocatalytic rate. On the other hand, O 2 - dominated the Sb(III) photocatalytic oxidation on low-index TiO 2 . The intrinsic facet-dependent adsorption and photocatalytic mechanism obtained from this study would be useful for developing TiO 2 -based environmental technologies. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. A Novel Framework Antimony (III) Phosphate: Synthesis and Structure of NaSb 3O 2(PO 4) 2 (United States)

    Adair, Brian A.; de Delgado, Graciela Díaz; Miguel Delgado, J.; Cheetham, Anthony K.


    The antimony (III) phosphate, NaSb3O2(PO4)2, is a framework structure built from SbIII and PV centers; orthorhombic, space group Pca21 (No. 29), a=13.944(3), b=6.6822(13), c=20.886(4) Å, V=1946.1(7) Å3, Z=8. Stereochemically active lone pairs of electrons associated with SbIIIO5 and SbIIIO4 polyhedra point into eight-ring channels, approximately 5×7 Å2, which dominate the architecture of the title compound. Charge-compensating sodium cations occupy the remaining space in the channels.

  10. Photochemical properties of mono-, tri-, and penta-cationic antimony(V) metalloporphyrin derivatives on a clay layer surface. (United States)

    Tsukamoto, Takamasa; Shimada, Tetsuya; Takagi, Shinsuke


    Three types of mono-, tri-, and penta-cationic antimony(V) porphyrin derivatives (Sb(V)Pors) were synthesized, and their photochemical properties on the anionic clay were systematically investigated. Sb(V)Por derivatives are dihydroxo(5,10,15,20-tetraphenylporphyrinato)antimony(V) chloride ([Sb(V)(TPP)(OH)2](+)Cl(-)), dihydroxo[5,10-diphenyl-15,20-di(N-methyl-pyridinium-4-yl)porphyrinato]antimony(V) trichloride ([Sb(V)(DMPyP)(OH)2](3+)3Cl(-)), and dihydroxo[5,10,15,20-tetrakis(N-methyl-pyridinium-4-yl)porphyrinato]antimony(V) pentachloride ([Sb(V)(TMPyP)(OH)2](5+)5Cl(-)). The photochemical behaviors of three cationic Sb(V)Pors with and without clay were examined in aqueous solution. For all Sb(V)Por, aggregation behaviors were not observed in the clay complexes even at high density adsorption conditions. The transition probabilities and fluorescence quantum yields of Sb(V)Por showed a tendency to be increased by the complex formation with clay. The less cationic Sb(V)Por/clay complex showed the larger fluorescence quantum yield. The more cationic Sb(V)Por/clay complex showed the longer fluorescence lifetime. These effects of complex formation with clay on the photochemical properties of Sb(V)Pors were discussed using the molecular potential energy curves of the porphyrin ground state and excited state. It is concluded that two types of effects work in the Sb(V)Por/clay system: effect i (structure resembling effect) is that the most stable structure becomes relatively similar between the ground and excited states, mainly by hydrophobic interactions between the porphyrin molecule and the clay surface, and effect ii (structure fixing effect) is that sharpened potential energy curves of clay complexes can lead to the increase of activation energy for the internal conversion from excited state to a high vibration level of ground state, mainly by electrostatic interactions between cationic porphyrin and anionic clay. Like this, the unique effects of the clay surface on

  11. Influence of zirconium ions on the uptake of carrier-free antimony (III) (125Sb) by various sorbents

    International Nuclear Information System (INIS)

    Friedmann, Ch.; Schoenfeld, T.; Vienna Univ.


    Sorption of carrier-free radioantimony ( 125 Sb) from acid aqueous solutions is strongly influenced by the presence of zirconium. For some sorbents (diatomaceous earth, clay minerals, activated charcoal) small amounts of dissolved zirconium salts increase 125 Sb sorption strongly. Larger amounts of zirconium reduce sorption again, sometimes below the uptake occurring in the absence of zirconium. With aluminium oxide only a reduction in uptake of 125 Sb results from the presence of Zr. These effects can be attributed to the formation of soluble complex species of zirconium with antimony (polynuclear cohydrolysis products) and to their sorption behaviour. (F.G.)

  12. Simultaneous speciation analysis of Sb(III), Sb(V) and (CH3)3SbCl2 by high performance liquid chromatography-hydride generation-atomic fluorescence spectrometry detection (HPLC-HG-AFS): application to antimony speciation in sea water. (United States)

    De Gregori, Ida; Quiroz, Waldo; Pinochet, Hugo; Pannier, Florence; Potin-Gautier, Martine


    This paper presents an improvement for the simultaneous separation of Sb(V), Sb(III) and (CH3)3SbCl2 species by high performance liquid chromatography (HPLC) and its detection by hydride generation-atomic fluorescence spectrometry (HG-AFS). The separation was performed on an anion exchange column PRP-X100 using a gradient elution program between EDTA/KHP (potasium hydrogen phtalate) as first mobile phase and phosphate solutions solution as the second one. The chromatographic separation and the HG-AFS parameters were optimized by experimental design. The best results were obtained by using an elution program with 20 mmol l(-1) EDTA + 2 mmol(-01) KHP solution at pH 4.5, during 1.15 min, then change to 50 mmol l(-1) (NH4)2HPO4 solution at pH 8.3, switching back after 4.0 min to the first mobile phase, until 5 min, with a constant flow rate of 1.5 ml min(-1). Retention time of Sb(V), Sb(III) and trimethylantimony species were 1.22, 2.31 and 3.45 min and the detection limits were 0.13; 0.07 and 0.13 microg l(-1), respectively. Studies on the stability of this antimony species in sea water samples on the function of the elapsed time of storage in refrigerator at 4 degrees C was performed employing the optimized method. Results revealed that Sb(III) is easily oxidized within some hours to Sb(V) in sea water stored at 4 degrees C. However, when the sea water was immediately mixed with EDTA no oxidation of Sb(III) was observed up to 1 week of storage. The proposed methodology was then applied to the antimony speciation in sea water samples.

  13. Neutron resonance spectroscopy of 113In and 115In

    International Nuclear Information System (INIS)

    Frankle, C.M.; Bowman, J.D.; Crawford, B.E.; Delheij, P.P.J.; Gould, C.R.; Haase, D.G.; Knudson, J.N.; Mitchell, G.E.; Patterson, S.S.; Penttilae, S.I.; Popov, Y.P.; Roberson, N.R.; Seestrom, S.J.; Sharapov, E.I.; Yen, Y.; Yoo, S.H.; Yuan, V.W.; Zhu, X.


    The neutron total cross section for natural indium was measured for E n =25--500 eV with the time-of-flight method at the Los Alamos Neutron Scattering Center. The neutron capture reaction was studied on a highly enriched sample (99.99%) of 115 In. A total of 47 previously unreported resonances were observed. The combination of the two measurements allowed assignment of the new resonances to 113 In or 115 In. Resonance parameters were extracted for all of the neutron resonances observed

  14. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment

    Directory of Open Access Journals (Sweden)

    Miguel Guzman-Rivero


    Full Text Available Background: The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. Objective: To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Design: Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. Results: The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. Conclusions: It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  15. Antimony Anchored with Nitrogen-Doping Porous Carbon as a High-Performance Anode Material for Na-Ion Batteries. (United States)

    Wu, Tianjing; Hou, Hongshuai; Zhang, Chenyang; Ge, Peng; Huang, Zhaodong; Jing, Mingjun; Qiu, Xiaoqing; Ji, Xiaobo


    Antimony represents a class of unique functional materials in sodium-ion batteries with high theoretical capacity (660 mA h g -1 ). The utilization of carbonaceous materials as a buffer layer has been considered an effective approach to alleviate rapid capacity fading. Herein, the antimony/nitrogen-doping porous carbon (Sb/NPC) composite with polyaniline nanosheets as a carbon source has been successfully achieved. In addition, our strategy involves three processes, a tunable organic polyreaction, a thermal annealing process, and a cost-effective reduction reaction. The as-prepared Sb/NPC electrode demonstrates a great reversible capacity of 529.6 mA h g -1 and an outstanding cycling stability with 97.2% capacity retention after 100 cycles at 100 mA g -1 . Even at 1600 mA g -1 , a superior rate capacity of 357 mA h g -1 can be retained. Those remarkable electrochemical performances can be ascribed to the introduction of a hierarchical porous NPC material to which tiny Sb nanoparticles of about 30 nm were well-wrapped to buffer volume expansion and improve conductivity.

  16. Treatment of air pollution control residues with iron rich waste sulfuric acid: does it work for antimony (Sb)? (United States)

    Okkenhaug, Gudny; Breedveld, Gijs D; Kirkeng, Terje; Lægreid, Marit; Mæhlum, Trond; Mulder, Jan


    Antimony (Sb) in air pollution control (APC) residues from municipal solid waste incineration has gained increased focus due to strict Sb leaching limits set by the EU landfill directive. Here we study the chemical speciation and solubility of Sb at the APC treatment facility NOAH Langøya (Norway), where iron (Fe)-rich sulfuric acid (∼3.6M, 2.3% Fe(II)), a waste product from the industrial extraction of ilmenite, is used for neutralization. Antimony in water extracts of untreated APC residues occurred exclusively as pentavalent antimonate, even at low pH and Eh values. The Sb solubility increased substantially at pH<10, possibly due to the dissolution of ettringite (at alkaline pH) or calcium (Ca)-antimonate. Treated APC residues, stored anoxically in the laboratory, simulating the conditions at the NOAH Langøya landfill, gave rise to decreasing concentrations of Sb in porewater, occurring exclusively as Sb(V). Concentrations of Sb decreased from 87-918μgL(-1) (day 3) to 18-69μgL(-1) (day 600). We hypothesize that an initial sorption of Sb to Fe(II)-Fe(III) hydroxides (green rust) and eventually precipitation of Ca- and Fe-antimonates (tripuhyite; FeSbO4) occurred. We conclude that Fe-rich, sulfuric acid waste is efficient to immobilize Sb in APC residues from waste incineration. Copyright © 2013 Elsevier B.V. All rights reserved.

  17. Arsenic, Antimony, Chromium, and Thallium Speciation in Water and Sediment Samples with the LC-ICP-MS Technique

    Directory of Open Access Journals (Sweden)

    Magdalena Jabłońska-Czapla


    Full Text Available Chemical speciation is a very important subject in the environmental protection, toxicology, and chemical analytics due to the fact that toxicity, availability, and reactivity of trace elements depend on the chemical forms in which these elements occur. Research on low analyte levels, particularly in complex matrix samples, requires more and more advanced and sophisticated analytical methods and techniques. The latest trends in this field concern the so-called hyphenated techniques. Arsenic, antimony, chromium, and (underestimated thallium attract the closest attention of toxicologists and analysts. The properties of those elements depend on the oxidation state in which they occur. The aim of the following paper is to answer the question why the speciation analytics is so important. The paper also provides numerous examples of the hyphenated technique usage (e.g., the LC-ICP-MS application in the speciation analysis of chromium, antimony, arsenic, or thallium in water and bottom sediment samples. An important issue addressed is the preparation of environmental samples for speciation analysis.

  18. Complement activation-related pseudoallergy in dogs following intravenous administration of a liposomal formulation of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro


    Full Text Available The increasing use of nanotechnologies in advanced therapies has allowed the observation of specific adverse reactions related to nanostructures. The toxicity of a novel liposome formulation of meglumine antimoniate in dogs with visceral leishmaniasis after single dose has been investigated. Groups of 12 animals received by the intravenous route a single dose of liposomal meglumine antimoniate (group I [GI], 6.5 mg Sb/kg, empty liposomes (GII or isotonic saline (GIII. Evaluation of hematological and biochemical parameters showed no significant changes 4 days after administration. No undesired effects were registered in the GIII. However, adverse reactions were observed in 67.7% of dogs from both groups that received liposomal formulations. The side effects began moments after bolus administration and disappeared during the first 15 minutes after treatment. Prostation, sialorrhea and defecation were the most frequent clinical signs, registered in 33.3% and 41.6 % of animals from the groups GI and GII, respectively. Tachypnea, mydriasis, miosis, vomiting and cyanosis were also registered in both groups. The adverse reactions observed in this study were attributed to the activation of the complement system by lipid vesicles in a phenomenon known as Complement Activation-Related Pseudoallergy (CARPA. The influence of the physical-chemical characteristics of liposomal formulation in the triggering of CARPA is discussed.

  19. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment. (United States)

    Guzman-Rivero, Miguel; Rojas, Ernesto; Verduguez-Orellana, Aleida; Pardo, Henry; Torrico, Mary Cruz; Cloetens, Lieselotte; Akesson, Björn; Sejas, Edgar


    The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  20. Arsenic, Antimony, Chromium, and Thallium Speciation in Water and Sediment Samples with the LC-ICP-MS Technique (United States)

    Jabłońska-Czapla, Magdalena


    Chemical speciation is a very important subject in the environmental protection, toxicology, and chemical analytics due to the fact that toxicity, availability, and reactivity of trace elements depend on the chemical forms in which these elements occur. Research on low analyte levels, particularly in complex matrix samples, requires more and more advanced and sophisticated analytical methods and techniques. The latest trends in this field concern the so-called hyphenated techniques. Arsenic, antimony, chromium, and (underestimated) thallium attract the closest attention of toxicologists and analysts. The properties of those elements depend on the oxidation state in which they occur. The aim of the following paper is to answer the question why the speciation analytics is so important. The paper also provides numerous examples of the hyphenated technique usage (e.g., the LC-ICP-MS application in the speciation analysis of chromium, antimony, arsenic, or thallium in water and bottom sediment samples). An important issue addressed is the preparation of environmental samples for speciation analysis. PMID:25873962

  1. Detection of pathogenic bacteria in skin lesions of patients with chiclero's ulcer: reluctant response to antimonial treatment

    Directory of Open Access Journals (Sweden)

    Isaac-Márquez Angélica Patricia


    Full Text Available We investigated the bacterial flora present in skin lesions of patients with chiclero's ulcer from the Yucatan peninsula of Mexico using conventional culture methods (11 patients, and an immunocolorimetric detection of pathogenic Streptococcus pyogenes (15 patients. Prevalence of bacteria isolated by culture methods was 90.9% (10/11. We cultured, from chiclero's ulcers (60%, pathogenic bacterial such as Staphylococcus aureus (20%, S. pyogenes (1.6%, Pseudomonas aeruginosa (1.6%, Morganella morganii (1.6%, and opportunist pathogenic bacteria such as Klebsiella spp. (20.0%, Enterobacter spp. (20%, and Enterococcus spp. (20%. We also cultured coagulase-negative staphylococci in 40% (4/10 of the remaining patients. Micrococcus spp. and coagulase-negative staphylococci constituted the bacterial genuses more frequently isolated in the normal skin of patients with chiclero's ulcer and healthy individuals used as controls. We also undertook another study to find out the presence of S. pyogenes by an immunocolorimetric assay. This study indicated that 60% (9/15 of the ulcerated lesions, but not normal controls, were contaminated with S. pyogenes. Importantly, individuals with purulent secretion and holding concomitant infections with S. pyogenes, S. aureus, P. aeruginosa, M. morganii, and E. durans took longer to heal Leishmania (L. mexicana infections treated with antimonial drugs. Our results suggest the need to eliminate bacterial purulent infections, by antibiotic treatment, before starting antimonial administration to patients with chiclero's ulcer.

  2. Cytotoxicity and In Vitro Antileishmanial Activity of Antimony (V), Bismuth (V), and Tin (IV) Complexes of Lapachol. (United States)

    Rocha, Marcele Neves; Nogueira, Paula Monalisa; Demicheli, Cynthia; de Oliveira, Ludmila Gonçalvez; da Silva, Meiriane Mariano; Frézard, Frédéric; Melo, Maria Norma; Soares, Rodrigo Pedro


    Leishmania amazonensis is the etiologic agent of the cutaneous and diffuse leishmaniasis often associated with drug resistance. Lapachol [2-hydroxy-3-(3'-methyl-2-butenyl)-1,4-naphthoquinone] displays a wide range of antimicrobial properties against many pathogens. In this study, using the classic microscopic in vitro model, we have analyzed the effects of a series of lapachol and chlorides complexes with antimony (V), bismuth (V), and tin (IV) against L. amazonensis. All seven compounds exhibited antileishmanial activity, but most of the antimony (V) and bismuth (V) complexes were toxic against human HepG2 cells and murine macrophages. The best IC50 values (0.17 ± 0.03 and 0.10 ± 0.11 μg/mL) were observed for Tin (IV) complexes (3) [(Lp)(Ph3Sn)] and (6) (Ph3SnCl2), respectively. Their selective indexes (SIs) were 70.65 and 120.35 for HepG2 cells, respectively. However, while analyzing murine macrophages, the SI decreased. Those compounds were moderately toxic for HepG2 cells and toxic for murine macrophages, still underlying the need of chemical modification in this class of compounds.

  3. Determination of Antimony (III in Real Samples by Anodic Stripping Voltammetry Using a Mercury Film Screen-Printed Electrode

    Directory of Open Access Journals (Sweden)

    Olga Domínguez-Renedo


    Full Text Available This paper describes a procedure for the determination of antimony (III by differential pulse anodic stripping voltammetry using a mercury film screen-printed electrode as the working electrode. The procedure has been optimized using experimental design methodology. Under these conditions, in terms of Residual Standard Deviation (RSD, the repeatability (3.81 % and the reproducibility (5.07 % of the constructed electrodes were both analyzed. The detection limit for Sb (III was calculated at a value of 1.27×10–8 M. The linear range obtained was between 0.99 × 10–8 – 8.26 × 10–8 M. An analysis of possible effects due to the presence of foreign ions in the solution was performed and the procedure was successfully applied to the determination of antimony levels in pharmaceutical preparations and sea water samples.

  4. Evaluation of the Content of Antimony, Arsenic, Bismuth, Selenium, Tellurium and Their Inorganic Forms in Commercially Baby Foods. (United States)

    Ruiz-de-Cenzano, M; Rochina-Marco, A; Cervera, M L; de la Guardia, M


    Baby foods, from the Spanish market and prepared from meat, fish, vegetables, cereals, legumes, and fruits, were analyzed to obtain the concentration of antimony (Sb), arsenic (As), bismuth (Bi), and tellurium (Te) as toxic elements and selenium (Se) as essential element. An analytical procedure was employed based on atomic fluorescence spectroscopy which allowed to obtain accurate data at low levels of concentration. Values of 14 commercial samples, expressed in nanograms per gram fresh weight, ranged for Sb 0.66-6.9, As 4.5-242, Te 1.35-2.94, Bi 2.18-4.79, and Se 5.4-109. Additionally, speciation studies were performed based on data from a non-chromatographic screening method. It was concluded that tellurium and bismuth were mainly present as inorganic forms and selenium as organic form, and antimony and arsenic species depend on the ingredients of each baby food. Risk assessment considerations were made by comparing dietary intake of the aforementioned elements through the consumption of one baby food portion a day and recommended or tolerable guideline values.

  5. THIR/Nimbus-4 Level 1 Meteorological Radiation Data at 11.5 microns V001 (THIRN4L1CH115) at GES DISC (United States)

    National Aeronautics and Space Administration — THIRN4L1CH115 is the Nimbus-4 Temperature-Humidity Infrared Radiometer (THIR) Level 1 Meteorological Radiation Data at 11.5 microns product and contains radiances...

  6. THIR/Nimbus-5 Level 1 Meteorological Radiation Data at 11.5 microns V001 (THIRN5L1CH115) at GES DISC (United States)

    National Aeronautics and Space Administration — THIRN5L1CH115 is the Nimbus-5 Temperature-Humidity Infrared Radiometer (THIR) Level 1 Meteorological Radiation Data at 11.5 microns product and contains radiances...

  7. THIR/Nimbus-6 Level 1 Meteorological Radiation Data at 11.5 microns V001 (THIRN6L1CH115) at GES DISC (United States)

    National Aeronautics and Space Administration — THIRN6L1CH115 is the Nimbus-6 Temperature-Humidity Infrared Radiometer (THIR) Level 1 Meteorological Radiation Data at 11.5 microns product and contains radiances...

  8. Effect of antimony-oxide on the shielding properties of some sodium-boro-silicate glasses. (United States)

    Zoulfakar, A M; Abdel-Ghany, A M; Abou-Elnasr, T Z; Mostafa, A G; Salem, S M; El-Bahnaswy, H H


    Some sodium-silicate-boro-antimonate glasses having the molecular composition [(20) Na 2 O - (20) SiO 2 - (60-x) B 2 O 3 - (x) Sb 2 O 3 (where x takes the values 0, 5 … or 20)] have been prepared by the melt quenching method. The melting and annealing temperatures were 1500 and 650K respectively. The amorphous nature of the prepared samples was confirmed by using X-ray diffraction analysis. Both the experimental and empirical density and molar volume values showed gradual increase with increasing Sb 2 O 3 content. The empirical densities showed higher values than those obtained experimentally, while the empirical molar volume values appeared lower than those obtained experimentally, which confirm the amorphous nature and randomness character of the studied samples. The experimentally obtained shielding parameters were approximately coincident with those obtained theoretically by applying WinXCom program. At low gamma-ray energies (0.356 and 0.662MeV) Sb 2 O 3 has approximately no effect on the total Mass Attenuation Coefficient, while at high energies it acts to increase the total Mass Attenuation Coefficient gradually. The obtained Half Value Layer and Mean Free Path values showed gradual decrease as Sb 2 O 3 was gradually increased. Also, the Total Mass Attenuation Coefficient values obtained between about 0.8 and 3.0MeV gamma-ray energy showed a slight decrease, as gamma-ray photon energy increased. This may be due to the differences between the Attenuation Coefficients of both antimony and boron oxides at various gamma-ray photon energies. However, it can be stated that the addition of Sb 2 O 3 into sodium-boro-silicate glasses increases the gamma-ray Attenuation Coefficient and the best sample is that contains 20 mol% of Sb 2 O 3 , which is operating well at 0.356 and 0.662MeV gamma-ray. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Effect of antimony segregation on the electronic properties of InAs/InAsSb superlattices (United States)

    Haugan, H. J.; Szmulowicz, F.; Hudgins, J. J.; Cordonnier, L. E.; Brown, G. J.


    There has been great progress in recent years in advancing the state-of-the-art of Ga-free InAs/InAsSb superlattice (SL) materials for infrared detector applications, spurred by the observation of long minority carrier lifetimes in this material system. However, compositional and dimensional changes through antimony (Sb) segregation alter the detector properties from those originally designed. For this reason, in this work, the authors explore epitaxial conditions that can mitigate this segregation in order to produce high-quality SL materials for optimum detector performance. A nominal SL structure of 7.7 nm InAs/3.5 nm InAs0.7 Sb0.3 tailored for an approximately six-micron response at 5 K was used to optimize the epitaxial parameters. Since the growth of mixed AsSb alloys is complicated by the potential reaction of As with Sb surfaces, the authors vary the substrate temperature (Ts) in order to control the As surface reaction on a Sb surface. Experimental results indicate that the SL sample grown at the lowest investigated Ts produces the highest Sb-mole fraction x of 0.3 in InAs1-x Sbx layers, which then decreases by 21 % as the Ts increases from 395 to 440 °C. This reduction causes an approximately 30 meV blueshift in the position of the excitonic photoluminescence (PL) peak. This finding differs from the results obtained from the Ga-containing InAs/GaSb SL equivalents, where the PL peak position remains constant at about 220 meV, regardless of Ts. The Ga-free SLs generally generate a broader PL linewidth than the corresponding Ga-containing SLs due to the higher spatial Sb distribution at the hetero-interfaces engendered by Sb segregation. In order for this newly proposed Ga-free SL materials to be viable for detector applications, the material problem associated with Sb segregation needs to be adequately controlled and further mitigated.

  10. Experimental and theoretical investigation of the chromium-vanadium-antimony system

    Energy Technology Data Exchange (ETDEWEB)

    Regus, Matthias; Bensch, Wolfgang [Kiel Univ. (Germany). Inst. of Inorganic Chemistry; Polesya, Svitlana; Kuhn, Gerhard; Mankovsky, Sergiy; Ebert, Hubert [Muenchen Univ. (Germany). Dept. of Chemistry; Bauers, Sage R.; Johnson, David C. [Oregon Univ., Eugene, OR (United States). Dept. of Chemistry


    The binary compound V{sub 3}Sb (V{sub 2.64}Sb, V{sub 3}Sb and V{sub 3.24}Sb) was synthesized as thin multilayered films with varying V:Sb ratios. The V-content determines the crystallization temperature and it is highest for the film with the lowest amount of V. Ternary chromium-vanadium-antimony (Cr-V-Sb) films were prepared containing Cr from 10 to 51 at-% with the Sb content fixed to yield M{sub 3}Sb (M=Cr, V). In the as-deposited state the layers are already interdiffused which is most likely caused by the very low repeating unit thickness between 0.29 and 0.68 nm investigated by X-ray diffraction experiments. All ternary compounds crystallized from the amorphous state with crystallization temperatures depending more on the repeating unit thickness than on chemical composition. For most samples the simultaneous crystallization of the two phases M{sub 3}Sb (A15 structure type) and MSb is observed. The crystalline A15 compounds are only stable in a limited temperature range and decompose at elevated temperatures. Compared to the binary Cr-Sb system crystallization of the hexagonal phase MSb (M=Cr, V) occurs at remarkably higher temperatures, i.e. in the ternary system nucleation and crystallization of this phase is hindered. The chemical composition requires short-range composition fluctuations to nucleate the binary phase. The first principles total energy calculations using the spin-polarized relativistic Korringa-Kohn-Rostoker (SPR-KKR) method confirm the experimental observations concerning the concentration-dependent stability of different phases of the Cr-V-Sb system. For the ratio M:Sb=3:1 the system is preferably stabilized in the A15 crystal structure for all possible Cr and V concentrations, while an increase of Sb content up to M:Sb=2:1 results in the stabilization of the Ni{sub 2}In structure for almost all Cr concentrations. Only in the V-rich regime of the system the Heusler Ni{sub 2}MnAl-type structure was found to be energetically more preferable.

  11. Correlation models between environmental factors and bacterial resistance to antimony and copper.

    Directory of Open Access Journals (Sweden)

    Zunji Shi

    Full Text Available Antimony (Sb and copper (Cu are toxic heavy metals that are associated with a wide variety of minerals. Sb(III-oxidizing bacteria that convert the toxic Sb(III to the less toxic Sb(V are potentially useful for environmental Sb bioremediation. A total of 125 culturable Sb(III/Cu(II-resistant bacteria from 11 different types of mining soils were isolated. Four strains identified as Arthrobacter, Acinetobacter and Janibacter exhibited notably high minimum inhibitory concentrations (MICs for Sb(III (>10 mM,making them the most highly Sb(III-resistant bacteria to date. Thirty-six strains were able to oxidize Sb(III, including Pseudomonas-, Comamonas-, Acinetobacter-, Sphingopyxis-, Paracoccus- Aminobacter-, Arthrobacter-, Bacillus-, Janibacter- and Variovorax-like isolates. Canonical correspondence analysis (CCA revealed that the soil concentrations of Sb and Cu were the most obvious environmental factors affecting the culturable bacterial population structures. Stepwise linear regression was used to create two predictive models for the correlation between soil characteristics and the bacterial Sb(III or Cu(II resistance. The concentrations of Sb and Cu in the soil was the significant factors affecting the bacterial Sb(III resistance, whereas the concentrations of S and P in the soil greatly affected the bacterial Cu(II resistance. The two stepwise linear regression models that we derived are as follows: MIC(Sb(III=606.605+0.14533 x C(Sb+0.4128 x C(Cu and MIC((Cu(II=58.3844+0.02119 x C(S+0.00199 x CP [where the MIC(Sb(III and MIC(Cu(II represent the average bacterial MIC for the metal of each soil (μM, and the C(Sb, C(Cu, C(S and C(P represent concentrations for Sb, Cu, S and P (mg/kg in soil, respectively, p<0.01]. The stepwise linear regression models we developed suggest that metals as well as other soil physicochemical parameters can contribute to bacterial resistance to metals.

  12. The presence and leachability of antimony in different wastes and waste handling facilities in Norway. (United States)

    Okkenhaug, G; Almås, Å R; Morin, N; Hale, S E; Arp, H P H


    The environmental behaviour of antimony (Sb) is gathering attention due to its increasingly extensive use in various products, particularly in plastics. Because of this it may be expected that plastic waste is an emission source for Sb in the environment. This study presents a comprehensive field investigation of Sb concentrations in diverse types of waste from waste handling facilities in Norway. The wastes included waste electrical and electronic equipment (WEEE), glass, vehicle fluff, combustibles, bottom ash, fly ash and digested sludge. The highest solid Sb concentrations were found in WEEE and vehicle plastic (from 1238 to 1715 mg kg(-1)) and vehicle fluff (from 34 to 4565 mg kg(-1)). The type of acid used to digest the diverse solid waste materials was also tested. It was found that HNO3:HCl extraction gave substantially lower, non-quantitative yields compared to HNO3:HF. The highest water-leachable concentration for wastes when mixed with water at a 1 : 10 ratio were observed for plastic (from 0.6 to 2.0 mg kg(-1)) and bottom ash (from 0.4 to 0.8 mg kg(-1)). For all of the considered waste fractions, Sb(v) was the dominant species in the leachates, even though Sb(iii) as Sb2O3 is mainly used in plastics and other products, indicating rapid oxidation in water. This study also presents for the first time a comparison of Sb concentrations in leachate at waste handling facilities using both active grab samples and DGT passive samples. Grab samples target the total suspended Sb, whereas DGT targets the sum of free- and other chemically labile species. The grab sample concentrations (from 0.5 to 50 μg L(-1)) were lower than the predicted no-effect concentration (PNEC) of 113 μg L(-1). The DGT concentrations were substantially lower (from 0.05 to 9.93 μg L(-1)) than the grab samples, indicating much of the Sb is present in a non-available colloidal form. In addition, air samples were taken from the chimney and areas within combustible waste incinerators, as

  13. Cross-section measurement for the reaction 115In(n,n')/sup 115m/In

    International Nuclear Information System (INIS)

    Liskien, H.; Arnotte, F.; Widera, R.; Paulsen, A.


    The excitation function for the reaction 115 In(n,n')/sup 115m/In was measured by the activation technique from threshold up to 4.1 MeV in 0.1-MeV steps. The absolute normalization of this excitation junction was performed at 2.1 MeV and is based on n-p scattering. The total uncertainty of the results is typically +- 6% above 1 MeV. The results are in good agreement with recently published data. 2 figures, 3 tables

  14. Real-world emission factors for antimony and other brake wear related trace elements: size-segregated values for light and heavy duty vehicles. (United States)

    Bukowiecki, Nicolas; Lienemann, Peter; Hill, Matthias; Figi, Renato; Richard, Agnes; Furger, Markus; Rickers, Karen; Falkenberg, Gerald; Zhao, Yongjing; Cliff, Steven S; Prevot, Andre S H; Baltensperger, Urs; Buchmann, Brigitte; Gehrig, Robert


    Hourly trace element measurements were performed in an urban street canyon and next to an interurban freeway in Switzerland during more than one month each, deploying a rotating drum impactor (RDI) and subsequent sample analysis by synchrotron radiation X-ray fluorescence spectrometry (SR-XRF). Antimony and other brake wear associated elements were detected in three particle size ranges (2.5-10, 1-2.5, and 0.1-1 microm). The hourly measurements revealed that the effect of resuspended road dust has to be taken into account for the calculation of vehicle emission factors. Individual values for light and heavy duty vehicles were obtained for stop-and-go traffic in the urban street canyon. Mass based brake wear emissions were predominantly found in the coarse particle fraction. For antimony, determined emission factors were 11 +/- 7 and 86 +/- 42 microg km(-1) vehicle(-1) for light and heavy duty vehicles, respectively. Antimony emissions along the interurban freeway with free-flowing traffic were significantly lower. Relative patterns for brake wear related elements were very similar for both considered locations. Beside vehicle type specific brake wear emissions, road dust resuspension was found to be a dominant contributor of antimony in the street canyon.

  15. Treatment of visceral leishmaniasis in a patient with AIDS with antimony and gamma-interferon: remission and prevention of relapse by maintenance therapy with weekly pentamidine

    NARCIS (Netherlands)

    Lustig, V.; Kager, P. A.; Meenhorst, P. L.


    A 41-year-old AIDS patient with fever, nightly perspiration, diarrhoea, anaemia and leukopenia was diagnosed as having visceral leishmaniasis (VL). After 8 weeks of antimony treatment combined with gamma-interferon, given in 2 courses of 3 and 5 weeks, 12 weeks apart, the bone marrow revealed no

  16. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    DEFF Research Database (Denmark)

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt


    of low chromatographic recoveries. A combination of HPLC-ICP-MS, AFFF-ICP-MS and spinfiltration was applied for analysis of model compounds and biological samples. Quantitative chromatographic Sb redox speciation analysis was possible by acidic hydrolysis of the antimony polymers prior to analysis...

  17. Syntheses, crystal structures and antimicrobial activities of 6-coordinate antimony(III) complexes with tridentate 2-acetylpyridine thiosemicarbazone, bis(thiosemicarbazone) and semicarbazone ligands. (United States)

    Kasuga, Noriko Chikaraishi; Onodera, Kuniaki; Nakano, Saori; Hayashi, Kunihiko; Nomiya, Kenji


    Five novel antimony(III) complexes with the mono- and bis(thiosemicarbazone) ligands of 2N1S or 4N2S donor atoms, N'-[1-(2-pyridyl)ethylidene]morpholine-4-carbothiohydrazide (Hmtsc, L1) and bis[N'-[1-(2-pyridyl)ethylidene

  18. 27 CFR 20.115 - Ink general-use formula. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Ink general-use formula... of Process General-Use Formulas § 20.115 Ink general-use formula. Ink general-use formula is any... sold or used as an ink. ...

  19. 14 CFR 61.115 - Balloon rating: Limitations. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Balloon rating: Limitations. 61.115 Section... rating: Limitations. (a) If a person who applies for a private pilot certificate with a balloon rating... operate a gas balloon. (b) If a person who applies for a private pilot certificate with a balloon rating...

  20. 14 CFR 1215.115 - Payment and billing. (United States)


    ... is applicable toward TDRSS operational services. (b) The procedure for billing and payment of... billings as the actual service time is tabulated. Amounts due to the user will be credited to the next... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Payment and billing. 1215.115 Section 1215...

  1. 24 CFR 115.305 - Special enforcement effort (SEE) funds. (United States)


    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Special enforcement effort (SEE... Housing Assistance Program § 115.305 Special enforcement effort (SEE) funds. (a) SEE funds are funds that HUD may provide to an agency to enhance enforcement activities of the agency's fair housing law. SEE...

  2. 45 CFR 81.115 - Matters not prohibited. (United States)


    ... Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRACTICE AND PROCEDURE FOR HEARINGS UNDER PART 80 OF THIS TITLE Judicial Standards of Practice § 81.115 Matters not prohibited. A... directed to the Civil Rights hearing clerk. Communications with respect to minor procedural matters or...

  3. 9 CFR 113.115 - Staphylococcus Aureus Bacterin-Toxoid. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Staphylococcus Aureus Bacterin-Toxoid... REQUIREMENTS Inactivated Bacterial Products § 113.115 Staphylococcus Aureus Bacterin-Toxoid. Staphylococcus... Staphylococcus aureus which has been inactivated and is nontoxic. Each serial of biological product containing...

  4. 19 CFR 115.9 - Certifying Authorities responsibilities-containers. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Certifying Authorities responsibilities-containers...; DEPARTMENT OF THE TREASURY CARGO CONTAINER AND ROAD VEHICLE CERTIFICATION PURSUANT TO INTERNATIONAL CUSTOMS CONVENTIONS Administration § 115.9 Certifying Authorities responsibilities—containers. (a) General. Containers...

  5. 7 CFR 4280.115 - Construction planning and performing development. (United States)


    ... BUSINESS-COOPERATIVE SERVICE AND RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE LOANS AND GRANTS Renewable Energy Systems and Energy Efficiency Improvements Program Section A. Grants § 4280.115..., designing, bidding, contracting, and constructing renewable energy systems and energy efficiency improvement...

  6. Monitoring of copper, arsenic and antimony levels in agricultural soils impacted and non-impacted by mining activities, from three regions in Chile. (United States)

    De Gregori, Ida; Fuentes, Edwar; Rojas, Mariela; Pinochet, Hugo; Potin-Gautier, Martine


    This paper reports a comparative study of the concentration of three important environmental elements that are often found together in mineral deposits and then associated with mining activities; copper, arsenic and antimony. These elements were determined in 26 different agricultural soils from regions I, II and V in Chile, zones where the most important and biggest copper industries of this country are located. As background levels of these elements in soils have not been well established, in this study, both, impacted and non-impacted agricultural soils from different regions were considered. The relationships between the concentrations of these elements in soils were also examined. The concentration ranges for copper, arsenic and antimony were 11-530; 2.7-202 and 0.42-11 mg kg(-1) respectively. The copper concentrations in non-polluted soils from the north and central zone of Chile were similar. However, three sites from the north region have copper concentration as higher as 100 mg kg(-1), values that exceed the critical concentration for copper in soils. The concentration of arsenic and antimony in the north soils were higher than in non-impacted ones and, in the case of arsenic, greatly exceeded the world average concentration reported for this element in soils. The highest arsenic and antimony concentrations were found in Calama and Quillagua soils, two different sites in the Loa valley. The arsenic/antimony concentration ratio was higher in Quillagua soil. The high concentrations of three elements determined in impacted soils from region V (Puchuncaví and Catemu valleys) clearly shows the impact produced in this zone by the industrial and mining activities developed in their proximities. At Puchuncaví valley a clear decrease was observed in copper, arsenic and antimony concentrations in soils on the function of the distance from the industrial complex "Las Ventanas", and all concentrations exceeded the reported critical values for this matrix. Instead at

  7. Development of {sup 115}Cd/{sup 115m}ln generator for industrial and environmental applications; Desenvolvimento de um gerador de {sup 115}Cd/{sup 115m}In para aplicacoes industriais e ambientais

    Energy Technology Data Exchange (ETDEWEB)

    Camargo, Fernanda Cristina Fonseca


    Indium isotopes, {sup 111}In, '1{sup 13}ln and {sup 115}In are widely used as radiotracers in industrial and environmental applications. {sup 113m}ln generators can be found in the international market. However they are manufactured by only a few companies worldwide, are rated at rather high prices and not always are available for sale (they are frequently manufactured only upon request). Hence it is of interest to produce the equipment in the country in which it will be used, especially if the parent nuclide can be also produced there. In Brazil, the ideal situation would be to produce a {sup 115}Cd/{sup 115m}In generator, whose target precursor is the '1{sup 14}Cd. Preliminary tests using non-enriched and inactive CdO were developed. The parent and daughter nuclides were separated flowing the eluate containing the chemical species Cd (II) and In (III) through ion exchange resins, Ag11A8, Chelex100 and Oowex 1 x8. 0.1 M, 1 M and 2M HCI and 2M HCI + 0.1 M NH{sub 4}CI solutions were tested as the eluant. The amount of Cd (l I) and In (III) eluted were determined by ICP-AES. The irradiation conditions of the target {sup 114}CdO were defined according to the neutron flux provided TRIGA MARK-I-R IPR reactor and the nuclear properties the of target. After to preliminary tests with the {sup 115}Cd/{sup 115m}In pair, column experiments were developed. Analyses were accomplished by gamma spectrometry to determine the presence of the {sup 115}Cd and {sup 115m}ln nuclides in the fractions eluted. Tests using the resin AG IIA8 and HCI I M eluent solution resulted in 100% adsorption of the Cd (11) and nearly 50% elution of In (III), corresponding to the best conditions for elution. Exposure to radiation can damage the resins, as the decrease in ion exchange capacity and change in volume of the polymer grains. Thus, columns packed with the chosen resin were exposed to radiation doses from 15 to 200 Gy, and eluted with the most effective eluent. The results showed that

  8. Determination of concentration levels of arsenic, gold and antimony in particle-size fractions of gold ore using Neutron Activation Analysis

    International Nuclear Information System (INIS)

    Nyarku, M.


    Instrumental Neutron Activation Analysis (INAA) has been used to quantify the concentrations of arsenic, gold and antimony in particle-size fractions of a gold ore. The ore, which was taken from the Ahafo project site of Newmont Ghana Gold Ltd, was first fractionated into fourteen (14) particle-size fractions using state-of-the-art analytical sieve machine. The minimum sieve mesh size used was 36 microns and grains >2000 microns were not considered for analysis. Results of the sieving were analysed with easysieve software. The < 36 microns sub fraction was found to be the optimum, hosting bulk of all three elements. For arsenic, the element was found to be highly concentrated in < 36 to +100 microns size fractions and erratically distributed from +150 microns fraction and above. For gold, in exception of the sub fraction <36 which had exceptionally high concentration, the element is distributed in all the size fractions but slightly 'plays out' in the +150 to +400 microns fractions. Antimony occurrence in the sample was relatively high in <36 microns size fraction followed by 600 - 800, 800 - 1000, 400 - 600 and 36 - 40 microns size fractions in that order. Gold content in the sample was far higher than that of arsenic and antimony. Gold concentration in the composite sample was in the range 564 - 8420 ppm. Arsenic levels were higher as compared to antimony. The range of arsenic concentration in the composite sample was 14.33 - 186.92 ppm. Antimony concentration was in the range 1.09 - 9.48 ppm. (au)

  9. Extractable copper, arsenic and antimony by EDTA solution from agricultural Chilean soils and its transfer to alfalfa plants (Medicago sativa L.). (United States)

    De Gregori, Ida; Fuentes, Edwar; Olivares, David; Pinochet, Hugo


    Following our research on copper, arsenic and antimony in Chilean ecosystems, a study to understand the mobility and transport of these elements from soil to plants was carried out. So, the aim of this study, which follows on from the previous work, was to demonstrate if the total concentrations of these elements or their fractions extracted by 0.05 M EDTA pH 7 from different Chilean soils correlate with the respective total concentrations in the edible tissue of alfalfa plants collected simultaneously from 20 different sites affected or unaffected by mining activities. The highest copper fractions extracted by EDTA solutions were obtained in contaminated soils from the central region (41-69%); however the northern soils presented the highest extractable fractions of arsenic (9-34%). The antimony fraction was low in all soils (0.4-8.0%). Alfalfa plants from all contaminated sites presented high copper, arsenic and antimony concentrations (19-126 mg kg(-1), 5.7-16.3 mg kg(-1) and 0.16-1.7 mg kg(-1), respectively). Statistically significant correlations were obtained between the total contents of copper and arsenic and their respective extractable fractions in soils. Good correlations were found between elements in alfalfa plants. Correlations were also obtained between the total concentrations of three elements in soils and in alfalfa plants. However, excepting for antimony in the northern samples, higher correlation coefficients were evaluated when the extractable fractions were considered. Samples from the north region presented the highest copper transfer factor and the lowest for arsenic, in spite of the high concentration of this metalloid extracted by EDTA solution in these soils. There was not a clear trend on the transfer factor for antimony, probably due to the low content of this element in alfalfa plants and/or the low recovery obtained for this element by EDTA.

  10. Comparative Analysis of the Omics Technologies Used to Study Antimonial, Amphotericin B, and Pentamidine Resistance in Leishmania

    Directory of Open Access Journals (Sweden)

    Gagandeep Kaur


    Full Text Available Leishmaniasis is a serious threat in developing countries due to its endemic nature and debilitating symptoms. Extensive research and investigations have been carried out to learn about the mechanism of drug resistance in Leishmania but results obtained in the laboratory are not in agreement with those obtained from the field. Also the lack of knowledge about the mode of action for a number of drugs makes the study of drug resistance more complex. A major concern in recent times has been regarding the role of parasitic virulence in drug resistance for Leishmania. Researchers have employed various techniques to unravel the facts about resistance and virulence in Leishmania. With advent of advanced and more specific means of detection, further hints about probable mechanisms of conferring resistance are expected. This review aims to provide a consolidated picture along with a comparative account of the work done so far to study the mechanism of antimony, amphotericin B, and pentamidine resistance using various techniques.

  11. Theoretical Prediction of an Antimony-Silicon Monolayer (penta-Sb2Si): Band Gap Engineering by Strain Effect (United States)

    Morshedi, Hosein; Naseri, Mosayeb; Hantehzadeh, Mohammad Reza; Elahi, Seyed Mohammad


    In this paper, using a first principles calculation, a two-dimensional structure of silicon-antimony named penta-Sb2Si is predicted. The structural, kinetic, and thermal stabilities of the predicted monolayer are confirmed by the cohesive energy calculation, phonon dispersion analysis, and first principles molecular dynamic simulation, respectively. The electronic properties investigation shows that the pentagonal Sb2Si monolayer is a semiconductor with an indirect band gap of about 1.53 eV (2.1 eV) from GGA-PBE (PBE0 hybrid functional) calculations which can be effectively engineered by employing external biaxial compressive and tensile strain. Furthermore, the optical characteristics calculation indicates that the predicted monolayer has considerable optical absorption and reflectivity in the ultraviolet region. The results suggest that a Sb2Si monolayer has very good potential applications in new nano-optoelectronic devices.

  12. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.). (United States)

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander


    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact.

  13. Enhanced Removal of Arsenic and Antimony in the Mining Site by Calcined γ-Fe2O3/Layered Double Hydroxide Nanocomposite (United States)

    Lee, Sang-Ho; Choi, Heechul; Kim, Kyoung-Woong


    Arsenic (As) and Antimony (Sb) have been recognized as harmful contaminants in aquatic environment due to its high toxicity and carcinogenicity. Especially, the contamination of arsenic in the mining areas is considered as a serious emerging environmental issue in Korea. Due to the hazardous effect of arsenic, the United States Environmental Protection Agency (US EPA) regulated maximum contamination level of arsenic to 10 μg/L in drinking water. The harmful effect on human health by excessive intake of antimony was also reported by previous studies, and severe contamination level (100 - 7,000 μg/L) of antimony reported in surface and groundwater of abandoned mining area in China and Slovakia. Therefore, US EPA regulated maximum contaminants level of antimony in drinking water to 6 μg/L. In order to remove anionic contaminants in drinking water, various type of nanomaterials have been developed. Layered double hydroxide (LDH) is the artificial anionic clay that is based on the layered structure of positively charged brucite-like layers with interlayers of anions. The LDH is one of the promising nanomaterials for the removal of anionic contaminants because it has high selectivity for arsenic, phosphate, chromium and antimony. However, the biggest problem of LDH for wastewater treatment is that the particles cannot be easily separated after the removal of contaminants. In this study, magnetic nanoparticles (γ-Fe2O3) supported LDH nanocomposite (γ-Fe2O3/LDH) was investigated to enhance magnetic particle recovery and removal efficiency for arsenic and antimony. The calcined γ-Fe2O3/LDH nanocomposites synthesized by co-precipitation method, and the crystallographic properties of maghemite (γ-Fe2O3) and layered structure of LDH were confirmed by X-ray diffraction. The nano-sized γ-Fe2O3 (30 to 50 nm) was stably attached on the surface of LDH (100 to 150 nm) and O1s spectrum by X-ray photoelectron spectroscopy (XPS) explained that there are both physical and

  14. Synthesis of Ce(III)-doped Fe3O4 magnetic particles for efficient removal of antimony from aqueous solution

    International Nuclear Information System (INIS)

    Qi, Zenglu; Joshi, Tista Prasai; Liu, Ruiping; Liu, Huijuan; Qu, Jiuhui


    Highlights: • Doping of Ce into Fe 3 O 4 was achieved based on a facile solvothermal method. • After doping, the removal capacity was increased by 5 times for “Sb(V)” and 2 times for “Sb(III)”. • Decreasing pH improved adsorption of Sb(V) but decreased adsorption of Sb(III). • Antimony sorption mechanisms on Ce-doped Fe 3 O 4 were illustrated. - Abstract: Aqueous antimony (Sb) pollution from human activity is of great concern in drinking water due to its adverse health effect. Magnetic Fe 3 O 4 particles, with high separation ability from solution, have been considered as a low-cost Sb adsorbent for contaminants. However, the limited adsorption capacity has restricted its practical application. In this study, a solvothermal approach was developed for doping Ce(III) into Fe 3 O 4 , thereby increasing the adsorption efficacy for both Sb(III) and Sb(V). In contrast to un-doped Fe 3 O 4 , the adsorption capacity towards Sb(III) and Sb(V) in Ce-doped materials increased from 111.4 to 224.2 mg/g and from 37.2 to 188.1 mg/g at neutral pH, respectively. Based on the combined results of XPS, XRD, and FTIR, it confirmed that Ce atom successfully doped into the Fe 3 O 4 structure, resulting in the decreased particle size, increased the surface area, and isoelectric point. Furthermore, the vibrating sample magnetometer (VSM) results showed that the Ce doping process had some side effects on the primitive magnetic property, but remaining the high separation potential during water treatment. According to the high removal efficiency and magnetic property, the Ce-doped Fe 3 O 4 of great simplicity should be a promising adsorbent for aqueous Sb removal.

  15. A comparative study of antimony accumulation in plants growing in two mining areas in Iran, Moghanlo, and Patyar. (United States)

    Jamali Hajiani, Naser; Ghaderian, Seyed Majid; Karimi, Naser; Schat, Henk


    Antimony occurs locally at high concentrations in some mineralized soils. Very little is known about behavior of antimony in plants. In this study, we analyzed the soil and vegetation of two mining areas in Iran, Patyar, and Moghanlo. Total Sb concentrations in soil were 358-3482 mg/kg in Moghanlo and 284-886 mg/kg in Patyar. Corresponding Sb concentrations in plant shoots were 0.8-287 and 1.3-49 mg/kg, respectively. In both areas, foliar Sb concentrations increased with acid-extractable soil Sb, although the slope was about 2-fold steeper for Patyar than for Moghanlo. Regressing the foliar concentrations on water-soluble Sb yielded identical slopes for both areas, suggesting that the soluble fraction of Sb rather than total Sb is the direct determinant of foliar Sb accumulation. Both in Patyar and Moghanlo, only a minor part of the total variance of shoot Sb was explained by soluble Sb. The major part was explained by plant species, demonstrating that plant taxonomic identity is the most important determinant of foliar Sb accumulation capacity in both areas. The translocation factor (TF) was highly variable too, with species as the only significant variance component. Only four species were able to accumulate more than 100 mg/kg Sb in their leaves. Among these species, Achillea wilhelmsii and Matthiola farinosa were by far the best Sb accumulators, with, on average, 141 and 132 mg/kg Sb in their leaves. Of these two, only Matthiola farinosa consistently maintained TF values far above unity across the whole range of soluble Sb in Moghanlo.

  16. Bulk etch rate of LR-115 cellulose nitrate film

    International Nuclear Information System (INIS)

    Harris, M.J.; Schlenker, R.A.


    Bulk etch rate (V/sub b/) of Kodak LR-115 cellulose nitrate film has been studied, and values for the parameter are presented. An interesting variability of V/sub b/ has been found which has implications for microdosimetry using this type of integrating nuclear track detector. Short-term and longer-term thickness changes have been observed which may increase the uncertainty in estimations of dose using this type of detector

  17. Superheavy-element spectroscopy: Correlations along element 115 decay chains

    Directory of Open Access Journals (Sweden)

    Rudolph D.


    Full Text Available Following a brief summary of the region of the heaviest atomic nuclei yet created in the laboratory, data on more than hundred α-decay chains associated with the production of element 115 are combined to investigate time and energy correlations along the observed decay chains. Several of these are analysed using a new method for statistical assessments of lifetimes in sets of decay chains.

  18. Relative SHG measurements of metal thin films: Gold, silver, aluminum, cobalt, chromium, germanium, nickel, antimony, titanium, titanium nitride, tungsten, zinc, silicon and indium tin oxide

    Directory of Open Access Journals (Sweden)

    Franklin Che

    Full Text Available We have experimentally measured the surface second-harmonic generation (SHG of sputtered gold, silver, aluminum, zinc, tungsten, copper, titanium, cobalt, nickel, chromium, germanium, antimony, titanium nitride, silicon and indium tin oxide thin films. The second-harmonic response was measured in reflection using a 150 fs p-polarized laser pulse at 1561 nm. We present a clear comparison of the SHG intensity of these films relative to each other. Our measured relative intensities compare favorably with the relative intensities of metals with published data. We also report for the first time to our knowledge the surface SHG intensity of tungsten and antimony relative to that of well known metallic thin films such as gold and silver. Keywords: Surface second-harmonic generation, Nonlinear optics, Metal thin films

  19. An improved method for the determination of trace levels of arsenic and antimony in geological materials by automated hydride generation-atomic absorption spectroscopy (United States)

    Crock, J.G.; Lichte, F.E.


    An improved, automated method for the determination of arsenic and antimony in geological materials is described. After digestion of the material in sulfuric, nitric, hydrofluoric and perchloric acids, a hydrochloric acid solution of the sample is automatically mixed with reducing agents, acidified with additional hydrochloric acid, and treated with a sodium tetrahydroborate solution to form arsine and stibine. The hydrides are decomposed in a heated quartz tube in the optical path of an atomic absorption spectrometer. The absorbance peak height for arsenic or antimony is measured. Interferences that exist are minimized to the point where most geological materials including coals, soils, coal ashes, rocks and sediments can be analyzed directly without use of standard additions. The relative standard deviation of the digestion and the instrumental procedure is less than 2% at the 50 ??g l-1 As or Sb level. The reagent-blank detection limit is 0.2 ??g l-1 As or Sb. ?? 1982.

  20. Comparative acute toxicity of gallium(III), antimony(III), indium(III), cadmium(II), and copper(II) on freshwater swamp shrimp (Macrobrachium nipponense). (United States)

    Yang, Jen-Lee


    Acute toxicity testing were carried out the freshwater swamp shrimp, Macrobrachium nipponense, as the model animal for the semiconductor applied metals (gallium, antimony, indium, cadmium, and copper) to evaluate if the species is an suitable experimental animal of pollution in aquatic ecosystem. The static renewal test method of acute lethal concentrations determination was used, and water temperature was maintained at 24.0 ± 0.5°C. Data of individual metal obtained from acute toxicity tests were determined using probit analysis method. The median lethal concentration (96-h LC50) of gallium, antimony, indium, cadmium, and copper for M. nipponense were estimated as 2.7742, 1.9626, 6.8938, 0.0539, and 0.0313 mg/L, respectively. Comparing the toxicity tolerance of M. nipponense with other species which exposed to these metals, it is obviously that the M. nipponense is more sensitive than that of various other aquatic animals.

  1. The cytotoxicity of organobismuth compounds with certain molecular structures can be diminished by replacing the bismuth atom with an antimony atom in the molecules. (United States)

    Kohri, Kumiko; Yoshida, Eiko; Yasuike, Shuji; Fujie, Tomoya; Yamamoto, Chika; Kaji, Toshiyuki


    Organic-inorganic hybrid molecules, which are composed of an organic structure and metal(s), are indispensable for synthetic chemical reactions; however, their toxicity has been incompletely understood. In the present study, we discovered two cytotoxic organobismuth compounds whose cytotoxicity diminished upon replacement of the intramolecular bismuth atom with an antimony atom. The intracellular accumulation of the organobismuth compounds was much higher than that of the organoantimony compounds with the corresponding organic structures. We also showed that both the organic structure and bismuth atom are required for certain organobismuth compounds to exert their cytotoxic effect, suggesting that the cytotoxicity of such a compound is a result of an interaction between the organic structure and the bismuth atom. The present data suggest that organobismuth compounds with certain molecular structures exhibit cytotoxicity via an interaction between the molecular structure and the bismuth atom, and this cytotoxicity can be diminished by replacing the bismuth atom with an antimony atom, resulting in lower intracellular accumulation.

  2. Simultaneous determination of asrenic, mercury, antimony and selenium in biological materials with prior collection of gaseous products followed by neutron activation analysis

    International Nuclear Information System (INIS)

    Wu, C.Y.; Chen, P.Y.; Yang, M.H.


    A method combining prior collection of gaseous products with subsequent neutron activation analysis has been developed for simultaneous determination of traces of arsenic, mercury, antimony and selenium in biological materials. The generation of hydrides of arsenic, antimony and selenium and cold vapor of mercury in the generation and collection system was investigated by the use of radiotracers of the respective elements. The result indicates that selenium and mercury can be completely evaporated from the digested sample solution in 5M HCl with the addition of 5% sodium tetrahydroborate solution, while additional reduction process by potassium iodide and ascorbic acid is needed for complete evaporation of arsenic and antiomony. The gaseous products were collected in a quartz tube for neutron irradiation. The detection limits of these elements were found to be in the range of 10 -7 to 10 -8 g under the present experimental conditions. The reliability was checked with NBS standard reference materisl. (author)

  3. Molecular precursors for the phase-change material germanium-antimony-telluride, Ge{sub 2}Sb{sub 2}Te{sub 5} (GST)

    Energy Technology Data Exchange (ETDEWEB)

    Harmgarth, Nicole; Zoerner, Florian; Engelhardt, Felix; Edelmann, Frank T. [Chemisches Institut, Otto-von-Guericke-Universitaet Magdeburg (Germany); Liebing, Phil [Laboratorium fuer Anorganische Chemie, ETH Zuerich (Switzerland); Burte, Edmund P.; Silinskas, Mindaugas [Institut fuer Mikro- und Sensorsysteme, Otto-von-Guericke-Universitaet Magdeburg (Germany)


    This review provides an overview of the precursor chemistry that has been developed around the phase-change material germanium-antimony-telluride, Ge{sub 2}Sb{sub 2}Te{sub 5} (GST). Thin films of GST can be deposited by employing either chemical vapor deposition (CVD) or atomic layer deposition (ALD) techniques. In both cases, the success of the layer deposition crucially depends on the proper choice of suitable molecular precursors. Previously reported processes mainly relied on simple alkoxides, alkyls, amides and halides of germanium, antimony, and tellurium. More sophisticated precursor design provided a number of promising new aziridinides and guanidinates. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. 25 CFR 115.808 - Could trust fund investments made by OTFM lose money? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Could trust fund investments made by OTFM lose money? 115.808 Section 115.808 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES... § 115.808 Could trust fund investments made by OTFM lose money? The value of trust fund investments made...

  5. 25 CFR 115.106 - Assets of members of the Agua Caliente Band of Mission Indians. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Assets of members of the Agua Caliente Band of Mission Indians. 115.106 Section 115.106 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES TRUST FUNDS FOR TRIBES AND INDIVIDUAL INDIANS IIM Accounts § 115.106 Assets of members of the Agua...

  6. 33 CFR 115.30 - Sufficiency of State authority for bridges. (United States)


    ... for bridges. 115.30 Section 115.30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LOCATIONS AND CLEARANCES; ADMINISTRATIVE PROCEDURES § 115.30 Sufficiency of State authority for bridges. An opinion of the attorney general of the State as to the sufficiency of State...

  7. 7 CFR 989.115 - Independent handler, major cooperative marketing association handler, and small cooperative... (United States)


    ... association handler, and small cooperative marketing association handler. 989.115 Section 989.115 Agriculture... CALIFORNIA Administrative Rules and Regulations Definitions § 989.115 Independent handler, major cooperative marketing association handler, and small cooperative marketing association handler. (a) Independent handler...

  8. 25 CFR 115.401 - What is a minor's supervised account? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false What is a minor's supervised account? 115.401 Section 115... TRIBES AND INDIVIDUAL INDIANS IIM Accounts: Minors § 115.401 What is a minor's supervised account? A minor's supervised account is a restricted IIM account from which all disbursements must be made...

  9. 25 CFR 115.711 - How is money in a trust account invested? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false How is money in a trust account invested? 115.711 Section 115.711 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES TRUST FUNDS... § 115.711 How is money in a trust account invested? OTFM manages trust fund investments and its...

  10. 21 CFR 201.115 - New drugs or new animal drugs. (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false New drugs or new animal drugs. 201.115 Section 201.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.115 New drugs or new animal...

  11. 40 CFR 81.115 - Northwest Nevada Intrastate Air Quality Control Region. (United States)


    ... Quality Control Region. 81.115 Section 81.115 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.115 Northwest Nevada Intrastate Air Quality Control Region. The Northwest Nevada Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

  12. 33 CFR 169.115 - Where is the southeastern reporting system located? (United States)


    ... reporting system located? 169.115 Section 169.115 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY SHIP REPORTING SYSTEMS Establishment of Two Mandatory Ship Reporting Systems for the Protection of Northern Right Whales § 169.115 Where is the...

  13. 46 CFR 115.502 - Certificate of Inspection: Conditions of validity. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Certificate of Inspection: Conditions of validity. 115.502 Section 115.502 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER... INSPECTION AND CERTIFICATION Reinspection § 115.502 Certificate of Inspection: Conditions of validity. To...

  14. 19 CFR 115.16 - Notification of Certifying Authority by manufacturer. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Notification of Certifying Authority by manufacturer. 115.16 Section 115.16 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... INTERNATIONAL CUSTOMS CONVENTIONS Administration § 115.16 Notification of Certifying Authority by manufacturer...

  15. Reducing plant radiation fields by source term reduction - tracking cobalt and antimony to their sources at Gentilly-2

    International Nuclear Information System (INIS)

    Gauthier, P.; Guzonas, D.A.


    Gentilly-2 NGS is experiencing high radiation fields in the fuelling machine vaults. These high fields make maintenance outages more expensive and their management more complicated. As part of the station refurbishment project, a task group was created to identify the cause of the high fields and make recommendations to prevent their reoccurrence in the second (post-refurbishment) operating cycle. To identify the root cause of the problem, the task group decided to analyse the primary heat transport system (PHTS), the fuel handling system and their inter-relation. Gentilly-2 has had to manage a unique (to CANDU) problem arising from antimony released from the main heat transport pump seals. Antimony deposits on in-core surfaces, becomes activated, and subsequently can be released, especially under oxidizing coolant conditions. It then becomes incorporated into the magnetite deposits on PHTS piping, including the steam generators and inlet feeders. Gentilly-2 has focused a great deal of effort on managing antimony over the last 15 years. As a result of these initiatives, radioantimony fields have been quite effectively managed since 1997, resulting in a decrease in their relative contribution to the total fields. The decrease in radioantimony fields highlighted the significant contribution of 60 Co cobalt activity; the high levels of both radioantimony and 60 Co differentiate Gentilly-2 from other CANDU 6 plants. Two types of 59 Co sources are present in the CANDU PHTS. High surface area materials such as steam generator tubes and feeder pipes contain trace concentrations of 59 Co as an impurity, which can be released by corrosion. Low surface area materials such as Stellites contain high concentrations of 59 Co that can be released as either corrosion or wear products. After assessing potential cobalt sources, the task group concluded that PHTS materials were not likely the origin of the high 60 Co fields. The major PHTS components identified as cobalt sources have

  16. Elimination of the inter-element interferences of iron, gold, molybdenum, tin and antimony when determined in organic solvents by flame atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Aneva, Zara; Arpadjan, Sonja


    The mutual interferences in the flame atomic absorption spectrometric determination of iron, gold, molybdenum, tin and antimony after their extraction - pre-concentration as chloride complexes from platinum solutions into isobutyl methyl ketone are investigated. It is suggested that the interferences are caused by chemical reactions in the flame and are influenced by the flame characteristics. The possibility of eliminating the interferences by addition of long-chain quaternary ammonium salts is discussed. (author)

  17. Structural, optical and electrical properties of copper antimony sulfide thin films grown by a citrate-assisted single chemical bath deposition (United States)

    Loranca-Ramos, F. E.; Diliegros-Godines, C. J.; Silva González, R.; Pal, Mou


    Copper antimony sulfide (CAS) has been proposed as low toxicity and earth abundant absorber materials for thin film photovoltaics due to their suitable optical band gap, high absorption coefficient and p-type electrical conductivity. The present work reports the formation of copper antimony sulfide by chemical bath deposition using sodium citrate as a complexing agent. We show that by tuning the annealing condition, one can obtain either chalcostibite or tetrahedrite phase. However, the main challenge was co-deposition of copper and antimony as ternary sulfides from a single chemical bath due to the distinct chemical behavior of these metals. The as-deposited films were subjected to several trials of thermal treatment using different temperatures and time to find the optimized annealing condition. The films were characterized by different techniques including Raman spectroscopy, X-ray diffraction (XRD), profilometer, scanning electron microscopy (SEM), UV-vis spectrophotometer, and Hall Effect measurements. The results show that the formation of chalcostibite and tetrahedrite phases is highly sensitive to annealing conditions. The electrical properties obtained for the chalcostibite films varied as the annealing temperature increases from 280 to 350 °C: hole concentration (n) = 1017-1018 cm-3, resistivity (ρ) = 1.74-2.14 Ωcm and carrier mobility (μ) = 4.7-9.26 cm2/Vseg. While for the tetrahedrite films, the electrical properties were n = 5 × 1019 cm-3, μ = 18.24 cm2/Vseg, and ρ = 5.8 × 10-3 Ωcm. A possible mechanism for the formation of ternary copper antimony sulfide has also been proposed.

  18. Spectroscopic Tools Applied to Element Z = 115 Decay Chains

    Directory of Open Access Journals (Sweden)

    Forsberg U.


    Full Text Available Nuclides that are considered to be isotopes of element Z = 115 were produced in the reaction 48Ca + 243Am at the GSI Helmholtzzentrum für Schwerionenforschung Darmstadt. The detector setup TASISpec was used. It was mounted behind the gas-filled separator TASCA. Thirty correlated α-decay chains were found, and the energies of the particles were determined with high precision. Two important spectroscopic aspects of the offline data analysis are discussed in detail: the handling of digitized preamplified signals from the silicon strip detectors, and the energy reconstruction of particles escaping to upstream detectors relying on pixel-by-pixel dead-layer thicknesses.

  19. Synthetic aspects, spectral, thermal studies and antimicrobial screening on bis(N,N-dimethyldithiocarbamato-S,S‧)antimony(III) complexes with oxo or thio donor ligands (United States)

    Chauhan, H. P. S.; Carpenter, Jaswant; Joshi, Sapana


    The bis(N,N-dimethyldithiocarbamato-S,S‧)antimony(III) complexes have been obtained by the reaction of chloro bis(N,N-dimethyldithiocarbamato-S,S‧)antimony(III) with corresponding oxo or thio donor ligands such as sodium benzoate 1, sodium thioglycolate 2, phenol 3, sodium 1-propanethiolate 4, potassium thioacetate 5, sodium salicylate 6, ethane-1,2-dithiolate 7 and disodium oxalate 8. These complexes have been characterized by the physicochemical [melting point, molecular weight determination and elemental analysis (C, H, N, S and Sb)], spectral [UV-Visible, FT-IR, far IR, NMR (1H and 13C)], thermogravimetric (TG & DTA) analysis, ESI-Mass and powder X-ray diffraction studies. Thermogravimetric analysis of the complexes confirmed the final decomposition product as highly pure antimony sulfide (Sb2S3) and powder X-ray diffraction studies show that the complexes are in lower symmetry with monoclinic crystal lattice and nano-ranged particle size (11.51-20.82 nm). The complexes have also been screened against some bacterial and fungal strains for their antibacterial and antifungal activities and compared with standard drugs. These show that the complexes have greater activities against some human pathogenic bacteria and fungi than the activities of standard drugs.

  20. Synthetic aspects, spectral, thermal studies and antimicrobial screening on bis(N,N-dimethyldithiocarbamato-S,S')antimony(III) complexes with oxo or thio donor ligands. (United States)

    Chauhan, H P S; Carpenter, Jaswant; Joshi, Sapana


    The bis(N,N-dimethyldithiocarbamato-S,S')antimony(III) complexes have been obtained by the reaction of chloro bis(N,N-dimethyldithiocarbamato-S,S')antimony(III) with corresponding oxo or thio donor ligands such as sodium benzoate 1, sodium thioglycolate 2, phenol 3, sodium 1-propanethiolate 4, potassium thioacetate 5, sodium salicylate 6, ethane-1,2-dithiolate 7 and disodium oxalate 8. These complexes have been characterized by the physicochemical [melting point, molecular weight determination and elemental analysis (C, H, N, S and Sb)], spectral [UV-Visible, FT-IR, far IR, NMR (1H and 13C)], thermogravimetric (TG & DTA) analysis, ESI-Mass and powder X-ray diffraction studies. Thermogravimetric analysis of the complexes confirmed the final decomposition product as highly pure antimony sulfide (Sb2S3) and powder X-ray diffraction studies show that the complexes are in lower symmetry with monoclinic crystal lattice and nano-ranged particle size (11.51-20.82 nm). The complexes have also been screened against some bacterial and fungal strains for their antibacterial and antifungal activities and compared with standard drugs. These show that the complexes have greater activities against some human pathogenic bacteria and fungi than the activities of standard drugs. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. Determination of antimony by electrochemical hydride generation atomic absorption spectrometry in samples with high iron content using chelating resins as on-line removal system

    International Nuclear Information System (INIS)

    Bolea, E.; Arroyo, D.; Laborda, F.; Castillo, J.R.


    A method for the removal of the interference caused by iron on electrochemical generation of stibine is proposed. It consists of a chelating resin Chelex 100 column integrated into a flow injection system and coupled to the electrochemical hydride generator quartz tube atomic absorption spectrometer (EcHG-QT-AAS). Iron, as Fe(II), is retained in the column with high efficiency, close to 99.9% under optimal conditions. No significant retention was observed for Sb(III) under same conditions and a 97 ± 5% signal recovery was achieved. An electrochemical hydride generator with a concentric configuration and a reticulated vitreous carbon cathode was employed. The system is able to determine antimony concentrations in the range of ng ml -1 in presence of iron concentrations up to 400 mg l -1 . The procedure was validated by analyzing PACS-2 marine sediments reference material with a 4% (w/w) iron content and a [Fe]:[Sb] ratio of 4000:1, which caused total antimony signal suppression on the electrochemical hydride generation system. A compost sample with high iron content (0.7%, w/w), was also analyzed. A good agreement was found on both samples with the certified value and the antimony concentration determined by ICP-MS, respectively

  2. The use of silver nanoparticles as an effective modifier for the determination of arsenic and antimony by electrothermal atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Gunduz, S., E-mail: [Istanbul Technical University, Faculty of Science and Letters, Department of Chemistry, 34469, Maslak-Istanbul (Turkey); Akman, S., E-mail: [Istanbul Technical University, Faculty of Science and Letters, Department of Chemistry, 34469, Maslak-Istanbul (Turkey); Baysal, A., E-mail: [Istanbul Technical University, Faculty of Science and Letters, Department of Chemistry, 34469, Maslak-Istanbul (Turkey); Kahraman, M., E-mail: [Yeditepe University, Faculty of Engineering and Architecture, Department of Genetics and Bioengineering, 34755 Kayisdagi-Istanbul (Turkey)


    Silver nanoparticles (AgNPs) were proposed as a new chemical modifier for the elimination of interferences when determining arsenic and antimony in aqueous NaCl or Na{sub 2}SO{sub 4} solutions and in sea-water by electrothermal atomic absorption spectrometry. For this purpose, the AgNPs were prepared simply by reducing silver nitrate with sodium citrate. The effects of pyrolysis and atomization temperatures and the amounts of interferents and modifiers on the sensitivities of these elements were investigated. In the presence of the proposed modifier, a pyrolysis temperature of at least 1100 deg. C for arsenic and 900 deg. C for antimony could be applied without the loss of analytes, and the interferences were greatly reduced to allow for interference-free determination. The detection limits (N = 10, 3sigma) for arsenic and antimony were 0.022 ng and 0.046 ng, respectively. AgNPs are cheaper and more available compared to many other modifiers. No background was detected, and the blank values were negligible.

  3. A new cloud point extraction procedure for determination of inorganic antimony species in beverages and biological samples by flame atomic absorption spectrometry. (United States)

    Altunay, Nail; Gürkan, Ramazan


    A new cloud-point extraction (CPE) for the determination of antimony species in biological and beverages samples has been established with flame atomic absorption spectrometry (FAAS). The method is based on the fact that formation of the competitive ion-pairing complex of Sb(III) and Sb(V) with Victoria Pure Blue BO (VPB(+)) at pH 10. The antimony species were individually detected by FAAS. Under the optimized conditions, the calibration range for Sb(V) is 1-250 μg L(-1) with a detection limit of 0.25 μg L(-1) and sensitive enhancement factor of 76.3 while the calibration range for Sb(III) is 10-400 μg L(-1) with a detection limit of 5.15 μg L(-1) and sensitive enhancement factor of 48.3. The precision as a relative standard deviation is in range of 0.24-2.35%. The method was successfully applied to the speciative determination of antimony species in the samples. The validation was verified by analysis of certified reference materials (CRMs). Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. Arsenic and antimony geochemistry of mine wastes, associated waters and sediments at the Giant Mine, Yellowknife, Northwest Territories, Canada (United States)

    Fawcett, Skya E.; Jamieson, Heather E.; Nordstrom, D. Kirk; McCleskey, R. Blaine


    Elevated levels of arsenic (As) and antimony (Sb) in water and sediments are legacy residues found downstream from gold-mining activities at the Giant Mine in Yellowknife, Northwest Territories (NWT), Canada. To track the transport and fate of As and Sb, samples of mine-waste from the mill, and surface water, sediment, pore-water, and vegetation downstream of the mine were collected. Mine waste, pore-water, and sediment samples were analyzed for bulk chemistry, and aqueous and solid-state speciation. Sediment and vegetation chemistry were evaluated using scanning electron microscope imaging, synchrotron-based element mapping and electron microprobe analysis. The distributions of As and Sb in sediments were similar, yet their distributions in the corresponding pore-waters were mostly dissimilar, and the mobility of As was greater than that of Sb. Competition for sorption sites is the most likely cause of elevated Sb concentrations in relatively oxidized pore-water and surface water. The aqueous and solid-state speciation of As and Sb also differed. In pore-water, As(V) dominated in oxidizing environments and As(III) in reducing environments. In contrast, the Sb(V) species dominated in all but one pore-water sample, even under reducing conditions. Antimony(III) appears to preferentially precipitate or adsorb onto sulfides as evidenced by the prevalence of an Sb(III)-S secondary solid-phase and the lack of Sb(III)(aq) in the deeper zones. The As(V)–O solid phase became depleted with depth below the sediment–water interface, and the Sb(V)–O phase persisted under relatively reducing conditions. In the surficial zone at a site populated by Equisetum fluviatile (common horsetail), As and Sb were associated with organic material and appeared mobile in the root zone. In the zone below active plant growth, As and Sb were associated primarily with inorganic phases suggesting a release and reprecipitation of these elements upon plant death. The co-existence of reduced

  5. Studies of Flerovium and Element 115 Homologs with Macrocyclic Extractants

    Energy Technology Data Exchange (ETDEWEB)

    Despotopulos, John D. [Univ. of Nevada, Las Vegas, NV (United States)


    Study of the chemistry of the heaviest elements, Z ≥ 104, poses a unique challenge due to their low production cross-sections and short half-lives. Chemistry also must be studied on the one-atom-at-a-time scale, requiring automated, fast, and very efficient chemical schemes. Recent studies of the chemical behavior of copernicium (Cn, element 112) and flerovium (Fl, element 114) together with the discovery of isotopes of these elements with half-lives suitable for chemical studies have spurred a renewed interest in the development of rapid systems designed to study the chemical properties of elements with Z ≥ 114. This dissertation explores both extraction chromatography and solvent extraction as methods for development of a rapid chemical separation scheme for the homologs of flerovium (Pb, Sn, Hg) and element 115 (Bi, Sb), with the goal of developing a chemical scheme that, in the future, can be applied to on-line chemistry of both Fl and element 115. Carrier-free radionuclides, used in these studies, of the homologs of Fl and element 115 were obtained by proton activation of high-purity metal foils at the Lawrence Livermore National Laboratory (LLNL) Center for Accelerator Mass Spectrometry (CAMS): natIn(p,n)113Sn, natSn(p,n)124Sb, and Au(p,n)197m,gHg. The carrier-free activity was separated from the foils by novel separation schemes based on ion exchange and extraction chromatography techniques. Carrier-free Pb and Bi isotopes were obtained from development of a novel generator based on cation exchange chromatography using the 232U parent to generate 212Pb and 212Bi. Macrocyclic extractants, specifically crown ethers and their derivatives, were chosen for these studies; crown ethers show high selectivity for metal ions. Finally. a potential chemical system for Fl was established based on the Eichrom Pb resin, and insight to an improved system based on thiacrown ethers is

  6. A novel voltammetric sensor based on carbon nanotubes and nanoparticles of antimony tin oxide for the determination of ractopamine. (United States)

    Baytak, Aysegul Kutluay; Teker, Tugce; Duzmen, Sehriban; Aslanoglu, Mehmet


    An electrochemical sensor was prepared by the modification of a glassy carbon electrode (GCE) with carbon nanotubes (CNTs) and nanoparticles of antimony tin oxide (ATO). The surface layer was characterized by scanning electronmicroscopy (SEM), energy dispersive X-ray diffraction method (EDX) and ATR FT-IR spectroscopy. The proposed electrode was assessed in respect to the electro-oxidation of ractopamine. Compared with a bare GCE and a GCE electrode modified with CNTs, the ATONPs/CNTs/GCE exhibited a great catalytic activity towards the oxidation of ractopamine with a well-defined anodic peak at 600 mV. The current response was linear with the concentration of ractopamine over the range from 10 to 240 nM with a detection limit of 3.3 nM. The proposed electrode enabled the selective determination of ractopamine in the presence of high concentrations of ascorbic acid (AA), dopamine (DA) and uric acid (UA). The proposed electrode was successfully applied for the determination of ractopamine in feed and urine samples. The sensitive and selective determination of ractopamine makes the developed method of great interest for monitoring its therapeutic use and doping control purposes.

  7. Therapeutic trial of sodium antimony gluconate alone and in combination with ketoconazole in post-kala-azar dermal leishmaniasis

    Directory of Open Access Journals (Sweden)

    Rathi S


    Full Text Available BACKGROUND: Drugs used in PKDL include parenteral sodium antimony gluconate (SAG, amphotericin-B, pentamidine, and ketoconazole (KTZ. SAG is the most effective one. Given alone, SAG has to be given for a long duration, leading to poor patient compliance and treatment failure. This study was carried out to compare the effectiness of SAG alone and a combination of SAG and KTZ for sixty days. METHODS: Ten patients of PKDL were included in the study. Five patients (Group A were given SAG intravenously, in the dose of 20 mg/kg per day and five (Group B were given SAG (intravenously 20 mg/kg per day and KTZ (200 mg twice daily orally. Both treatment regimens were given for sixty days. RESULTS: In Group A, the nodules and/or plaques showed approximate 80-85% clinical improvement, and macules showed 25-30% improvement. In group B (SAG + KTZ, there was 90-95% clinical improvement in the nodules and/or plaques and 25-30% in macules. CONCLUSION: This study suggests the therapeutic superiority of the combination treatment regimen in a shorter duration but is not conclusive as the number of patients was low. Further trials are recommended.

  8. Ultrasound-assisted HCl-NaCl leaching of lead-rich and antimony-rich oxidizing slag. (United States)

    Zhang, Rong Liang; Zhang, Xiao Fei; Tang, Shu Zhen; Huang, Ai Dong


    Lead-rich and antimony-rich oxidizing slag was subjected to regular HCl-NaCl leaching, with the experimental conditions optimized under which ultrasound was introduced. After only 15 min of ultrasound-assisted leaching, the leaching rate of Sb resembled that after 45 min of regular leaching. Ultrasonic treatment considerably elevated the leaching rates of Sb and Pb, and shortened the leaching time. With the decrease of particle size, the leaching rate of Sb and Pb increased gradually. Especially, as the particle size of the slag was greater than 0.217 mm, the ultrasonic leaching effects of Sb and Pb were significantly higher than that of regular leaching effects. The temperature exhibited great effect on ultrasonic leaching performance. As the temperature increased, the leaching rates of Sb and Pb increased step by step. In case the temperature was higher than 85°C, the increasing speed of the leaching rates for Sb and Pb tended to be slow. Increasing ultrasonic power could augment the leaching rate or accelerate the procedure till the same leaching rate. However, since ultrasound failed to energize the formation of new reaction pathways, the maximum leaching rates of Sb and Pb were determined by their phase compositions rather than by ultrasonic field. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Thickness-Dependent Bioelectrochemical and Energy Applications of Thickness-Controlled Meso-Macroporous Antimony-Doped Tin Oxide

    Directory of Open Access Journals (Sweden)

    Daniel Mieritz


    Full Text Available Coatings of hierarchically meso-macroporous antimony-doped tin oxide (ATO enable interfacing adsorbed species, such as biomacromolecules, with an electronic circuit. The coating thickness is a limiting factor for the surface coverage of adsorbates, that are electrochemically addressable. To overcome this challenge, a carbon black-based templating method was developed by studying the composition of the template system, and finding the right conditions for self-standing templates, preventing the reaction mixture from flowing out of the mask. The thicknesses of as-fabricated coatings were measured using stylus profilometry to establish a relationship between the mask thickness and the coating thickness. Cyclic voltammetry was performed on coatings with adsorbed cytochrome c to check whether the entire coating thickness was electrochemically addressable. Further, bacterial photosynthetic reaction centers were incorporated into the coatings, and photocurrent with respect to coating thickness was studied. The template mixture required enough of both carbon black and polymer, roughly 7% carbon black and 6% poly(ethylene glycol. Coatings were fabricated with thicknesses approaching 30 µm, and thickness was shown to be controllable up to at least 15 µm. Under the experimental conditions, photocurrent was found to increase linearly with the coating thickness, up to around 12 µm, above which were diminished gains.

  10. Respirable antimony and other trace-elements inside and outside an elementary school in Flagstaff, AZ, USA

    International Nuclear Information System (INIS)

    Majestic, Brian J.; Turner, Joseph A.; Marcotte, Aurelie R.


    Because people spend almost 90% of their time indoors, ambient air monitors may severely underestimate actual exposure to atmospheric particulate matter (PM). Therefore, it becomes increasingly important to better understand the microenvironments where people are spending their time. For preadolescent children, the best estimates of exposure may be inside of their school. In this study, 11 size fractions of PM were collected inside and outside of an elementary school in Flagstaff, AZ, USA. In particles −3 — greater than many urban areas around the world. Cu:Sb ratios and size distribution functions suggest that the excess source of PM1 indoor Sb results from the suspension of embedded Sb (used as a flame retardant) in the carpeting. This is the first study to observe elevated submicron Sb in schools and further studies are required to determine if this is a widespread health risk. -- Highlights: ► Atmospheric particulate matter (PM) was collected inside and outside an elementary school. ► Size-resolved trace metal and mass concentrations were measured. ► Indoor / Outdoor ratios of PM mass were very large for particles larger than 1 µm and about unity for particles < 1 µm. ► Most of the metal mass was found to originate from crustal sources. ► Highly elevated levels of antimony were measured – most likely from the resuspension of Sb embedded in carpeting.

  11. Influence of silicon treatment on antimony uptake and translocation in rice genotypes with different radial oxygen loss. (United States)

    Zhang, Liping; Yang, Qianqian; Wang, Shiliang; Li, Wanting; Jiang, Shaoqing; Liu, Yan


    Antimony (Sb) pollution in soil may have a negative impact on the health of people consuming rice. This study investigated the effect of silicon (Si) application on rice biomass, iron plaque formation, and Sb uptake and speciation in rice plants with different radial oxygen loss (ROL) using pot experiments. The results demonstrated that Si addition increased the biomass of straw and grain, but had no obvious impact on the root biomass. Indica genotypes with higher ROL underwent greater iron plaque formation and exhibited more Sb sequestration in iron plaque. Silicon treatments increased iron levels in iron plaque from the different genotypes but decreased the total Sb concentration in root, straw, husk, and grain. In addition, Si treatment reduced the inorganic Sb concentrations but slightly increased the trimethylantimony (TMSb) concentrations in rice straw. Moreover, rice straw from hybrid genotypes accumulated higher concentrations of TMSb and inorganic Sb than that from indica genotypes. The conclusions from this study indicate that Sb contamination in rice can be efficiently reduced by applying Si treatment and selecting genotypes with high ROL. Copyright © 2017 Elsevier Inc. All rights reserved.

  12. Structural and optical changes induced by incorporation of antimony into InAs/GaAs(001) quantum dots

    International Nuclear Information System (INIS)

    Taboada, A. G.; Alonso-Alvarez, D.; Alen, B.; Rivera, A.; Ripalda, J. M.; Llorens, J. M.; Martin-Sanchez, J.; Gonzalez, Y.; Sanchez, A. M.; Beltran, A. M.; Molina, S. I.; Bozkurt, M.; Ulloa, J. M.; Koenraad, P. M.; Garcia, J. M.


    We present experimental evidence of Sb incorporation inside InAs/GaAs(001) quantum dots exposed to an antimony flux immediately before capping with GaAs. The Sb composition profile inside the nanostructures as measured by cross-sectional scanning tunneling and electron transmission microscopies show two differentiated regions within the quantum dots, with an Sb rich alloy at the tip of the quantum dots. Atomic force microscopy and transmission electron microscopy micrographs show increased quantum-dot height with Sb flux exposure. The evolution of the reflection high-energy electron-diffraction pattern suggests that the increased height is due to changes in the quantum-dot capping process related to the presence of segregated Sb atoms. These structural and compositional changes result in a shift of the room-temperature photoluminescence emission from 1.26 to 1.36 μm accompanied by an order of magnitude increase in the room-temperature quantum-dot luminescence intensity.

  13. High-throughput combinatorial chemical bath deposition: The case of doping Cu (In, Ga) Se film with antimony (United States)

    Yan, Zongkai; Zhang, Xiaokun; Li, Guang; Cui, Yuxing; Jiang, Zhaolian; Liu, Wen; Peng, Zhi; Xiang, Yong


    The conventional methods for designing and preparing thin film based on wet process remain a challenge due to disadvantages such as time-consuming and ineffective, which hinders the development of novel materials. Herein, we present a high-throughput combinatorial technique for continuous thin film preparation relied on chemical bath deposition (CBD). The method is ideally used to prepare high-throughput combinatorial material library with low decomposition temperatures and high water- or oxygen-sensitivity at relatively high-temperature. To check this system, a Cu(In, Ga)Se (CIGS) thin films library doped with 0-19.04 at.% of antimony (Sb) was taken as an example to evaluate the regulation of varying Sb doping concentration on the grain growth, structure, morphology and electrical properties of CIGS thin film systemically. Combined with the Energy Dispersive Spectrometer (EDS), X-ray Photoelectron Spectroscopy (XPS), automated X-ray Diffraction (XRD) for rapid screening and Localized Electrochemical Impedance Spectroscopy (LEIS), it was confirmed that this combinatorial high-throughput system could be used to identify the composition with the optimal grain orientation growth, microstructure and electrical properties systematically, through accurately monitoring the doping content and material composition. According to the characterization results, a Sb2Se3 quasi-liquid phase promoted CIGS film-growth model has been put forward. In addition to CIGS thin film reported here, the combinatorial CBD also could be applied to the high-throughput screening of other sulfide thin film material systems.

  14. Immunotherapy Using Autoclaved L. Major Antigens and M. Vaccae with Meglumine Antimoniate, for the Treatment of Experimental Canine Visceral Leishmaniasis

    Directory of Open Access Journals (Sweden)

    Sh Jamshidi


    Full Text Available Background: To evaluate immunotherapy against canine visceral leishmaniasis, Leishmania ma­jor antigen and heat-killed Mycobacterium vaccae (SRL172 were used as stimulators of immune de­fense mechanisms and the results were compared with standard chemotherapy meglumine antimoni­ate.Methods: Nineteen mongrel dogs aging 1-3 years old were used in this experiment. Infection was carried out in 15 out of 19 dogs using L. infantum, isolated from a naturally infected poly-symptomatic dog.Results: All the cases showed positive serologic results by direct agglutination test during 30-60 days following inoculation. In the first group, which was under chemotherapy (GlucantimeR, one of the members showed recurrence of the disease despite rapid effect of the therapeutic protocol. Im­munotherapy using SRL172 caused complete cleaning of the parasite in group 2, but the speed was less than Glucantime. Immunotherapy using L. major antigen combined with M. vaccae in group 3 and combine administration of immunotherapy and chemotherapy in group 4 both were with relapsing of one case in each group. Group 5 and 6 were consisted of positive and negative con­trol dogs, respectively.Conclusion: Immunotherapy seems to be an adjuvant in treatment of canine leishmaniasis but it needs more investigation for final confirmation.

  15. Influence of arbuscular mycorrhizal fungi on antimony phyto-uptake and compartmentation in vegetables cultivated in urban gardens. (United States)

    Pierart, Antoine; Dumat, Camille; Maes, Arthur QuyManh; Sejalon-Delmas, Nathalie


    1. Urban areas are often contaminated with various forms of persistent metal (loid) and emerging contaminants such as antimony (Sb). Thus, in the context of urban agriculture where sustainable practices such as biofertilizers application (arbuscular mycorrhizal fungi, AMF) could improve nutrient transfer from the soil to the vegetables, the effect of AMF on metal (loid) mobility and human bioaccessibility is still poorly known. 2. The role of AMF in Sb uptake by lettuce and carrot grown in artificial substrate spiked with different Sb chemical species was investigated. Plants were grown under hydroponic conditions and half of the treatments received a concentrated spore solution to obtain mycorrhized and non-mycorrhized plants. Three weeks before harvest, plants were exposed to 10 mg.L -1 of either Sb 2 O 3 or KSbO-tartrate (KSb). 3. The presence of AMF significantly increased its accumulation in carrots (all organs) with higher accumulation in roots. In lettuce, accumulation appeared to be dependent on the Sb chemical species. Moreover, it was observed for the first time that AMF changed the human bioaccessible fraction of Sb in edible organs. 4. The present results highlight a possible risk of Sb transfer from soil to edible plants cultivated in soil naturally containing AMF propagules, or when AMF are added as biofertilizers. After validating the influence of soil environment and AMF on Sb behavior in the field, these results should be considered in health risk assessments. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. 3D Cathodes of Cupric Oxide Nanosheets Coated onto Macroporous Antimony-Doped Tin Oxide for Photoelectrochemical Water Splitting. (United States)

    Wang, Xu-Dong; Xu, Yang-Fan; Chen, Bai-Xue; Zhou, Ning; Chen, Hong-Yan; Kuang, Dai-Bin; Su, Cheng-Yong


    Cupric oxide (CuO), a narrow-bandgap semiconductor, has a band alignment that makes it an ideal photocathode for the renewable production of solar fuels. However, the photoelectrochemical performance of CuO is limited by its poor conductivity and short electron diffusion lengths. Herein, a three-dimensional (3D) architecture consisting of CuO nanosheets supported onto transparent conducting macroporous antimony-doped tin oxide (mpATO@CuONSs) is designed as an excellent photocathode for promoting the hydrogen evolution reaction (HER). Owing to the 3D structure affording superior light-harvesting characteristics, large contact areas with the electrolyte, and highly conductive pathways for separation and transport of charge carriers, the mpATO@CuONSs photocathode produces an impressively high photocurrent density of -4.6 mA cm -2 at 0 V versus the reversible hydrogen electrode (RHE), which is much higher than that of the CuONSs array onto planar FTO glass (-1.9 mA cm -2 ). © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Investigation of physico-mechanical properties of flexible poly (vinyl chloride) filled with antimony trioxide using ionizing radiation. (United States)

    Elnaggar, Mona Y; Fathy, E S; Hassan, Medhat M


    Composites of polyvinyl chloride (PVC) with 2% calcium carbonate, 2% diethyl phthalate, 2% paraffin wax and 2% lead sulphate and different contents of antimony trioxide (Sb 2 O 3 ) prepared by melting and irradiated with gamma ray have been considered. Assessment of the mechanical and thermal properties of the unirradiated and irradiated flexible polyvinyl chloride (FPVC) were completed utilizing elasticity (TS), Elongation at break (Eb) and thermogravimetric analysis measurements. TS and thermal stability of FPVC displayed advanced improvement after addition of additives and this approach highlighted the efficiency of those ingredients on PVC. The compounding of FPVC with Sb 2 O 3 in various extents was examined by FTIR, X-ray diffraction and scanning electron microscope methods. It is obvious that the presence of Sb 2 O 3 begins impacting oxidative degradation, leading to a decrease in mechanical properties up to 10%. Moreover, a slight increase in the thermal stability of composites by exposure to ionizing radiation is apparently due to cross-linking of FPVC chains.

  18. Kinetic modeling of pH-dependent antimony (V) sorption and transport in iron oxide-coated sand. (United States)

    Cai, Yongbing; Li, Lulu; Zhang, Hua


    Understanding the mechanisms and kinetics controlling the retention and transport of antimony (Sb) is prerequisite for evaluating the risk of groundwater contamination by the toxic element. In this study, kinetic batch and saturated miscible displacement experiments were performed to investigate effects of protonation-deprotonation reactions on sorption-desorption and transport of Sb(V) in iron oxide-coated sand (IOCS). Results clearly demonstrated that Sb(V) sorption was highly nonlinear and time dependent, where both sorption capacity and kinetic rates decreased with increasing solution pH. Breakthrough curves (BTCs) obtained at different solution pH exhibited that mobility of Sb(V) were higher under neutral to alkaline condition than under acidic condition. Because of the nonlinear and non-equilibrium nature of Sb(V) retention and transport, multi-reaction models (MRM) with equilibrium and kinetic sorption expressions were utilized successfully to simulate the experiment data. Equilibrium distribution coefficient (Ke) and reversible kinetic retention parameters (k1 and k2) of both kinetic sorption and transport experiment showed marked decrease as pH increased from 4.0 to 7.5. Surface complexation is suggested as the dominant mechanism for the observed pH-dependent phenomena, which need to be incorporated into the kinetic models to accurately simulate the reactive transport of Sb(V) in vadose zone and aquifers. Copyright © 2015. Published by Elsevier Ltd.

  19. Effects of storage temperature and time of antimony release from PET bottles into drinking water in China. (United States)

    Qiao, Fei; Lei, Kun; Li, Zicheng; Liu, Qing; Wei, Zhanliang; An, Lihui; Qi, Hongli; Cui, Song


    Antimony (Sb) concentrations were measured in 10 brands of PET bottled drinking water available in supermarkets in China. To simulate general storage habits based on market research, these PET bottles with drinking water were stored for 4 weeks in a lab or a car trunk during the summer. Although the PET package material of brand A had the lowest Sb level (142.71 ± 29.81 μg/g), it showed a significant increase in Sb concentrations when stored in both the car trunk and the lab. There was significant release of Sb from the PET bottles into the water following 24 h of incubation at ≥ 40 °C (40, 50, 60, and 70 °C), especially at 70 °C. The potential health risk of Sb release from PET bottles was calculated based on daily intake values and determined to be acceptable for consumers under normal storage conditions.


    Directory of Open Access Journals (Sweden)

    Madelon Novato Ribeiro


    Full Text Available The favorable outcome of the treatment of a disease is influenced by the adherence to therapy. Our objective was to assess factors associated with adherence to treatment of patients included in a clinical trial of equivalence between the standard and alternative treatment schemes with meglumine antimoniate (MA in the treatment of cutaneous leishmaniasis (CL, in the state of Rio de Janeiro. Between 2008 and 2011, 57 patients with CL were interviewed using a questionnaire to collect socioeconomic data. The following methods were used for adherence monitoring: counting of vial surplus, monitoring card, Morisky test and modified Morisky test (without the question regarding the schedule; we observed 82.1% (vial return, 86.0% (monitoring card, 66.7% (Morisky test and 86.0% (modified Morisky test adherence. There was a strong correlation between the method of vial counting and the monitoring card and modified Morisky test. A significant association was observed between greater adherence to treatment and low dose of MA, as well as with a lower number of people sleeping in the same room. We recommend the use of the modified Morisky test to assess adherence to treatment of CL with MA, because it is a simple method and with a good performance, when compared to other methods.

  1. Sensitivity of a LR-115 based radon dosemeter

    CERN Document Server

    Bagnoli, F; Bucci, S


    The first results of a study on the sensitivity of a LR-115 based radon dosemeter as a function of the absorber thickness are presented. The theoretical sensitivity was analytically calculated considering a constant detector response to alpha particles within a given energy range and up to a critical angle of incidence. The results are presented in two extreme situations: i) both radon and its decay products uniformly distributed in the chamber volume; ii) radon decay products uniformly deposited on the chamber walls. The agreement with the experimental curve shape appears better in the former case, suggesting that either the parameter values of the model could be different from the chosen values, or the model was too simplified.

  2. Transpalpebral exenteration in cattle: a retrospective study of 115 cases. (United States)

    Chigerwe, Munashe; Angelos, John A; Gamsjäeger, Lisa; Heller, Meera C


    To describe the indications for exenteration and complications associated with the procedure. 115 cattle. Medical records of cattle presented for unilateral exenteration evaluated at the University of California, Davis Veterinary Medical Teaching Hospital from January 1985 through December 2015 were reviewed. Median (range) age at presentation for all cattle was 6 (0.2-30) years. The most prevalent (80.9%) indication for exenteration was squamous cell carcinoma (SCC). Cattle >5 years had higher odds (OR = 11.2, 95% CI, 2.8-45.8) for undergoing exenteration due to SCC compared to cattle ≤5 years. Herefords had higher odds (OR = 4.6, 95% CI, 1.5-14.6) for undergoing exenteration for SCC compared to other breeds. Holsteins had higher odds (OR = 140.7, 95% CI, 7.5-2644) for undergoing exenteration for retrobulbar lymphoma compared to other breeds. Complications following exenteration were reported in 15 cases (13.0%). The postsurgical complications were orbital abscesses (6/15), recurrence of SCC (5/15), wound dehiscence (3/15), and excessive hemorrhage (1/15). Median (range) time to occurrence of postsurgical complications was 19 (5-205) days. There was no significant association (P > 0.05) between ocular diagnosis, age, anesthetic technique or the suture pattern used to close the skin postsurgically, and occurrence of postsurgical complications. Early clinical diagnosis of SCC by owners and veterinarians may prevent the need for exenteration. Owners should be made aware of the possible postsurgical complications following exenteration in cattle. © 2016 American College of Veterinary Ophthalmologists.

  3. Analysis of parahippocampal gyrus in 115 patients with hippocampal sclerosis

    Directory of Open Access Journals (Sweden)

    Ferreira Nelson Fortes


    Full Text Available PURPOSE: Analysis of the parahippocampal gyrus (PHG involvement in 115 patients with hippocampal sclerosis (HS by MR imaging. The simultaneous occurrence of ipsilateral fornix (F and mamillary body (MB volume loss was checked also. These findings were correlated with the side of hippocampal involvement, the sex, patient´s age, and the symptoms onset. METHOD: The MR images of 115 patients with HS were studied retrospectively. All the examinations were performed on 1.5 T units (SIGNA, GE, Milwaukee, WI and included high resolution coronal T2-weighted images (3 mm thickness, 0.6 mm gap. RESULTS: The patient's age ranged between 3.5 and 80 years (mean 34.1; 62 (53.9% were female and 53 (46.1% were male. There were HS on the left side in 53 (46.0%, on the right side in 51 (44.3%, and bilateral in 11 (9.7%. In 43 (37.3% cases there were ipsilateral PHG volume loss and signal hyper intensity on T2-weighted imaging. In 29 (25.2% cases there were ipsilateral fornix volume loss and in 10 (34.5% of this there were also ipsilateral MB changes. In abnormal PHG, 23 (53.4% were on the left side, 17 (39.5% were on the right side, and 3 (7.1% were bilateral. There were fornix changes in 15 (34.8% cases and MB volume loss in 5 (11.6% cases. Pertinent clinical data were obtained in only 18 (41.8% of the PHG lesion cases and 11 (61.1% of these patients had epileptic attacks for more than 20 years before the examination. CONCLUSION: PHG involvement must be investigated in patients with HS and we suggest that the term mesial temporal sclerosis should be used only if there are also changes at this anatomical site.

  4. Comparison of sup(115m)Cd accumulation from sediments and sea water by polychaete worms

    International Nuclear Information System (INIS)

    Ueda, Taishi; Nakamura, Ryoichi; Suzuki, Yuzuru


    To know the role played by marine sediments in influencing the fate of discharged metals, (1) the interaction of metals between sediments and deposit-feeder marine worms (Nereis japonica), and (2) uptake and excretion of metals by worms were examined by laboratory experiments using sup(115m)Cd. Worms directly in contact with sup(115m)Cd-sediments accumulated sup(115m)Cd six times more than worms that were not in contact with the sup(115m)Cd sediments during the 8 days of experimentation and 12% of sup(115m)Cd in sediments were noted to be transfered to worms per unit. Comparing the concentration factor of 22 (from sea water) with accumulation from sediments, it was assumed that sup(115m)Cd in sediments would give the effect of 1/200 to the accumulation of sup(115m)Cd by worms in sea water to the accumulation of sup(115m)Cd. Further, to simulate these results close to that occuring in the natural ecosystem, the distribution of sup(115m)Cd in sea water, sediments and alga were also examined by means of a curve analysis of the distribution pattern by a three compartment model. It proved that the activity ratios of sup(115m)Cd were 9 for sediments and 21 for alga, which was similar to 22 for worms. (auth.)

  5. The oxygen sensitivity of a multipoint antimony electrode for tissue pH measurements. A study of the sensitivity for in vivo PO2 variations below 6 kPa. (United States)

    Sjöberg, F; Edwall, G; Lund, N


    Monocrystalline micro antimony electrodes in a multipoint arrangement as described by Lund et al. were placed on the skeletal muscle surface of the rabbit. Tissue oxygen levels were measured simultaneously with the MDO (Mehrdraht Dortmund Oberfläche) oxygen electrode. The sensitivity for variations in tissue PO2 (PO2(t)) was evaluated for the antimony metal-metal oxide sensor. The sensitivity (delta E/delta log10 PO2)+/- SE was found to be 21.8 +/- 1.2 mV in the interval between 0.1 kPa and 1 kPa and 53 +/- 5 mV in the interval between 1 kPa and 6 kPa. These results are not consistent with the oxygen sensitivity of monocrystalline antimony described in vitro, but are in agreement with the findings of Nilsson & Edwall. A plausible explanation for the S-shaped oxygen sensitivity curve of antimony at oxygen levels below 10 kPa could be an interaction, at the electrode surface, between the dissolved oxygen and the oxygen bound to haemoglobin. If this is the case, the use of an antimony electrode would make possible the determination of the dissociation of oxyhaemoglobin in tissues.

  6. Speciation of inorganic antimony in polyethylene terephthalate (PET) bottled water using hydride generation atomic absorption spectrophotometry (HG-AAS)

    International Nuclear Information System (INIS)

    Markwo, Ali


    Antimony (Sb) is a regulated drinking water contaminant that has been found to leach from polyethylene terephthalate (PET) plastic containers into the waters stored in them. The common inorganic species of antimony in water are Sb(III) and Sb(V), with the former being more toxic and the latter being more soluble. In order to assess the extent to which waters stored in PET bottles are contaminated with inorganic Sb and to further examine the effect of typical storage conditions on migration rates, speciation analysis of inorganic Sb using hydride generation atomic absorption spectrophotometry (HG-AAS) was undertaken on selected PET plastic bottled waters marketed in the Greater Accra Region of Ghana. Six brands of PET plastic bottled waters were obtained at source on the day of packaging, and analyses undertaken on samples of the waters stored in the plastic containers at intervals of four weeks for twelve weeks, under three carefully chosen storage conditions distinctive of bottled water usage. Selected physicochemical properties of samples of the waters stored in the plastic containers and total Sb of samples of the plastic containers were also determined to discover the effect of some physical properties and certain major ions, and the influence of the different quality PET plastic types on Sb migration respectively. The study revealed amounts of total Sb in the PET plastic containers of the 6 brands ranging from 123.46 mg/kg to 146.45 mg/kg. The selected physicochemical properties of the waters stored in the PET plastic containers considered were pH (6.78 – 7.43), Ca2+ (1.61 – 12.39 mg/L), Mg2+ (1.00 – 4.96 mg/L), HCO3− (6.18 – 55.41 mg/L) and TDS (8.70 – 70.40 mg/L)). PET bottled waters of 5 out of the 6 brands contained Sb (initial total Sb ranging from 1.11 – 14.65 μg/L) before storage. Total Sb concentrations of the waters stored in the plastic containers were observed to increase with storage time under all the three storage conditions for

  7. A novel voltammetric sensor based on carbon nanotubes and nanoparticles of antimony tin oxide for the determination of ractopamine

    Energy Technology Data Exchange (ETDEWEB)

    Baytak, Aysegul Kutluay; Teker, Tugce; Duzmen, Sehriban; Aslanoglu, Mehmet, E-mail:


    An electrochemical sensor was prepared by the modification of a glassy carbon electrode (GCE) with carbon nanotubes (CNTs) and nanoparticles of antimony tin oxide (ATO). The surface layer was characterized by scanning electron microscopy (SEM), energy dispersive X-ray diffraction method (EDX) and ATR FT-IR spectroscopy. The proposed electrode was assessed in respect to the electro-oxidation of ractopamine. Compared with a bare GCE and a GCE electrode modified with CNTs, the ATONPs/CNTs/GCE exhibited a great catalytic activity towards the oxidation of ractopamine with a well-defined anodic peak at 600 mV. The current response was linear with the concentration of ractopamine over the range from 10 to 240 nM with a detection limit of 3.3 nM. The proposed electrode enabled the selective determination of ractopamine in the presence of high concentrations of ascorbic acid (AA), dopamine (DA) and uric acid (UA). The proposed electrode was successfully applied for the determination of ractopamine in feed and urine samples. The sensitive and selective determination of ractopamine makes the developed method of great interest for monitoring its therapeutic use and doping control purposes. - Highlights: • A novel voltammetric sensor was prepared using nanoparticles of ATO and CNTs. • The ATONPs/CNTs/GCE has greatly improved the voltammetry of ractopamine. • The proposed electrode enabled a detection limit of 3.3 nM. • AA, DA and UA did not interfere with the selective detection of ractopamine. • Measurements were precise and accurate.

  8. Eficácia do sulfato de aminosidine na leishmaniose visceral grave, resistente ao tratamento com antimonial pentavalente

    Directory of Open Access Journals (Sweden)

    Cleudson Castro


    Full Text Available Descreve-se um caso de calazar grave resistente a dez cursos de antimonial petitavalente (glucantime à base de 20mg de Sb5/kg/dia, que respondeu favoravelmente ao sulfato de aminosidine intramuscular na dose de 20mg/kg/dia por 20 dias, repetido após 20 dias. O parasitismo esplénico passou de 50 parasitos por campo a 3 parasitos em 10 campos logo após a primeira série de sulfato de aminosidine, tornando-se negativo depois de sete meses. A melhora clínica foi imediata, com redução gradual da hepatoesplenomegalia, e desaparecimento 26 meses após. Neste período aumentou 13 kg. Após o uso de aminosidine a reação de Monténégro tornou-se positiva e as células mononucleares responderam quando estimuladas com antígenos de leishmânia.A grave kala-azar infection in a 14 years old boy is described. The leishmanial infection failed to respond to ten interrupted courses of glucantime of variable duration (14-56 days at a dose of 20mg Sb5/kg/day. However a favorable response ocurred to intramuscular aminosidine sulphate (20mg/kg/day for 20 days. This same regimen was repeated 20 days later. After the first treatment splenic puncture parasite density fell from 50 amastigotes per oil immersion field to 3 amastigotes in 10 fields. A further splenic puncture 7 months after treatment was negative. The marked hepatoesplenomegaly gradually resolved over 26 months follow up and he gained 13 kilogramas in weight. After aminosidine sulphate therapy his Montenegro reaction become positive and his lymphocytes responded to leishmania antigens.

  9. Microbial degradation of high impact polystyrene (HIPS), an e-plastic with decabromodiphenyl oxide and antimony trioxide

    International Nuclear Information System (INIS)

    Sekhar, Vini C.; Nampoothiri, K. Madhavan; Mohan, Arya J.; Nair, Nimisha R.; Bhaskar, Thallada; Pandey, Ashok


    Highlights: • Biodegradation of a high impact polystyrene e − plastic. • 12.4% (w/w) e plastic film lost using an isolate, Enterobacter sp. • Noted changes in the physico-chemical characteristics of degraded e-plastic film. • Polystyrene intermediates were detected in the degradation medium. • e-plastic degrading microbes displayed extracellular depolymerase activity. - Abstract: Accumulation of electronic waste has increased catastrophically and out of that various plastic resins constitute one of the leading thrown out materials in the electronic machinery. Enrichment medium, containing high impact polystyrene (HIPS) with decabromodiphenyl oxide and antimony trioxide as sole carbon source, was used to isolate microbial cultures. The viability of these cultures in the e-plastic containing mineral medium was further confirmed by triphenyl tetrazolium chloride (TTC) reduction test. Four cultures were identified by 16S rRNA sequencing as Enterobacter sp., Citrobacter sedlakii, Alcaligenes sp. and Brevundimonas diminuta. Biodegradation experiments were carried out in flask level and gelatin supplementation (0.1% w/v) along with HIPS had increased the degradation rate to a maximum of 12.4% (w/w) within 30 days. This is the first report for this kind of material. The comparison of FTIR, NMR, and TGA analysis of original and degraded e-plastic films revealed structural changes under microbial treatment. Polystyrene degradation intermediates in the culture supernatant were also detected using HPLC analysis. The gravity of biodegradation was validated by morphological changes under scanning electron microscope. All isolates displayed depolymerase activity to substantiate enzymatic degradation of e-plastic.

  10. Microbial degradation of high impact polystyrene (HIPS), an e-plastic with decabromodiphenyl oxide and antimony trioxide

    Energy Technology Data Exchange (ETDEWEB)

    Sekhar, Vini C. [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India); Nampoothiri, K. Madhavan, E-mail: [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India); Mohan, Arya J.; Nair, Nimisha R. [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India); Bhaskar, Thallada [Bio-Fuels Division (BFD), CSIR-Indian Institute of Petroleum (IIP), Dehradun, Uttarakhand 248005 (India); Pandey, Ashok [Biotechnology Division, CSIR-National Institute for Interdisciplinary Science and Technology (NIIST), Trivandrum 695 019, Kerala (India)


    Highlights: • Biodegradation of a high impact polystyrene e − plastic. • 12.4% (w/w) e plastic film lost using an isolate, Enterobacter sp. • Noted changes in the physico-chemical characteristics of degraded e-plastic film. • Polystyrene intermediates were detected in the degradation medium. • e-plastic degrading microbes displayed extracellular depolymerase activity. - Abstract: Accumulation of electronic waste has increased catastrophically and out of that various plastic resins constitute one of the leading thrown out materials in the electronic machinery. Enrichment medium, containing high impact polystyrene (HIPS) with decabromodiphenyl oxide and antimony trioxide as sole carbon source, was used to isolate microbial cultures. The viability of these cultures in the e-plastic containing mineral medium was further confirmed by triphenyl tetrazolium chloride (TTC) reduction test. Four cultures were identified by 16S rRNA sequencing as Enterobacter sp., Citrobacter sedlakii, Alcaligenes sp. and Brevundimonas diminuta. Biodegradation experiments were carried out in flask level and gelatin supplementation (0.1% w/v) along with HIPS had increased the degradation rate to a maximum of 12.4% (w/w) within 30 days. This is the first report for this kind of material. The comparison of FTIR, NMR, and TGA analysis of original and degraded e-plastic films revealed structural changes under microbial treatment. Polystyrene degradation intermediates in the culture supernatant were also detected using HPLC analysis. The gravity of biodegradation was validated by morphological changes under scanning electron microscope. All isolates displayed depolymerase activity to substantiate enzymatic degradation of e-plastic.

  11. The effect of trace amounts of antimony on the structure and properties of aluminum alloy A356. 2

    Energy Technology Data Exchange (ETDEWEB)

    Tuttle, B.L. (Tuttle (B.L.) (USA)); Keslinke, A. (Cast Metals Inst., Des Plaines, IL (USA)); Twarog, D.L. (American Foundrymens' Society, Des Plaines, IL (USA)); Daniels, E.J. (Argonne National Lab., IL (USA))


    This investigation was performed to determine the effect of trace amounts of antimony (Sb) on the microstructure, mechanical properties, and casting properties of strontium-modified A356.2 aluminum alloy that was cast in chemically bonded sand molds. The aluminum-silicon alloys were prepared in a high-frequency induction furnace from primary A356.2 ingot of commercial purity. Each melt was grain-refined with aluminum-titanium rod, modified with aluminum-strontium-silicon rod, and degassed with dry nitrogen. Five heats were prepared at each target level of Sb: 0.00, 0.05, 0.10, 0.15 and 0.20 wt %. Significant changes in mechanical and foundry properties resulted from changes in the morphology of the aluminum-silicon eutectic microstructure at the different Sb concentrations. The principle mechanical property affected was elongation (ductility). At an Sb concentration of 0.00%, elongation was 5.3%. At a concentration of 0.06%, elongation decreased to 2.9%. The fluidity of the alloy was also affected. At all three temperatures investigated, fluidity declined approximately 17% at 0.14% Sb relative to alloy containing no Sb. At an Sb content of 0.26%, the fluidity increased approximately 22% (relative to that at 0.14% Sb) to a value slightly higher than that of the Sr-modified alloy containing no Sb. None of the thermal analysis curves for the five levels of Sb addition indicated a cooling curve inflection that could be attributed to the presence of Sb alone. 14 refs., 9 figs., 10 tabs.

  12. Mine waste acidic potential and distribution of antimony and arsenic in waters of the Xikuangshan mine, China

    International Nuclear Information System (INIS)

    Zhou, Jianwei; Nyirenda, Mathews T.; Xie, Lina; Li, Yi; Zhou, Baolong; Zhu, Yue; Liu, Huilin


    The Xikuangshan (XKS) mine in China has vast quantities of waste material and reported antimony (Sb) and arsenic (As) contamination of water in the mine area. This study estimated the potential of acid mine drainage (AMD) generation by waste material at XKS mine by using paste pH, acid base accounting and net acid generation geochemical static tests. Distribution of Sb and As in surface and groundwater in relation to mine waste AMD producing potential was also investigated. Thirty four (34) water samples and representative samples of three mine wastes from different periods (fresh, 10 and 50 years) were collected for this study: waste rock, smelting slag and tailings. The AMD prediction shows that waste rock (from 10 year period) is acid producing while the fresh mine waste had alkaline paste pH indicating the presence of reactive carbonates. Hence AMD generation may have occurred after a long time due to dissolution of carbonates. Water analysis found Sb with higher concentration than As with means of 3.74 mg/L and 0.19 mg/L respectively. Highest Sb and As concentrations were observed in the North mine along the water flow path from waste heaps and tailing pond; Mine water in the South mine also had elevated Sb and As concentrations. Mining activities at the XKS mine have accelerated Sb and As releases because of the disturbed natural equilibrium. Proper mine waste management and collection and treatment of outflow from the waste rock heaps and tailing ponds seem to be a promising mitigation options. - Highlights: • High levels of Sb and As were detected in alkaline water at Xikuangshan mine. • Static test showed that mine waste aged over 10 years was acid generating. • Mine waste influenced the high concentration of Sb and As in water. • The Sb/As ratios in water favored Sb because of high Sb content in the ore body.

  13. Imipramine is an orally active drug against both antimony sensitive and resistant Leishmania donovani clinical isolates in experimental infection.

    Directory of Open Access Journals (Sweden)

    Sandip Mukherjee

    Full Text Available BACKGROUND: In an endeavor to find an orally active and affordable antileishmanial drug, we tested the efficacy of a cationic amphiphilic drug, imipramine, commonly used for the treatment of depression in humans. The only available orally active antileishmanial drug is miltefosine with long half life and teratogenic potential limits patient compliance. Thus there is a genuine need for an orally active antileishmanial drug. Previously it was shown that imipramine, a tricyclic antidepressant alters the protonmotive force in promastigotes, but its in vivo efficacy was not reported. METHODOLOGY/PRINCIPAL FINDINGS: Here we show that the drug is highly active against antimony sensitive and resistant Leishmania donovani in both promastigotes and intracellular amastigotes and in LD infected hamster model. The drug was found to decrease the mitochondrial transmembrane potential of Leishmania donovani (LD promastigotes and purified amastigotes after 8 h of treatment, whereas miltefosine effected only a marginal change even after 24 h. The drug restores defective antigen presenting ability of the parasitized macrophages. The status of the host protective factors TNF α, IFN γ and iNOS activity increased with the concomitant decrease in IL 10 and TGF β level in imipramine treated infected hamsters and evolution of matured sterile hepatic granuloma. The 10-day therapeutic window as a monotherapy, showing about 90% clearance of organ parasites in infected hamsters regardless of their SSG sensitivity. CONCLUSIONS: This study showed that imipramine possibly qualifies for a new use of an old drug and can be used as an effective orally active drug for the treatment of Kala-azar.

  14. A novel voltammetric sensor based on carbon nanotubes and nanoparticles of antimony tin oxide for the determination of ractopamine

    International Nuclear Information System (INIS)

    Baytak, Aysegul Kutluay; Teker, Tugce; Duzmen, Sehriban; Aslanoglu, Mehmet


    An electrochemical sensor was prepared by the modification of a glassy carbon electrode (GCE) with carbon nanotubes (CNTs) and nanoparticles of antimony tin oxide (ATO). The surface layer was characterized by scanning electron microscopy (SEM), energy dispersive X-ray diffraction method (EDX) and ATR FT-IR spectroscopy. The proposed electrode was assessed in respect to the electro-oxidation of ractopamine. Compared with a bare GCE and a GCE electrode modified with CNTs, the ATONPs/CNTs/GCE exhibited a great catalytic activity towards the oxidation of ractopamine with a well-defined anodic peak at 600 mV. The current response was linear with the concentration of ractopamine over the range from 10 to 240 nM with a detection limit of 3.3 nM. The proposed electrode enabled the selective determination of ractopamine in the presence of high concentrations of ascorbic acid (AA), dopamine (DA) and uric acid (UA). The proposed electrode was successfully applied for the determination of ractopamine in feed and urine samples. The sensitive and selective determination of ractopamine makes the developed method of great interest for monitoring its therapeutic use and doping control purposes. - Highlights: • A novel voltammetric sensor was prepared using nanoparticles of ATO and CNTs. • The ATONPs/CNTs/GCE has greatly improved the voltammetry of ractopamine. • The proposed electrode enabled a detection limit of 3.3 nM. • AA, DA and UA did not interfere with the selective detection of ractopamine. • Measurements were precise and accurate.

  15. Antimony doped tin oxides and their composites with tin pyrophosphates as catalyst supports for oxygen evolution reaction in proton exchange membrane water electrolysis

    DEFF Research Database (Denmark)

    Xu, Junyuan; Li, Qingfeng; Hansen, Martin Kalmar


    based on tin pyrophosphates as the catalyst support. The materials showed an overall conductivity of 0.57 S cm−1 at 130 °C under the water vapor atmosphere with a contribution of the proton conduction. Using this composite support, iridium oxide nanoparticle catalysts were prepared and characterized......Proton exchange membrane water electrolysers operating at typically 80 °C or at further elevated temperatures suffer from insufficient catalyst activity and durability. In this work, antimony doped tin oxide nanoparticles were synthesized and further doped with an inorganic proton conducting phase...

  16. Double blind, randomized controlled trial, to evaluate the effectiveness of a controlled nitric oxide releasing patch versus meglumine antimoniate in the treatment of cutaneous leishmaniasis [NCT00317629

    Directory of Open Access Journals (Sweden)

    Silva Federico A


    Full Text Available Abstract Background Cutaneous Leishmaniasis is a worldwide disease, endemic in 88 countries, that has shown an increasing incidence over the last two decades. So far, pentavalent antimony compounds have been considered the treatment of choice, with a percentage of cure of about 85%. However, the high efficacy of these drugs is counteracted by their many disadvantages and adverse events. Previous studies have shown nitric oxide to be a potential alternative treatment when administered topically with no serious adverse events. However, due to the unstable nitric oxide release, the topical donors needed to be applied frequently, making the adherence to the treatment difficult. The electrospinning technique has allowed the production of a multilayer transdermal patch that produces a continuous and stable nitric oxide release. The main objective of this study is to evaluate this novel nitric oxide topical donor for the treatment of cutaneous leishmaniasis. Methods and design A double-blind, randomized, double-masked, placebo-controlled clinical trial, including 620 patients from endemic areas for Leishmaniasis in Colombia was designed to investigate whether this patch is as effective as meglumine antimoniate for the treatment of cutaneous leishmaniasis but with less adverse events. Subjects with ulcers characteristic of cutaneous leishmaniasis will be medically evaluated and laboratory tests and parasitological confirmation performed. After checking the inclusion/exclusion criteria, the patients will be randomly assigned to one of two groups. During 20 days Group 1 will receive simultaneously meglumine antimoniate and placebo of nitric oxide patches while Group 2 will receive placebo of meglumine antimoniate and active nitric oxide patches. During the treatment visits, the medications will be daily administered and the presence of adverse events assessed. During the follow-up, the research group will visit the patients at days 21, 45, 90 and 180. The

  17. Design of a Flow-Through Voltammetric Sensor Based on an Antimony-Modified Silver Electrode for Determining Lithol Rubine B in Cosmetics


    Lai-Hao, Wang; Shu-Juan, Huang


    Lithol Rubine B (LRB; the disodium salt of 3-hydroxy-4-[(4-methyl-2-sulfophenyl) azo]-2-naphthalenecarboxylic acid) was detected using high-performance liquid chromatography with an electrochemical (antimony film on silver) detector (HPLC-ECD). For direct current (DC) mode, with the current at a constant potential, and measurements with suitable experimental parameters, a linear concentration from 0.125 to 1.80 μg/mL was found. The detection limit of our method was approximately 2.0 ng/mL. An...

  18. Antimony in the soil-water-plant system at the Su Suergiu abandoned mine (Sardinia, Italy): strategies to mitigate contamination. (United States)

    Cidu, Rosa; Biddau, Riccardo; Dore, Elisabetta; Vacca, Andrea; Marini, Luigi


    This study was aimed to implement the understanding of the Sb behavior in near-surface environments, as a contribution to address appropriate mitigation actions at contaminated sites. For this purpose, geochemical data of soil (8 sites), water (29 sites), and plant (12 sites) samples were collected. The study area is located at Su Suergiu and surroundings in Sardinia (Italy), an abandoned mine area heavily contaminated with Sb, with relevant impact on water bodies that supply water for agriculture and domestic uses. Antimony in the soil horizons ranged from 19 to 4400 mg kg(-1), with highest concentrations in soils located close to the mining-related wastes, and concentrations in the topsoil much higher than in the bedrock. The Sb readily available fraction was about 2% of the total Sb in the soil. Antimony in the pore water ranged from 23 to 1700 μg L(-1), with highest values in the Sb-rich soils. The waters showed neutral to slightly alkaline pH, redox potential values indicating oxidizing conditions, electrical conductivity in the range of 0.2 to 3.7 mS cm(-1), and dissolved organic carbon ≤2 mg L(-1). The waters collected upstream of the mine have Ca-bicarbonate dominant composition, and median concentration of Sb(tot) of 1.7 μg L(-1) (that is total antimony determined in waters filtered through 0.45 μm), a value relatively high as compared with the background value (≤0.5 μg L(-1) Sb) estimated for Sardinian waters, but below the limits established by the European Union and the World Health Organization for drinking water (5 μg L(-1) Sb and 20 μg L(-1) Sb, respectively). The waters flowing in the mine area are characterized by Ca-sulfate dominant composition, and median concentrations of 7000 μg L(-1) Sb(tot). Extreme concentrations, up to 30,000 μg L(-1) Sb(tot), were observed in waters flowing out of the slag materials derived from the processing of Sb-ore. The Sb(III) was in the range of 0.8 to 760 μg L(-1) and represented up to 6% of Sb

  19. Elastic and inelastic atomic beam scattering from Ni(115)

    International Nuclear Information System (INIS)

    Aten, R.M.


    Scattered angular intensities of the elastic diffraction of nearly monoenergetic helium beam from a Ni(115) crystalline surface in the [552] direction at a variety of incident energies and polar angles was measured. A method is developed of mapping the corrugation parameters from the hard-wall diffraction model, which fit the experimental data, to the corrugation parameters in the soft wall (Morse potential) model. The experimental data was fit by the soft wall model with only minor adjustments of the mapped corrugation parameters for well depth of 8.0 MeV and a steepness parameter of 2.2 reciprocal angstroms. The inelastic scattering of argon at an incident angle of 30 0 for a variety of incident energies and surface temperatures was measured both as a function of reflected angle and as a function of time for narrow incident pulse shapes at the angle corresponding to the backscattered rainbow maximum in the [552] direction, and at the specular angle in the [110] direction. The angular scans show the intensity is peaked at a backscattered rainbow angle in the [552] direction, and is peaked at the specular angle in the [110] direction. The time-of-flight measurements show that a linear relationship between the reflected energy and the incident energy and between the reflected energy and the surface temperature is obeyed

  20. 25 CFR 115.817 - How does OTFM disburse money to a tribe? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false How does OTFM disburse money to a tribe? 115.817 Section 115.817 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES TRUST FUNDS... OTFM disburse money to a tribe? Upon receipt of all necessary documentation, OTFM will process the...

  1. Direct determination of bulk etching rate for LR-115-II solid state ...

    Indian Academy of Sciences (India)

    measurements and α autoradiography. Bulk removing rate is the objective of this work. We use a nonstrippable LR-115-. II detector, which consists of 12 µm cellulose nitrate on a substrate of 100 polyester, manufactured by Kodak pathe France. 2. Experimental. Different values for the bulk etching rate of LR-115-II detector ...

  2. 13 CFR 115.62 - Prohibition on participation in Prior Approval program. (United States)


    ... Prior Approval program. 115.62 Section 115.62 Business Credit and Assistance SMALL BUSINESS... in Prior Approval program. A PSB Surety is not eligible to submit applications under subpart B of this part. This prohibition does not extend to an Affiliate, as defined in 13 CFR § 121.103, of a PSB...

  3. 25 CFR 115.803 - What information will be provided in a statement of performance? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false What information will be provided in a statement of performance? 115.803 Section 115.803 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL... provided in a statement of performance? The statement of performance will identify the source, type, and...

  4. 25 CFR 115.405 - How frequently will a minor's statement of performance be mailed? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false How frequently will a minor's statement of performance be mailed? 115.405 Section 115.405 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL... minor's statement of performance be mailed? We will mail a minor's statement of performance to the...

  5. logos, jesus en god in johannes 1:1-5: 'n tekstuele analise

    African Journals Online (AJOL)

    LOGOS, JESUS AND GOD IN JOHN 1:1-5: A TEXTUAL ANALYSIS. ABSTRACT. In this article, the relationship between Christology and theology in John 1:1-5 is addressed. In particular, the relationship ..... 26 G. Steyer (1975:123, §148 H, J); vgl. ook Moulton, Howard & Turner (1963-. 1979:II, p. 423; IV, p. 427), N. Turner ...

  6. 33 CFR 115.60 - Procedures for handling applications for bridge construction permits. (United States)


    ... applications for bridge construction permits. 115.60 Section 115.60 Navigation and Navigable Waters COAST GUARD... Procedures for handling applications for bridge construction permits. The following procedures will be..., the District Commander verifies the authority for construction of the bridge, reviews, the application...

  7. 46 CFR 115.650 - Alternative Hull Examination (AHE) Program options: Divers or underwater ROV. (United States)


    ...: Divers or underwater ROV. 115.650 Section 115.650 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Alternative Hull Examination (AHE) Program options: Divers or underwater ROV. To complete your underwater survey, you may use divers or an underwater remotely operated vehicle (ROV). (a) If you use divers to...

  8. 19 CFR 115.18 - Decision of Commissioner of Customs final. (United States)



  9. Some investigations and use of LR-115 track detectors for radon measurements

    CERN Document Server

    Amrani, D


    Closed passive integrating radon dosimeters based on the use of cellulose nitrate (LR-115 type II) have been developed for assessment of long term radon exposure. This paper presents and comments the results of investigations, of registration efficiency, calibration factors, linearity tests and lower limit of detection for LR-115 detectors from different batches.

  10. 40 CFR 91.115 - Certification procedure-determining engine power and engine families. (United States)


    ... engine power and engine families. 91.115 Section 91.115 Protection of Environment ENVIRONMENTAL... engine power and engine families. (a) Engine power must be calculated using SAE J1228. This procedure has... engine families as specified by paragraph (c) of this section, comprised of engines expected to have...

  11. 41 CFR 115-1.103-50 - Temporary-type changes to EPPMR. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Temporary-type changes to EPPMR. 115-1.103-50 Section 115-1.103-50 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation...

  12. 41 CFR 115-1.108 - Agency implementation and supplementation of FPMR. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Agency implementation and supplementation of FPMR. 115-1.108 Section 115-1.108 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION...

  13. Ultra-low carrier concentration and surface-dominant transport in antimony-doped Bi2Se3 topological insulator nanoribbons

    KAUST Repository

    Hong, Seung Sae


    A topological insulator is the state of quantum matter possessing gapless spin-locking surface states across the bulk band gap, which has created new opportunities from novel electronics to energy conversion. However, the large concentration of bulk residual carriers has been a major challenge for revealing the property of the topological surface state by electron transport measurements. Here we report the surface-state-dominant transport in antimony-doped, zinc oxide-encapsulated Bi2Se3 nanoribbons with suppressed bulk electron concentration. In the nanoribbon with sub-10-nm thickness protected by a zinc oxide layer, we position the Fermi levels of the top and bottom surfaces near the Dirac point by electrostatic gating, achieving extremely low two-dimensional carrier concentration of 2×10 11cm-2. The zinc oxide-capped, antimony-doped Bi 2Se3 nanostructures provide an attractive materials platform to study fundamental physics in topological insulators, as well as future applications. © 2012 Macmillan Publishers Limited. All rights reserved.

  14. Comparative acute toxicity of gallium(III, antimony(III, indium(III, cadmium(II, and copper(II on freshwater swamp shrimp (Macrobrachium nipponense

    Directory of Open Access Journals (Sweden)

    Jen-Lee Yang


    Full Text Available BACKGROUND: Acute toxicity testing were carried out the freshwater swamp shrimp, Macrobrachium nipponense, as the model animal for the semiconductor applied metals (gallium, antimony, indium, cadmium, and copper to evaluate if the species is an suitable experimental animal of pollution in aquatic ecosystem. RESULTS: The static renewal test method of acute lethal concentrations determination was used, and water temperature was maintained at 24.0 ± 0.5°C. Data of individual metal obtained from acute toxicity tests were determined using probit analysis method. The median lethal concentration (96-h LC50 of gallium, antimony, indium, cadmium, and copper for M. nipponense were estimated as 2.7742, 1.9626, 6.8938, 0.0539, and 0.0313 mg/L, respectively. CONCLUSIONS: Comparing the toxicity tolerance of M. nipponense with other species which exposed to these metals, it is obviously that the M. nipponense is more sensitive than that of various other aquatic animals.

  15. Impact of temperature and storage time on the migration of antimony from polyethylene terephthalate (PET) containers into bottled water in Qatar. (United States)

    Al-Otoum, Fatima; Al-Ghouti, Mohammad A; Costa, Ozeas S; Khraisheh, Majeda


    Prosperity in Qatar and the consequent stresses on water resources resulted in a sustainable increase in the bottled drinking water market. Reports on health concerns and possible migration of chemicals from the plastic material into the water have driven the current investigation. This study aims to address the extent of antimony (Sb) leaching from polyethylene terephthalate (PET) water bottles subject to temperature variations (24-50 °C) due to Qatar's hot climate and improper storage conditions. A representative basket including 66 different imported and locally produced water bottles was considered. The concentrations of Sb in bottled water ranged from 0.168 to 2.263 μg/L at 24 °C and from 0.240 to 6.110 μg/L at 50 °C. Antimony concentrations in PET bottles at 24 °C was significantly lower than those at 50 °C (p = 0.0142), indicating that the temperature was a principal factor affecting the release of Sb from the plastic into the water. Although the detected Sb amounts were below the guidelines endorsed by WHO and Qatar (standard 5 μg/L) at 24 °C, the concentration measured at 50 °C was higher than the recommended WHO values (6.11 μg/L).

  16. Oral bioavailability of arsenic, antimony and a selection of metals in ashes; Oral biotillgaenglighet av arsenik, antimon och ett urval av metaller i askor

    Energy Technology Data Exchange (ETDEWEB)

    Carlsson, Christel; Bendz, David; Jones, Celia


    In an earlier study, financed by Varmeforsk, 'Q4-238 Environmental guidelines for reuse of ash in civil engineering applications', the total content of arsenic and lead was shown to determine whether or not reuse of some of the ashes in construction work is feasible. The model used to calculate the guidelines uses the total concentration of metals to evaluate the health risks resulting from exposure to the ashes. The use of total concentration can lead to overly conservative risk assessments if a significant fraction of the total metal content is not bioavailable. Better precision in the risk assessment can be given by the use of the bioavailable fraction of arsenic and lead in the model. As a result, ashes which are rejected on the basis of total metal concentration may be acceptable for use in engineering construction when the assessment is based on the bioavailable fraction. The purpose of the study was to (i) compile information on the oral bioavailability of arsenic, antimony and a selection of metals in ashes and similar materials, and on in vitro methods for determination of oral bioavailability, and (ii) experimentally estimate oral bioavailability of arsenic, antimony and some metals in a selection of ashes by analysis of the gastrointestinal bioaccessibility of these elements. The investigated elements were antimony, arsenic, lead, cadmium, copper, chromium, nickel and zinc. In the literature study performed within the project a number of static and dynamic in vitro methods simulating gastrointestinal processes of contaminants were compiled. The methods include one or several segments, i.e. mouth, stomach and intestine. Among the compiled methods, the RIVM (Rijksinstituut voor volksgesundheid en milieu) in vitro method was used in the experimental part of the project. The advantages with the method was that: the method to a high degree mimicked the human gastrointestinal processes (the method included three segments mouth, stomach, and intestine

  17. New antimony(III) halide complexes with dithiocarbamate ligands derived from thiuram degradation: The effect of the molecule's close contacts on in vitro cytotoxic activity

    Energy Technology Data Exchange (ETDEWEB)

    Urgut, O.S. [Department of Chemistry, Namık Kemal University, 59030, Tekirdag (Turkey); Ozturk, I.I., E-mail: [Department of Chemistry, Namık Kemal University, 59030, Tekirdag (Turkey); Banti, C.N., E-mail: [Section of Inorganic and Analytical Chemistry, Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Kourkoumelis, N., E-mail: [Medical Physics Laboratory, Medical School, University of Ioannina, Ioannina, 45110 (Greece); Manoli, M.; Tasiopoulos, A.J. [Department of Chemistry, University of Cyprus, Nicosia (Cyprus); Hadjikakou, S.K., E-mail: [Section of Inorganic and Analytical Chemistry, Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)


    ABSTRACT: Antimony(III) halide complexes of the formulae {[SbBr(Me_2DTC)_2]_n} (1), {[SbI(Me_2DTC)_2]_n} (2) and {[(Me_2DTC)_2Sb(μ_2-I)Sb(Me_2DTC)_2]"+.I_3"−} (3) (Me{sub 2}DTC = dimethyldithiocarbomate) were synthesized from SbX{sub 3}, (X = Br or I) and tetramethylthiuram monosulfide (Me{sub 4}tms) or tetramethylthiuram disulfide (Me{sub 4}tds). The complexes were characterized by melting point (m.p.), elemental analysis (e.a.), Fourier-transform Infra-Red (FT-IR), Fourier-transform Raman (FT-Raman), Nuclear Magnetic Resonance ({sup 1}H,{sup 13}C-NMR) spectroscopy and Thermogravimetric-Differential Thermal Analysis (TG-DTA). Crystal structures of complexes 1–3 were determined with single crystal X-ray diffraction analysis. Complexes 1 and 2 are polymers with distorted square pyramidal (SP) geometry in each monomeric unit, whereas complex 3 is ionic, containing an iodonium linkage Sb–I{sup +}–Sb and an I{sub 3}{sup −} counter anion; to the best of our knowledge, this is the first ionic antimony(III) iodide complex. The in vitro cytotoxic activity of 1–3 against human adenocarcinoma cells: breast (MCF-7) and cervix (HeLa) cells and non-cancerous cells: MRC-5 (normal human fetal lung fibroblast cells) was evaluated with trypan blue (TB) and sulforhodamine B (SRB) assays. Among antimony(III) compounds with sulfur containing ligand, those of dithiocarbamates exhibit significant cytotoxic activity. Hirshfeld surface volumes were analyzed to clarify the nature of the intermolecular interactions by the 2D fingerprint plot. Molecules with lower H-all atoms inter-molecular interactions exhibit the higher activity against MCF-7 cells. The in vivo genotoxicity of 1–3 was evaluated by the mean of Allium cepa test. Alterations in the mitotic index values due to the chromosomal aberrations were observed in the case of complexes 2 and 3. Since, no such alteration is caused by 1, it makes this compound candidate for further study as potential drug. - Graphical

  18. An evaluation of the migration of antimony from polyethylene terephthalate (PET) plastic used for bottled drinking water

    International Nuclear Information System (INIS)

    Chapa-Martínez, C.A.; Hinojosa-Reyes, L.; Hernández-Ramírez, A.; Ruiz-Ruiz, E.; Maya-Treviño, L.; Guzmán-Mar, J.L.


    The leaching of antimony (Sb) from polyethylene terephthalate (PET) bottling material was assessed in twelve brands of bottled water purchased in Mexican supermarkets by atomic fluorescence spectrometry with a hydride generation system (HG-AFS). Dowex® 1X8-100 ion-exchange resin was used to preconcentrate trace amounts of Sb in water samples. Migration experiments from the PET bottle material were performed in water according to the following storage conditions: 1) temperature (25 and 75 °C), 2) pH (3 and 7) and 3) exposure time (5 and 15 days), using ultrapure water as a simulant for liquid foods. The test conditions were studied by a 2 3 factorial experimental design. The Sb concentration measured in the PET packaging materials varied between 73.0 and 111.3 mg/kg. The Sb concentration (0.28–2.30 μg/L) in all of the PET bottled drinking water samples examined at the initial stage of the study was below the maximum contaminant level of 5 μg/L prescribed by European Union (EU) regulations. The parameters studied (pH, temperature, and storage time) significantly affected the release of Sb, with temperature having the highest positive significant effect within the studied experimental domain. The highest Sb concentration leached from PET containers was in water samples at pH 7 stored at 75 °C for a period of 5 days. The extent of Sb leaching from the PET ingredients for different brands of drinking water can differ by as much as one order of magnitude in experiments conducted under the worst-case conditions. The chronic daily intake (CDI) caused by the release of Sb in one brand exceeded the Environmental Protection Agency (USEPA) regulated CDI value of 400 ng/kg/day, with values of 514.3 and 566.2 ng/kg/day for adults and children. Thus, the appropriate selection of the polymer used for the production of PET bottles seems to ensure low Sb levels in water samples. - Highlights: • The PET safety due to the release of Sb was evaluated in Mexican water PET

  19. An evaluation of the migration of antimony from polyethylene terephthalate (PET) plastic used for bottled drinking water

    Energy Technology Data Exchange (ETDEWEB)

    Chapa-Martínez, C.A.; Hinojosa-Reyes, L.; Hernández-Ramírez, A.; Ruiz-Ruiz, E.; Maya-Treviño, L.; Guzmán-Mar, J.L., E-mail:


    The leaching of antimony (Sb) from polyethylene terephthalate (PET) bottling material was assessed in twelve brands of bottled water purchased in Mexican supermarkets by atomic fluorescence spectrometry with a hydride generation system (HG-AFS). Dowex® 1X8-100 ion-exchange resin was used to preconcentrate trace amounts of Sb in water samples. Migration experiments from the PET bottle material were performed in water according to the following storage conditions: 1) temperature (25 and 75 °C), 2) pH (3 and 7) and 3) exposure time (5 and 15 days), using ultrapure water as a simulant for liquid foods. The test conditions were studied by a 2{sup 3} factorial experimental design. The Sb concentration measured in the PET packaging materials varied between 73.0 and 111.3 mg/kg. The Sb concentration (0.28–2.30 μg/L) in all of the PET bottled drinking water samples examined at the initial stage of the study was below the maximum contaminant level of 5 μg/L prescribed by European Union (EU) regulations. The parameters studied (pH, temperature, and storage time) significantly affected the release of Sb, with temperature having the highest positive significant effect within the studied experimental domain. The highest Sb concentration leached from PET containers was in water samples at pH 7 stored at 75 °C for a period of 5 days. The extent of Sb leaching from the PET ingredients for different brands of drinking water can differ by as much as one order of magnitude in experiments conducted under the worst-case conditions. The chronic daily intake (CDI) caused by the release of Sb in one brand exceeded the Environmental Protection Agency (USEPA) regulated CDI value of 400 ng/kg/day, with values of 514.3 and 566.2 ng/kg/day for adults and children. Thus, the appropriate selection of the polymer used for the production of PET bottles seems to ensure low Sb levels in water samples. - Highlights: • The PET safety due to the release of Sb was evaluated in Mexican water PET

  20. Investor's and procurement guide South Africa. Pt. 1. Heavy minerals, rare earth elements, antimony

    Energy Technology Data Exchange (ETDEWEB)

    Graupner, Torsten; Schwarz-Schampera, Ulrich [Bundesanstalt fuer Geowissenschaften und Rohstoffe (BGR), Berlin (Germany); Hammond, Napoleon Q.; Opperman, Rehan; Long' a Tongu, Elisa; Kenan, Abdul O.; Nondula, Unathi; Tsanwani, Matamba [Council for Geoscience (CGS), Pretoria (South Africa). Dept. of Mineral Resources Development; Liedke, Maren; Marbler, Herwig [Bundesanstalt fuer Geowissenschaften und Rohstoffe (BGR), Berlin (Germany). Deutsche Rohstoffagentur (DERA)


    This is the first part of the ''Investor's and Procurement Guide South Africa'', a handbook for investing and doing business in South Africa's mineral industry. It is anticipated that this publication will aid potential investors into considering South Africa as an investment destination, not only for raw materials, but also for related industries. This manual supplements the many publications available on the economic geology and mineral wealth in South Africa and has been designed to guide prospective and current investors, suppliers and mine equipment exporters through the process of doing business in Africa's biggest and dynamic economy. As well as detailing the mineral raw materials heavy minerals, rare-earth metals and antimony, the handbook provides a general introduction to South Africa and its infrastructure, the economical, political and judicial frame of the South African mining industry and an overview of the economic geology. South Africa has a long and complex geological history which dates back in excess of 3.6 billion years. The country has a vast mineral wealth, undoubtedly due to the fact that a significant proportion of the Archaean and younger rocks have been preserved. The mining of the enormous Witwatersrand gold deposits, commencing in 1886, has led to the establishment of South Africa's well-developed infrastructure and to the sustained growth of an industrial and service sector in the country. With the world's largest resources of PGMs, gold, chromite, vanadium and manganese and significant resources of iron, coal and numerous other minerals and metals, the minerals industry will continue to play a pivotal role in the growth of South Africa's economy in the foreseeable future. South Africa is one of the top destinations in Africa for foreign direct investments. South African headquartered companies have been major investors into foreign direct investments on the African continent in the past

  1. Dressings combined with injection of meglumine antimoniate in the treatment of cutaneous leishmaniasis: a randomized controlled clinical trial.

    Directory of Open Access Journals (Sweden)

    Alireza Khatami

    Full Text Available BACKGROUND: Cutaneous leishmaniasis (CL is a neglected infectious disease and a major health problem in several developing countries. Despite some reasonable explanation for their potential benefits, there is only trace evidence regarding the role of dressings in the treatment of CL. METHODS: This randomized, assessor-blind, controlled, clinical trial was conducted in an endemic area for CL caused by Leishmania major in Iran to assess the efficacy of administration of weekly intralesional meglumine antimoniate (i.l.MA either alone or combined with application of a silver or a non-silver polyester dressing on their lesions for 6 weeks. After screening of 241 patients with CL lesions, 83 eligible patients with 158 lesions were randomly allocated in three arms of the study. Eligibility criteria included parasitologically confirmed CL, age of 12 to 60 years; willingness to participate, duration of lesion<3 months, number of lesions<5, largest ulcer diameter<5 cm. Pregnant or lactating women were excluded. The primary outcome was absolute risk reduction (ARR based on the proportion of complete healing, which was defined as more than 75% reduction in the size of the lesion compared with baseline in each group at the termination of treatment and 1 month later. FINDINGS: ARR (95% Confidence Interval [CI] in i.l.MA versus i.l.MA+non-silver dressing groups was 5.98% (-7.07% to 20.25%, between i.l.MA versus i.l.MA+silver dressing groups was -0.23% (-13.53% to 14.82%, and between i.l.MA+non-silver dressing versus i.l.MA+silver dressing groups was -6.21%(-18.28% to 6.52% after 6 weeks of treatment. ARR (95% CI in i.l.MA versus i.l.MA+non-silver dressing groups was -2.22% (-22.12% to 18.10%, between i.l.MA versus i.l.MA+silver dressing groups was 3.64% (-15.36% to 22.82%, and between i.l.MA+non-silver dressing versus i.l.MA+silver dressing groups was 5.86% (-12.86% to 24.31% 1 month later. CONCLUSION: It could not be demonstrated that the efficacy of i

  2. Coupled S and Sr isotope evidences for elevated arsenic concentrations in groundwater from the world's largest antimony mine, Central China (United States)

    Wen, Bing; Zhou, Aiguo; Zhou, Jianwei; Liu, Cunfu; Huang, Yuliu; Li, Ligang


    The Xikuangshan(XKS) mine, the world's largest antimony mine, was chosen for a detailed arsenic hydrogeochemical study because of the elevated arsenic in bedrock aquifers used by local residents. Hydrochemical data, δ34S values of dissolved SO42- and 87Sr/86Sr ratios have been analyzed to identify the predominant geochemical processes that control the arsenic mobilization within the aquifers. Groundwater samples can be divided into three major types: low arsenic groundwater (0-50 μg/L), high arsenic groundwater (50-1000 μg/L) and anomalous high arsenic groundwater (>1000 μg/L). Arsenic occurs under oxidizing conditions at the XKS Sb mine as the HAsO42- anion. The Ca/Na ratio correlates significantly with HCO3-/Na and Sr/Na ratios, indicating that carbonate dissolution and silicate weathering are the dominant processes controlling groundwater hydrochemistry. The δ34S values of the groundwater indicate that dissolved SO42- in groundwater is mainly sourced from the oxidation of sulfide minerals, and elevated As concentrations in groundwater are influenced by the mixing of mine water and surface water. Furthermore, the δ34S values are not correlated with dissolved As concentrations and Fe concentrations, suggesting that the reduction dissolution of Fe(III) hydroxides is not the dominant process controlling As mobilization. The 87Sr/86Sr ratios imply that elevated As concentrations in groundwater are primarily derived from the interaction with the stibnite and silicified limestone. More specifically, the excess-Na ion, the feature of Ca/Na ratio, and the spatial association of elevated As concentrations in groundwater collectively suggest that high and anomalous high arsenic groundwater are associated with smelting slags and, in particular, the arsenic alkali residue. In general, the hydrochemistry analysis, especially the S and Sr isotope evidences elucidate that elevated As concentrations and As mobilization are influenced by several geochemical processes

  3. Selective extraction of traffic-related antimony compounds for speciation analysis by graphite furnace atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Zih-Perenyi, K., E-mail: perkat@freestart.h [L. Eoetvoes University, Institute of Chemistry, H-1518 Budapest 112, P.O. Box 32. (Hungary); Neurohr, K., E-mail: [L. Eoetvoes University, Institute of Chemistry, H-1518 Budapest 112, P.O. Box 32. (Hungary); Nagy, G. [Semmelweis University, Faculty of Pharmacy, H-1085 Budapest, Ulloi Str. 26. (Hungary); Balla, M., E-mail: balla@reakt.bme.h [Budapest University of Technology and Economics, Institute of Nuclear Techniques, H-1111 Budapest, Muegyetem rakpart 9 (Hungary); Lasztity, A., E-mail: [L. Eoetvoes University, Institute of Chemistry, H-1518 Budapest 112, P.O. Box 32. (Hungary)


    Most traffic-related antimony air pollutants are derived from brake dust. Brake dust contains Sb{sub 2}S{sub 3}, used as a friction material in brake pads, and its high-temperature oxidation products, Sb{sub 2}O{sub 3} or Sb{sub 2}O{sub 4}. Systematic investigations were carried out to find the most selective leaching conditions for these substances. First, solubility experiments of the pure potential compounds mentioned above were carried out. Then, the leaching of these compounds from home-made artificial dusts previously spiked with these compounds at the trace level was investigated. A 0.5 mol L{sup -1} citric acid solution proved to leach the whole Sb{sub 2}O{sub 3} content while extracting less than 10% Sb{sub 2}S{sub 3} and no Sb{sub 2}O{sub 4} at all. It was found that Sb{sub 2}O{sub 3} and Sb{sub 2}S{sub 3} traces were soluble in a 6 mol L{sup -1} HCl solution, quantitatively and selectively. Graphite furnace atomic absorption spectrometry and hydride generation graphite furnace atomic absorption spectrometry methods were developed to determine the Sb content of the extracts. The proposed method proved to be applicable to settled dust containing traffic-related Sb compounds. The detection limits were 1.2 and 0.3 {mu}g g{sup -1} for leaching by citric acid and HCl solution, respectively, which were adequate for Sb content determination in the urban dust studied. The reproducibility of the method expressed as relative standard deviation was about 7%. The results showed that the concentration of leachable Sb was 40 {mu}g g{sup -1} in the settled dust of Budapest, about half of which corresponded to Sb{sub 2}O{sub 3}. The Sb{sub 2}O{sub 4} content calculated as the difference of total and leachable fraction was about 10% with high uncertainty.

  4. Investor's and procurement guide South Africa. Pt. 1. Heavy minerals, rare earth elements, antimony

    International Nuclear Information System (INIS)

    Graupner, Torsten; Schwarz-Schampera, Ulrich; Hammond, Napoleon Q.; Opperman, Rehan; Long'a Tongu, Elisa; Kenan, Abdul O.; Nondula, Unathi; Tsanwani, Matamba


    This is the first part of the ''Investor's and Procurement Guide South Africa'', a handbook for investing and doing business in South Africa's mineral industry. It is anticipated that this publication will aid potential investors into considering South Africa as an investment destination, not only for raw materials, but also for related industries. This manual supplements the many publications available on the economic geology and mineral wealth in South Africa and has been designed to guide prospective and current investors, suppliers and mine equipment exporters through the process of doing business in Africa's biggest and dynamic economy. As well as detailing the mineral raw materials heavy minerals, rare-earth metals and antimony, the handbook provides a general introduction to South Africa and its infrastructure, the economical, political and judicial frame of the South African mining industry and an overview of the economic geology. South Africa has a long and complex geological history which dates back in excess of 3.6 billion years. The country has a vast mineral wealth, undoubtedly due to the fact that a significant proportion of the Archaean and younger rocks have been preserved. The mining of the enormous Witwatersrand gold deposits, commencing in 1886, has led to the establishment of South Africa's well-developed infrastructure and to the sustained growth of an industrial and service sector in the country. With the world's largest resources of PGMs, gold, chromite, vanadium and manganese and significant resources of iron, coal and numerous other minerals and metals, the minerals industry will continue to play a pivotal role in the growth of South Africa's economy in the foreseeable future. South Africa is one of the top destinations in Africa for foreign direct investments. South African headquartered companies have been major investors into foreign direct investments on the African continent in the past

  5. Arsenic and Antimony Removal from Drinking Water by Point-of-Entry Reverse Osmosis Coupled with Dual Plumbing Distribution - U.S. EPA Demonstration Project at Carmel Elementary School in Carmel, ME -Final Performance Evaluation Report (United States)

    This report documents the activities performed for and the results obtained from the arsenic and antimony removal treatment technology demonstration project at the Carmel Elementary School (CES) in Carmel, ME. An innovative approach of employing point of entry (POE) reverse osmo...

  6. Anatomy of a Merger: A Deep Chandra Observation of Abell 115 (United States)

    Forman, William R.


    A deep Chandra observation of Abell 115 provides a unique probe of the anatomy of cluster mergers. The X-ray image shows two prominent subclusters, A115N (north) and A115S (south) with a projected separation of almost 1 Mpc. The X-ray subclusters each have ram-pressure stripped tails that unambiguously indicate the directions of motion. The central BCG of A115N hosts the radio source 3C28 which shows a pair of jets, almost perpendicular to the direction of the sucluster's motion. The jets terminate in lobes each of which has a "tail" pointing IN the direction of motion of the subcluster. The Chandra analysis provides details of the merger including the velocities of the subclusters both through analysis of the cold front and a weak shock. The motion of A115N through the cluster generates counter-rotating vortices in the subcluster gas that form the two radio tails. Hydrodynamic modeling yields circulation velocities within the A115N sub cluster. Thus, the radio emitting plasma acts as a dye tracing the motions of the X-ray emitting plasma. A115S shows two "cores", one coincident with the BCG and a second appears as a ram pressure stripped tail.

  7. 34 CFR 403.115 - What appeal procedures must be established under the Secondary School Vocational Education Program? (United States)


    ... Secondary School Vocational Education Program? 403.115 Section 403.115 Education Regulations of the Offices... EDUCATION STATE VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION PROGRAM What Kinds of Activities Does the... § 403.115 What appeal procedures must be established under the Secondary School Vocational Education...

  8. 78 FR 5840 - Notice of License Termination for University of Illinois Advanced TRIGA Reactor, License No. R-115 (United States)


    ... University of Illinois Advanced TRIGA Reactor, License No. R-115 The U.S. Nuclear Regulatory Commission (NRC) is noticing the termination of Facility Operating License No. R-115, for the University of Illinois... Operating License No. R-115 is terminated. The above referenced documents may be examined, and/or copied for...

  9. Nimbus-5/THIR Level 1 Brightness Temperature at 11.5 microns V001 (United States)

    National Aeronautics and Space Administration — The Nimbus-5 Temperature-Humidity Infrared Radiometer (THIR) Level 1 Brightness Temperature at 11.5 microns data product contains radiances expressed in units of...

  10. Nimbus-6/THIR Level 1 Brightness Temperature at 11.5 microns V001 (United States)

    National Aeronautics and Space Administration — The Nimbus-6 Temperature-Humidity Infrared Radiometer (THIR) Level 1 Brightness Temperature at 11.5 microns data product contains radiances expressed in units of...

  11. 36 CFR 1212.115 - Does this part affect the Federal contracts that I receive? (United States)



  12. 46 CFR 52.01-115 - Feedwater supply (modifies PG-61). (United States)


    ... BOILERS General Requirements § 52.01-115 Feedwater supply (modifies PG-61). Boiler feedwater supply must meet the requirements of PG-61 of section I of the ASME Boiler and Pressure Vessel Code (incorporated...

  13. Unusual armadillo fold in the human general vesicular transport factor p115.

    Directory of Open Access Journals (Sweden)

    Harald Striegl

    Full Text Available The golgin family gives identity and structure to the Golgi apparatus and is part of a complex protein network at the Golgi membrane. The golgin p115 is targeted by the GTPase Rab1a, contains a large globular head region and a long region of coiled-coil which forms an extended rod-like structure. p115 serves as vesicle tethering factor and plays an important role at different steps of vesicular transport. Here we present the 2.2 A-resolution X-ray structure of the globular head region of p115. The structure exhibits an armadillo fold that is decorated by elongated loops and carries a C-terminal non-canonical repeat. This terminal repeat folds into the armadillo superhelical groove and allows homodimeric association with important implications for p115 mediated multiple protein interactions and tethering.

  14. The calibration of the solid state nuclear track detector LR 115 for radon measurements

    CERN Document Server

    Gericke, C; Jönsson, G; Freyer, K; Treutler, H C; Enge, W


    An experimental calibration of indoor room and outdoor soil detector devices which are based on LR 115 as sensitive element has taken place at the Swedish Radiation Protection Institute in Stockholm (Sweden) in 1994 and 1996, at the Physikalisch-Technischen Bundesanstalt in Braunschweig (Germany) in 1997 and at the Umweltforschungszentrum Leipzig-Halle (Germany) in 1997. Special properties of the used solid state nuclear track detector (SSNTD) material LR 115 have been measured to define the application of the experimental calibration.

  15. Structural and optical properties of antimony-germanate-borate glass and glass fiber co-doped Eu3+ and Ag nanoparticles. (United States)

    Zmojda, Jacek; Kochanowicz, Marcin; Miluski, Piotr; Baranowska, Agata; Pisarski, Wojciech A; Pisarska, Joanna; Jadach, Renata; Sitarz, Maciej; Dorosz, Dominik


    In the paper analysis of structural and luminescent properties of antimony-germanate-borate glasses and glass fiber co-doped with 0.6AgNO 3 /0.2Eu 2 O 3 are presented. Heat treatment of the fabricated glass and optical fiber (400 °C, 12 h) enabled to obtain Ag nanoparticles (NPs) with average size 30-50 nm on their surface. It has been proofed that silver ions migrate to the glass surface, where they are reduced to Ag 0 nanoparticles. Simultaneously, FTIR analysis showed that heat treatment of the glass and optical fiber increases the local symmetry of the Eu 3+ site. Copyright © 2018. Published by Elsevier B.V.

  16. The influence of Ag content and annealing time on structural and optical properties of SGS antimony-germanate glass doped with Er3+ ions (United States)

    Zmojda, J.; Kochanowicz, M.; Miluski, P.; Baranowska, A.; Basa, A.; Jadach, R.; Sitarz, M.; Dorosz, D.


    A series of erbium doped SGS antimony-germanate glass embedding silver (Ag0) nanoparticles have been synthesized by a one-step melt-quench thermochemical reduction technique. The effect of NPs concentration and annealing time on the structural and photoluminescent (PL) properties were investigated. The Raman spectra as a function of temperature measured in-situ allow to determine the structural changes in vicinity of Ag+ ions and confirmed thermochemical reduction of Ag+ ions by Sb3+ ions. The surface plasmon resonance absorption band was evidenced near 450 nm. The impact of local field effect generated by Ag0 nanoparticles (NPs) and energy transfer from surface of silver NPs to trivalent erbium ions on near-infrared and up-conversion luminescence was described in terms of enhancement and quench phenomena.

  17. Influence of mycorhization and soil organic matters on lead and antimony transfers to vegetables cultivated in urban gardens: environmental and sanitary consequences (United States)

    Pierart, Antoine; Braud, Armelle; Lebeau, Thierry; Séjalon-Delmas, Nathalie; Dumat, Camille


    The European Environment Agency estimates that c.a. 250 000 sites required clean up and that about 100 000 ha could have been contaminated by metals in Europe. Numerous remediation techniques have been therefore tested and phytoremediation appears as a sustainable and low cost in situ technique particularly for large-scale remediation of polluted arable soils. Arbuscular Mycorrhizal Fungi (AMF) are already used in phytoextraction or phytostabilisation of many metal(loid)s (GU ET AL., 2013, SHARMA AND SHARMA, 2013). However, while plant inoculation with AMF will mostly result of an increase of the plant biomass, the response for lead accumulation in shoots is contrasted (LEBEAU ET AL., 2008). Furthermore, nothing is actually known for Sb transfer to plants phytoremediation-assisted AMF. Yet recently, many researches concern the accumulation of Sb in the environment, its (eco)toxicity and the risk of bioaccumulation in vegetables (FENG ET AL., 2013), especially in some China areas where Sb mining activities have widely contaminated arable lands (WU ET AL., 2011). Our research project, which is part of a national program for urban gardens (JASSUR,, focused on polluted soils in associative urban gardens with both geogenic and anthropogenic origins for Pb and Sb. The impact of Pb and Sb on AMF density and diversity was studied using morphological and biomolecular approaches. The role of AMF symbiosis with Lettuce (Lactuca sativa L.) on Pb and Sb compartmentalization, speciation and phytoavailability was investigated. The influence of soil organic matters on these processes was examined. Eventually, the part of metal(loid)s available for humans in case of ingestion of lettuces unfit for human consumption (FOUCAULT ET AL., 2013; XIONG ET AL., 2013) will be assessed in relation with the influence of AMF symbiosis and organic matter. Key Words: Mycorrhiza, Antimony, Compartmentation, Speciation, Edible Plants, Urban Agriculture

  18. Post-CMOS FinFET integration of bismuth telluride and antimony telluride thin-film-based thermoelectric devices on SoI substrate

    KAUST Repository

    Aktakka, Ethem Erkan


    This letter reports, for the first time, heterogeneous integration of bismuth telluride (Bi2Te3) and antimony telluride (Sb 2Te3) thin-film-based thermoelectric ffect transistors) via a characterized TE-film coevaporationand shadow-mask patterning process using predeposition surface treatment methods for reduced TE-metal contact resistance. As a demonstration vehicle, a 2 × 2 mm2-sized integrated planar thermoelectric generator (TEG) is shown to harvest 0.7 μ W from 21-K temperature gradient. Transistor performance showed no significant change upon post-CMOS TEG integration, indicating, for the first time, the CMOS compatibility of the Bi2Te3 and Sb2Te3 thin films, which could be leveraged for realization of high-performance integrated micro-TE harvesters and coolers. © 2013 IEEE.

  19. Progress report on neutron beam experiments in Thailand: effects of antimony substitutions on the critical temperature of Bi-Pb-Sr-Ca-Cu-O compounds

    Energy Technology Data Exchange (ETDEWEB)

    Sangariyavanich, A.; Ampornrat, P. [Office of Atomic Energy for Peace, Bangkok (Thailand)


    Effects of systematic substitutions of antimony for bismuth in Bi{sub 1.8-x}Pb{sub 0.2}Sb{sub x}Sr{sub 2}Ca{sub 3}Cu{sub 4}O{sub 10} have been investigated. Fabrication of the specimens has been performed by solid state reaction in air. The samples were sintered between 820degC - 843degC for 65 hours and subsequently quenched in liquid nitrogen. The critical temperatures of most specimens as determined by standard four-probe technique was higher than 100 K. Phase identification by X-ray diffraction technique indicated that `2223` and `2234` were the predominant phases in these samples. (author)

  20. Investigation of strontium and uranium sorption onto zirconium-antimony oxide/polyacrylonitrile (Zr-Sb oxide/PAN) composite using experimental design. (United States)

    Cakir, Pelin; Inan, Suleyman; Altas, Yuksel


    A study on the sorption of strontium (Sr(2+)) and uranium (UO2(2+)) onto zirconium-antimony oxide/PAN (Zr-Sb oxide/PAN) composite was conducted. The zirconium-antimony oxide was synthesized and was then turned into composite spheres by mixing it with polyacrylonitrile (PAN). The single and combined effects of independent variables such as initial pH, temperature, initial ion concentration and contact time on the sorption of Sr(2+) and UO2(2+) were separately analyzed using response surface methodology (RSM). Central composite design (CCD) was separately employed for Sr(2+) and UO2(2+) sorption. Analysis of variance (ANOVA) revealed that all of the single effects found statistically significant on the sorption of Sr(2+) and UO2(2+). Probability F-values (F=2.45 × 10(-08) and F=9.63 × 10(-12) for Sr(2+) and UO2(2+), respectively) and correlation coefficients (R(2)=0.96 for Sr(2+) and R(2)=0.98 for UO2(2+)) indicate that both models fit the experimental data well. At optimum sorption conditions Sr(2+) and UO2(2+) sorption capacities of the composite were found as 39.78 and 60.66 mg/g, respectively. Sorption isotherm data pointed out that Langmuir model is more suitable for the Sr(2+) sorption, whereas the sorption of UO2(2+) was correlated well with the Langmuir and Freundlich models. Thermodynamic parameters such as ΔH°, ΔS° and ΔG° indicate that Sr(2+) and UO2(2+) sorption processes are endothermic and spontaneous. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. The occurrence and distribution of high-arsenic, selenium, tin and antimony in bottom sediments of Burullus lagoon and its effects on human health, Egypt (United States)

    El-Badry, Abd El-Monsef Ahmed; Khalifa, Moataz M.


    Burullus lagoon is one of four natural water bodies known as northern Egyptian delta lakes. The lagoon extended maximum long of 53 km long and maximum width 13 km with an area about 420 km2. The pollution of bottom sediment of the Burullus lagoon is indicative of both water and food web quality in general. A few research were carried out related to study of arsenic, selenium, tin and antimony. The main objective of this study is assessment of environmental effects of arsenic, selenium, tin and antimony metals, twenty-one samples were collect from bottom sediments sample among sites covering the Burullus Lagoon during summer 2014, and analyzed by using simultaneous inductively coupled plasma emission spectrometer. The contamination with these metals was evaluate by applying index of contamination factor (CF) and geoaccumulation (Igeo). The relative order of abundance of the potentially toxic metals in the lagoon's sediment is Se > Sn > Sb > As The territory around inlet and southeastern drain show considerable pollution by the studied toxic metals. The main reason for such pollution resulting from industrial activities and agricultural drains. The disregards of the anthropogenic activities are the main reason of pollution in the studied lagoon. Construction of special units for treatment and purification of all types of drainage and wastewater (agricultural, industrial). Successive analysis of lake water to assess the amount of pollutants to make suitable decisions. Take an action to prohibit throwing of wastes in the lagoon. Consumption of the lake water for agricultural and industrial must be under control in order to decrease water pollution.

  2. Post-traumatic avascular necrosis of the femoral head predicted by preoperative technetium-99m antimony-colloid scan: an experimental and clinical study

    International Nuclear Information System (INIS)

    Turner, J.H.


    Technetium-99m antimony colloid was used to visualize the bone marrow of the head of the femur within twenty-four hours after interruption of the blood supply by subcapital osteotomy and section of the ligamentum teres in thirteen rabbits and within twenty-four hours after a subcapital fracture in thirty patients. Of the rabbits, all showed loss of marrow radioactivity over the affected femoral head. Bone-imaging with technetium-99m methylene diphosphonate, in contrast, failed to demonstrate any abnormality in the avascular head of the femur for as long as forty-eight hours after osteotomy. This difference between the marrow scan and the bone scan was attributed to earlier loss of function in the marrow cells than in the osteocytes. The thirty patients who had a preoperative scan within twenty-four hours after sustaining a subcapital fracture were treated by internal fixation with a Richards screw and plate and were followed for as long as two years, or until the patient died or radiographs showed evidence of avascular necrosis. The preoperative technetium-99m antimony-colloid activity in the head of the fractured femur was normal in sixteen patients and absent in fourteen; two of the fourteen had no activity in either hip, which precluded assessment of the fractured hip in these patients. In fifteen of the sixteen hips, preservation of the uptake in the marrow of the head of the fractured femur preoperatively predicted normal healing. Late segmental collapse developed in the remaining hip. In eleven of the twelve patients who had loss of marrow activity in the femoral head preoperatively, avascular necrosis developed within two years

  3. Association of Liposome-Encapsulated Trivalent Antimonial with Ascorbic Acid: An Effective and Safe Strategy in the Treatment of Experimental Visceral Leishmaniasis (United States)

    Castro, Renata A. O.; Silva-Barcellos, Neila M.; Licio, Carolina S. A.; Souza, Janine B.; Souza-Testasicca, Míriam C.; Ferreira, Flávia M.; Batista, Mauricio A.; Silveira-Lemos, Denise; Moura, Sandra L.; Frézard, Frédéric; Rezende, Simone A.


    Background: Visceral leishmaniasis (VL) is a chronic debilitating disease endemic in tropical and subtropical areas, caused by protozoan parasites of the genus Leishmania. Annually, it is estimated the occurrence of 0.2 to 0.4 million new cases of the disease worldwide. Considering the lack of an effective vaccine the afflicted population must rely on both, an accurate diagnosis and successful treatment to combat the disease. Here we propose to evaluate the efficacy of trivalent antimonial encapsulated in conventional liposomes, in association with ascorbic acid, by monitoring its toxicity and efficacy in BALB/c mice infected with Leishmania infantum. Methodology/Principal Findings: Infected mice were subjected to single-dose treatments consisting in the administration of either free or liposome-encapsulated trivalent antimony (SbIII), in association or not with ascorbic acid. Parasite burden was assessed in the liver, spleen and bone marrow using the serial limiting dilution technique. After treatment, tissue alterations were examined by histopathology of liver, heart and kidney and confirmed by serum levels of classic biomarkers. The phenotypic profile of splenocytes was also investigated by flow cytometry. Treatment with liposome-encapsulated SbIII significantly reduced the parasite burden in the liver, spleen and bone marrow. Co-administration of ascorbic acid, with either free SbIII or its liposomal form, did not interfere with its leishmanicidal activity and promoted reduced toxicity particularly to the kidney and liver tissues. Conclusions/Significance: Among the evaluated posological regimens treatment of L. infantum-infected mice with liposomal SbIII, in association with ascorbic acid, represented the best alternative as judged by its high leishmanicidal activity and absence of detectable toxic effects. Of particular importance, reduction of parasite burden in the bone marrow attested to the ability of SbIII-carrying liposomes to efficiently reach this

  4. Benchmarking pKa prediction methods for Lys115 in acetoacetate decarboxylase. (United States)

    Liu, Yuli; Patel, Anand H G; Burger, Steven K; Ayers, Paul W


    Three different pK a prediction methods were used to calculate the pK a of Lys115 in acetoacetate decarboxylase (AADase): the empirical method PROPKA, the multiconformation continuum electrostatics (MCCE) method, and the molecular dynamics/thermodynamic integration (MD/TI) method with implicit solvent. As expected, accurate pK a prediction of Lys115 depends on the protonation patterns of other ionizable groups, especially the nearby Glu76. However, since the prediction methods do not explicitly sample the protonation patterns of nearby residues, this must be done manually. When Glu76 is deprotonated, all three methods give an incorrect pK a value for Lys115. If protonated, Glu76 is used in an MD/TI calculation, the pK a of Lys115 is predicted to be 5.3, which agrees well with the experimental value of 5.9. This result agrees with previous site-directed mutagenesis studies, where the mutation of Glu76 (negative charge when deprotonated) to Gln (neutral) causes no change in K m , suggesting that Glu76 has no effect on the pK a shift of Lys115. Thus, we postulate that the pK a of Glu76 is also shifted so that Glu76 is protonated (neutral) in AADase. Graphical abstract Simulated abundances of protonated species as pH is varied.

  5. Evaluation of the 115In(n,n)/sup 115m/In reaction for the ENDF/B-V dosimetry file

    International Nuclear Information System (INIS)

    Smith, D.L.


    An evaluation of the 115 In(n,n')/sup 115m/In reaction for the ENDF/B-V Dosimetry File is presented. This evaluation is based entirely on reported experimental differential data. Several data sets were renormalized prior to the evaluation in order to take into account recent adjustments in corresponding standard cross sections and in other nuclear parameters used for derivation of cross sections. The present evaluation is compared with the corresponding ENDF/B-IV evaluation. The value of the spectrum-average cross section for the standard neutron field resulting from thermal-neutron fission of 235 U has been computed for this reaction using cross section values from the present evaluation. This computed cross section compares favorably with the result of a recent evaluation of integral data

  6. Successful therapeutic response of resistant cases of mucocutaneous leishmaniasis to a very low dose of antimony Resposta terapêutica bem sucedida de casos resistentes de leishmaniose mucocutânea a doses muito baixas de antimônio

    Directory of Open Access Journals (Sweden)

    Manoel Paes de Oliveira-Neto


    Full Text Available Two mucocutaneous leishmaniasis cases resistant to therapy are reported here. After the failure of initial therapies (antimony, amphotericin B and/or pentamidine patients received a low-dose schedule: one ampoule of meglumine antimoniate (405mg of pentavalent antimony [Sb v] by intramuscular injection, three times a week until complete healing of the lesions. One patient was cured with a total of 30 ampoules in 10 weeks and the other received 36 ampoules in 12 weeks. Both remain clinically cured after one year of follow-up.São relatados dois casos de leishmaniose mucocutânea resistentes ao tratamento. Depois das terapêuticas iniciais (antimônio, anfotericina B e/ou pentamidina, os pacientes receberam um esquema alternativo: uma ampola de antimoniato de meglumina (405mg de antimônio pentavalnte [Sb v] por via intramuscular, três vezes por semana até a cura completa das lesões. Um paciente recebeu um total de 30 ampolas durante 10 semanas e o outro, 36 ampolas durante 12 semanas. Ambos permanecem clinicamente curados até um ano após o tratamento.

  7. Fractionation and redox speciation of antimony in agricultural soils by hydride generation--atomic fluorescence spectrometry and stability of Sb(III) and Sb(V) during extraction with different extractant solutions. (United States)

    Fuentes, Edwar; Pinochet, Hugo; Potin-Gautier, Martine; De Graegori, Ida


    This stability of Sb(III) and Sb(V) species was studied during single extraction from soils by water. EDTA, diluted H2SO4 and H3PO4, and oxalic acid/oxalate solutions, with and without ascorbic acid, were used as stabilizing reagent of both Sb species. Antimony redox speciation in soil extracts was performed by selective hydride generation-atomic fluorescence spectrometry. Simulated extraction procedures (without soil) showed that, except in oxalate medium, Sb(III) was oxidized to Sb(V), and this reaction was avoided with ascorbic acid. Recovery studies from a spiked agricultural soil showed that no oxidation but sorption of Sb(III) occurred during the extraction process in water and H2SO4 medium, and quantitative oxidation in EDTA and oxalate medium. With ascorbic acid, this oxidation was totally avoided in EDTA and partially avoided in oxalate solution. A new sequential extraction procedure was proposed and applied to the fractionation and redox speciation of antimony in agricultural soils, using EDTA + ascorbic acid, pH 7 (available under complexing and moderately reducible conditions); oxalic acid/oxalate + ascorbic acid (extractable in reducible conditions) and HNO3 + HCl + HF (residual fraction). The proposed extraction scheme can provide information about the availability and mobility of antimony redox species in agricultural soils.

  8. A study on antimony determination in environmental samples by neutron activation analysis: validation of the methodology and determination of the uncertainty of the measurement

    International Nuclear Information System (INIS)

    Matsubara, Tassiane Cristina Martins


    Antimony is an element found in low concentrations in the environment. However, its determination has attracted great interest due to the knowledge of its toxicity and increasing application in industry. The determination of antimony has been a challenge for researchers since this element is found in low concentrations which make its analysis a difficult task. Therefore, although neutron activation analysis (NAA) is an appropriate method for the determination of various elements in different types of matrix, in the case of Sb its analysis presents some difficulties, mainly due to spectral interferences. The objective of this research was to validate the NAA method for Sb determination in environmental samples. To establish appropriate conditions for Sb determinations, preliminary assays were carried out for further analysis of certified reference materials (CRM). The experimental procedure was to irradiate samples with a synthetic Sb standard for a period of 8 or 16 hours in the IEA-R1 nuclear research reactor, followed by gamma ray spectrometry. The quantification of Sb was performed by measuring the radioactive isotopes of 122 Sb and '1 24 Sb. The results of preliminary assays indicated the presence of Sb in Whatman no 40 filter paper used in the preparation of the synthetic standard, but at very low concentrations, which could be considered negligible. In the case of the plastic material used in bags for the sample irradiation, it should be chosen carefully, because depending on the thickness, they may contain Sb. The analyses of the stability of the diluted Sb standard solution showed no change in the Sb concentration within eight months after its preparation. Results obtained in the analysis of certified reference materials indicated the interference of 76 As and also of 134 Cs and 152 Eu in the Sb determinations by measuring '1 22 Sb, due to the proximity of the gamma ray energies. The high activity of '2 4 Na can also mask the peak of 122 Sb hindering its

  9. Synthesis of Ce(III)-doped Fe{sub 3}O{sub 4} magnetic particles for efficient removal of antimony from aqueous solution

    Energy Technology Data Exchange (ETDEWEB)

    Qi, Zenglu; Joshi, Tista Prasai [Key Laboratory of Drinking Water Science and Technology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Liu, Ruiping, E-mail: [Key Laboratory of Drinking Water Science and Technology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Liu, Huijuan [University of Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Environmental Aquatic Chemistry, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing, 100085 (China); Qu, Jiuhui [Key Laboratory of Drinking Water Science and Technology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, Beijing 100085 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)


    Highlights: • Doping of Ce into Fe{sub 3}O{sub 4} was achieved based on a facile solvothermal method. • After doping, the removal capacity was increased by 5 times for “Sb(V)” and 2 times for “Sb(III)”. • Decreasing pH improved adsorption of Sb(V) but decreased adsorption of Sb(III). • Antimony sorption mechanisms on Ce-doped Fe{sub 3}O{sub 4} were illustrated. - Abstract: Aqueous antimony (Sb) pollution from human activity is of great concern in drinking water due to its adverse health effect. Magnetic Fe{sub 3}O{sub 4} particles, with high separation ability from solution, have been considered as a low-cost Sb adsorbent for contaminants. However, the limited adsorption capacity has restricted its practical application. In this study, a solvothermal approach was developed for doping Ce(III) into Fe{sub 3}O{sub 4}, thereby increasing the adsorption efficacy for both Sb(III) and Sb(V). In contrast to un-doped Fe{sub 3}O{sub 4}, the adsorption capacity towards Sb(III) and Sb(V) in Ce-doped materials increased from 111.4 to 224.2 mg/g and from 37.2 to 188.1 mg/g at neutral pH, respectively. Based on the combined results of XPS, XRD, and FTIR, it confirmed that Ce atom successfully doped into the Fe{sub 3}O{sub 4} structure, resulting in the decreased particle size, increased the surface area, and isoelectric point. Furthermore, the vibrating sample magnetometer (VSM) results showed that the Ce doping process had some side effects on the primitive magnetic property, but remaining the high separation potential during water treatment. According to the high removal efficiency and magnetic property, the Ce-doped Fe{sub 3}O{sub 4} of great simplicity should be a promising adsorbent for aqueous Sb removal.

  10. No disease in the brain of a 115-year-old woman

    NARCIS (Netherlands)

    den Dunnen, Wilfred F. A.; Brouwer, Wiebo H.; Bijlard, Eveline; Kamphuis, Jeanine; van Linschoten, Klaas; Eggens-Meijer, Ellie; Holstege, Gert

    Are there limits to the duration of high quality of life? Are there limits to healthy life for a human brain? We have had the opportunity to evaluate the performance of a 112-113-year-old woman and perform full pathological examination of her body immediately after death at the age of 115. The

  11. 12 CFR 563b.115 - How will OTS review my business plan? (United States)


    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false How will OTS review my business plan? 563b.115... business plan? (a) OTS will review your business plan to determine that it demonstrates a safe and sound... will be determinative. OTS will review every case on its merits. (b) You must file your business plan...

  12. 13 CFR 107.115 - 1940 Act and 1980 Act Companies. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false 1940 Act and 1980 Act Companies... INVESTMENT COMPANIES Qualifying for an SBIC License Organizing An Sbic § 107.115 1940 Act and 1980 Act Companies. A 1940 Act or 1980 Act Company is eligible to apply for an SBIC license, and an existing Licensee...

  13. 33 CFR 165.115 - Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth, Massachusetts. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones... Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY REGULATED... Coast Guard District § 165.115 Safety and Security Zones; Pilgrim Nuclear Power Plant, Plymouth...

  14. 1.15

    African Journals Online (AJOL)

    Dean SPGS NAU 1.15. Abstract. In Nigeria, there are three main religions recognised by the people;. Christianity, Islam and the Indigenous religion. These religions have differences that have brought about unrest as the tolerance level has got to a point of polarity. The various unrests have led to national.

  15. alpha-particle radioactivity from LR 115 by two methods of analysis

    CERN Document Server

    Azkour, K; Adloff, J C; Pape, A


    LR115 track detectors were exposed to samples of Moroccan phosphate and phosphogypsum to measure their alpha-particle radioactivity. Then two formalisms were used for the dosimetry: simulation by a Monte Carlo method and determination of concentrations from a numerically integrated track registration equation. The results were compared with those deduced gamma-ray spectrometry.

  16. 47 CFR 15.115 - TV interface devices, including cable system terminal devices. (United States)


    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false TV interface devices, including cable system... FREQUENCY DEVICES Unintentional Radiators § 15.115 TV interface devices, including cable system terminal devices. (a) Measurements of the radiated emissions of a TV interface device shall be conducted with the...

  17. 14 CFR 152.115 - Grant agreement: Offer, acceptance, and amendment. (United States)


    ... agency's attorney must certify that the acceptance complies with all applicable law, and constitutes a... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Grant agreement: Offer, acceptance, and....115 Grant agreement: Offer, acceptance, and amendment. (a) Offer. Upon approving a project for airport...

  18. Hand Preference and Skill in 115 Children of Two Left-Handed Parents. (United States)

    Annett, Marian


    Studied hand skill and performance in children (N=115) of left-handed parents using peg moving tasks and soccer kicks. Concluded that being raised by two left-handed parents does little to hinder the expression of the rs plus gene. Correlations for handedness in families depend more on genetics than experience. (Author/JAC)

  19. Logos, Jesus en God in Johannes 1:1-5: 'N Tekstuele Analise ...

    African Journals Online (AJOL)

    In this article, the relationship between Christology and theology in John 1:1-5 is addressed. In particular, the relationship between the Logos and God has to be clarified. It is suggested that this relationship should be understood in the sense of communication between the Logos and God. This could then be interpreted ...

  20. 25 CFR 115.616 - What information will be included in BIA's final decision? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false What information will be included in BIA's final decision... Account § 115.616 What information will be included in BIA's final decision? BIA's final written decision to the parties involved in the proceeding will include: (a) BIA's decision to remove or retain the...

  1. An Experimental 11.5 T Nb3Sn LHC Type of Dipole Magnet

    NARCIS (Netherlands)

    den Ouden, A.; Wessel, Wilhelm A.J.; Krooshoop, Hendrikus J.G.; Dubbeldam, R.; ten Kate, Herman H.J.


    As part of the magnet development program for the LHC an experimental 1 m long 11.5 T single aperture Nb3Sn dipole magnet has been designed and is now under construction. The design is focused on full utilisation of the high current density in the powder tube Nb3Sn. A new field optimisation has led

  2. 33 CFR 80.115 - Portland Head, ME to Cape Ann, MA. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Portland Head, ME to Cape Ann, MA... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Atlantic Coast § 80.115 Portland Head, ME to Cape Ann... to Halibut Point at Cape Ann. (b) A line drawn from the southernmost tower on Gerrish Island charted...

  3. 25 CFR 115.709 - Will an annual audit be conducted on trust funds? (United States)


    ... has conducted an annual audit on a fiscal year basis of all the trust funds held by the United States... 25 Indians 1 2010-04-01 2010-04-01 false Will an annual audit be conducted on trust funds? 115.709... annual audit be conducted on trust funds? Yes, in accordance with the Trust Reform Act an annual audit...

  4. Baseline survey B11-5 on the German Continental Shelf

    NARCIS (Netherlands)

    Glorius, S.T.; Weide, van der B.E.; Kaag, N.H.B.M.


    A consortium, consisting of Wintershall Holding GmbH, GdF Suez, RWE Dea and EWE AG, is planning an exploration well in block B11-5, located within the Doggerbank (N2000 area). In order to assess any effect from this activity on the biological, physical and chemical properties of the seafloor

  5. 41 CFR 105-74.115 - Does this part affect the Federal contracts that I receive? (United States)


    ... Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION Regional Offices-General Services Administration 74-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Purpose and Coverage § 105-74.115 Does this part affect the Federal contracts that I...

  6. Bond scission cross sections for alpha-particles in cellulose nitrate (LR115)

    CERN Document Server

    Barillon, R; Chambaudet, A; Katz, R; Stoquert, J P; Pape, A


    Chemical damage created by alpha-particles in cellulose nitrate (LR115) have been studied by infrared spectroscopy. This technique enables identifying the sensitive bonds and giving an order of magnitude of their scission cross sections for given alpha-particle energies. The high cross sections observed suggest a new description of the track etch velocity in this material.

  7. 25 CFR 115.409 - How is an address for a minor's residence changed? (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false How is an address for a minor's residence changed? 115... minor's residence changed? (a) To change an address for a minor's residence, the custodial parent, legal... guardianship order, where applicable; (4) The new address of the minor's residence; and (5) The signature, mark...

  8. 46 CFR 115.710 - Inspection and testing prior to hot work. (United States)


    ...) Within or on the boundaries of fuel tanks; or (2) To pipelines, heating coils, pumps, fittings, or other appurtenances connected to fuel tanks. (b) An inspection required by paragraph (a) of this section must be... AND CERTIFICATION Repairs and Alterations § 115.710 Inspection and testing prior to hot work. (a) An...

  9. 14 CFR 65.115 - Senior parachute rigger certificate: Experience, knowledge, and skill requirements. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Senior parachute rigger certificate... CREWMEMBERS Parachute Riggers § 65.115 Senior parachute rigger certificate: Experience, knowledge, and skill requirements. Except as provided in § 65.117, an applicant for a senior parachute rigger certificate must— (a...

  10. 24 CFR 904.115 - Achievement of ownership by subsequent homebuyers. (United States)


    ... of the LHA's debt, if there are any subsequent homebuyers who have not acquired ownership of their... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Achievement of ownership by... Description § 904.115 Achievement of ownership by subsequent homebuyers. (a) Definition. In the event the...

  11. Conjugated fatty acid synthesis: residues 111 and 115 influence product partitioning of Momordica charantia conjugase. (United States)

    Rawat, Richa; Yu, Xiao-Hong; Sweet, Marie; Shanklin, John


    Conjugated linolenic acids (CLNs), 18:3 Δ(9,11,13), lack the methylene groups found between the double bonds of linolenic acid (18:3 Δ(9,12,15)). CLNs are produced by conjugase enzymes that are homologs of the oleate desaturases FAD2. The goal of this study was to map the domain(s) within the Momordica charantia conjugase (FADX) responsible for CLN formation. To achieve this, a series of Momordica FADX-Arabidopsis FAD2 chimeras were expressed in the Arabidopsis fad3fae1 mutant, and the transformed seeds were analyzed for the accumulation of CLN. These experiments identified helix 2 and the first histidine box as a determinant of conjugase product partitioning into punicic acid (18:3 Δ(9cis,11trans,13cis)) or α-eleostearic acid (18:3 Δ(9cis,11trans,13trans)). This was confirmed by analysis of a FADX mutant containing six substitutions in which the sequence of helix 2 and first histidine box was converted to that of FAD2. Each of the six FAD2 substitutions was individually converted back to the FADX equivalent identifying residues 111 and 115, adjacent to the first histidine box, as key determinants of conjugase product partitioning. Additionally, expression of FADX G111V and FADX G111V/D115E resulted in an approximate doubling of eleostearic acid accumulation to 20.4% and 21.2%, respectively, compared with 9.9% upon expression of the native Momordica FADX. Like the Momordica conjugase, FADX G111V and FADX D115E produced predominantly α-eleostearic acid and little punicic acid, but the FADX G111V/D115E double mutant produced approximately equal amounts of α-eleostearic acid and its isomer, punicic acid, implicating an interactive effect of residues 111 and 115 in punicic acid formation.

  12. Marys Lake 69/115-kV transmission line upgrade and substation expansion projects

    International Nuclear Information System (INIS)


    Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park

  13. Marys Lake 69/115-kV transmission line upgrade and substation expansion projects

    Energy Technology Data Exchange (ETDEWEB)



    Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park.

  14. Variability and exposure classification of urinary levels of non-essential metals aluminum, antimony, barium, thallium, tungsten and uranium in healthy adult men. (United States)

    Wang, Yi-Xin; Pan, An; Feng, Wei; Liu, Chong; Huang, Li-Li; Ai, Song-Hua; Zeng, Qiang; Lu, Wen-Qing


    Arsenic, cadmium and lead are well-known toxic metals, and there are substantial studies on variability of these metals in urine to optimize design of exposure assessment. For urinary levels of other nonessential metals such as aluminum (Al), antimony (Sb), barium (Ba), thallium (Tl), tungsten (W) and uranium (U), however, their within-individual and between-individual variability are unclear. Therefore, we collected 529 samples from 11 healthy adult men on 8 days during a 3-month period. We measured urinary metals and creatinine (Cr) levels, assessed the reproducibility using intraclass correlation coefficients (ICCs), and performed sensitivity and specificity analyses to assess how well 1, 2 or 3 specimens could classify exposure. Al, Sb, Ba, W and U levels measured from spot samples varied greatly over days and months (Cr-adjusted ICCs = 0.01-0.14). Serial measures of Tl levels measured from spot samples had fair-to-good reproducibility over 5 consecutive days (Cr-adjusted ICC = 0.40), but worsened when the specimens were collected months apart (Cr-adjusted ICC = 0.16). To identify men who were highly exposed (top 33%) based on their 3-month averages, tests of single spot samples and tests of first-morning voids had high specificities (0.73-0.85) but relatively low sensitivities (0.27-0.60). Collection of repeated urine specimens from each individual improved the classification.

  15. (Vapor + Liquid) Equilibrium (VLE) for Binary Lead-Antimony System in Vacuum Distillation: New Data and Modeling Using Nonrandom Two-Liquid (NRTL) Model (United States)

    Xu, Junjie; Kong, Lingxin; Xu, Baoqiang; Yang, Bin; You, Yanjun; Xu, Shuai; Zhou, Yuezhen; Li, Yifu; Liu, Dachun


    In this work, new experimental vapor-liquid equilibrium (VLE) data of lead-antimony alloy (Pb-Sb alloy) in vacuum distillation are reported. The activity coefficients of components of Pb-Sb alloy were calculated by using the NRTL model. The calculated average relative deviations were ±0.1425 and ±0.2433 pct, and the average standard deviations were ±0.0009 and ±0.0007, respectively, for Pb and Sb. The VLE phase diagrams, such as the temperature composition ( T- x) and pressure composition ( P-x) diagrams of Pb-Sb alloy in vacuum distillation were predicted based on the NRTL model and VLE theory. The predicted results are consistent with the new experimental data indicating that VLE phase diagrams obtained by this method are reliable. The VLE phase diagrams of alloys will provide an effective and intuitive way for the technical design and realization of recycling and separation processes. The VLE data may be used in separation processes design, and the thermodynamic properties as the key parameters in specific applications.

  16. Prediction of the percolation threshold and electrical conductivity of self-assembled antimony-doped tin oxide nanoparticles into ordered structures in PMMA/ATO nanocomposites. (United States)

    Jin, Youngho; Gerhardt, Rosario A


    Electrical percolation in nanocomposites consisting of poly(methyl methacrylate) (PMMA) and antimony tin oxide (ATO) nanoparticles was investigated experimentally using monosize and polydisperse polymer particles. The nanocomposites were fabricated by compression molding at 170 °C. The matrix PMMA was transformed into space filling polyhedra while the ATO nanoparticles distributed along the sharp edges of the matrix, forming a 3D interconnected network. The measured electrical resistivity showed that percolation was achieved in these materials at a very low ATO content of 0.99 wt % ATO when monosize PMMA was used, whereas 1.48 wt % ATO was needed to achieve percolation when the PMMA was polydispersed. A parametric finite element approach was chosen to model this unique microstructure-driven self-assembling percolation behavior. COMSOL Multiphysics was used to solve the effects of phase segregation between the matrix and the filler using a 2D simplified model in the frequency domain of the AC/DC module. It was found that the percolation threshold (pc) is affected by the size ratio between the matrix and the filler in a systematic way. Furthermore, simulations indicate that small deviations from perfect interconnection result mostly in changes in the electrical resistivity while the minimum DC resistivity achievable in any given composite is governed by the electrical conductivity of the filler, which must be accurately known in order to obtain an accurate prediction. The model is quite general and is able to predict percolation behavior in a number of other similarly processed segregated network nanocomposites.

  17. Simplified sample preparation in the simultaneous measurement of whole blood antimony, bismuth, manganese, and zinc by inductively coupled plasma mass spectrometry. (United States)

    Haglock-Adler, Carrie J; Strathmann, Frederick G


    We developed and validated a simplified sample preparation for the analysis of antimony (Sb), bismuth (Bi), manganese (Mn), and zinc (Zn) in whole blood. This simplification included a reduction in sample volume, removal of a lengthy acidic digestion, and optimization of the internal standard. Measurement of Sb, Bi, Mn and Zn in whole blood was conducted using inductively coupled-plasma mass spectrometry. Method performance characteristics, including intra- and inter-assay imprecision, accuracy, linearity, AMR, sensitivity, carryover, sample stability and assay stability were determined in accordance with clinical laboratory standards. In addition, analytical and clinical recoveries were assessed to investigate comparability between goat blood matrix and pooled patient blood. Established assay performance characteristics included inter- and intra-assay imprecision samples, proficiency testing samples, and comparison to an outside reference laboratory. This method overcomes the laborious acidic heat digestion previously used and replaces it with a simplified sample preparation involving an alkaline dilution. The method requires minimal sample preparation with the dilution of alkaline diluent and is validated to quantify Sb and Bi from 1 to 25 μg/L, Mn from 1 to 80 μg/L, and Zn from 50 to 1500 μg/dL in whole blood. Copyright © 2014 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  18. Migration of antimony from PET trays into food simulant and food: determination of Arrhenius parameters and comparison of predicted and measured migration data. (United States)

    Haldimann, M; Alt, A; Blanc, A; Brunner, K; Sager, F; Dudler, V


    Migration experiments with small sheets cut out from ovenable PET trays were performed in two-sided contact with 3% acetic acid as food simulant at various temperatures. The fraction of diffusible antimony (Sb) was estimated to be 62% in the PET sample under study. Apparent diffusion coefficients of Sb in PET trays were determined experimentally. Measurement of migration between 20 and 150°C yielded a linear Arrhenius plot over a wide temperature range from which the activation energy (E(a)) of 188 ± 36 kJ mol(-1) and the pre-exponential factor (D(0)) of 3.6 × 10(14) cm(2) s(-1) were determined for diffusing Sb species. E (a) was similar to previously reported values for PET bottles obtained with a different experimental approach. E (a) and D (0) were applied as model parameters in migration modelling software for predicting the Sb transfer in real food. Ready meals intended for preparation in a baking oven were heated in the PET trays under study and the actual Sb migration into the food phase was measured by isotope dilution ICP-MS. It was shown that the predictive modelling reproduces correctly experimental data.

  19. Effects of storage temperature and duration on release of antimony and bisphenol A from polyethylene terephthalate drinking water bottles of China. (United States)

    Fan, Ying-Ying; Zheng, Jian-Lun; Ren, Jing-Hua; Luo, Jun; Cui, Xin-Yi; Ma, Lena Q


    We investigated effects of storage temperature and duration on release of antimony (Sb) and bisphenol A (BPA) from 16 brands of polyethylene terephthalate (PET) drinking water bottles in China. After 1-week storage, Sb release increased from 1.88-8.32 ng/L at 4 °C, to 2.10-18.4 ng/L at 25 °C and to 20.3-2604 ng/L at 70 °C. The corresponding releases for BPA were less at 0.26-18.7, 0.62-22.6, and 2.89-38.9 ng/L. Both Sb and BPA release increased with storage duration up to 4-week, but their releasing rates decreased with storage time, indicating that Sb and BPA release from PET bottles may become stable under long term storage. Human health risk was evaluated based on the worst case, i.e., storage at 70 °C for 4-week. Chronic daily intake (CDI) caused by BPA release was below USEPA regulation, Sb release in one brand exceeded USEPA regulated CDI (400 ng/kg bw/d) with values of 409 and 1430 ng/kg bw/d for adult and children. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Microstructure and Electrical Properties of Antimony Telluride Thin Films Deposited by RF Magnetron Sputtering on Flexible Substrate Using Different Sputtering Pressures (United States)

    Khumtong, T.; Sukwisute, P.; Sakulkalavek, A.; Sakdanuphab, R.


    The microstructural, electrical, and thermoelectric properties of antimony telluride (Sb2Te3) thin films have been investigated for thermoelectric applications. Sb2Te3 thin films were deposited on flexible substrate (polyimide) by radiofrequency (RF) magnetron sputtering from a Sb2Te3 target using different sputtering pressures in the range from 4 × 10-3 mbar to 1.2 × 10-2 mbar. The crystal structure, [Sb]:[Te] ratio, and electrical and thermoelectric properties of the films were analyzed by grazing-incidence x-ray diffraction (XRD) analysis, energy-dispersive x-ray spectroscopy (EDS), and Hall effect and Seebeck measurements, respectively. The XRD spectra of the films demonstrated polycrystalline structure with preferred orientation of (015), (110), and (1010). A high-intensity spectrum was found for the film deposited at lower sputtering pressure. EDS analysis of the films revealed the effects of the sputtering pressure on the [Sb]:[Te] atomic ratio, with nearly stoichiometric films being obtained at higher sputtering pressure. The stoichiometric Sb2Te3 films showed p-type characteristics with electrical conductivity, carrier concentration, and mobility of 35.7 S cm-1, 6.38 × 1019 cm-3, and 3.67 cm2 V-1 s-1, respectively. The maximum power factor of 1.07 × 10-4 W m-1 K-2 was achieved for the film deposited at sputtering pressure of 1.0 × 10-2 mbar.